WO2017106656A1 - Antibody molecules to pd-1 and uses thereof - Google Patents
Antibody molecules to pd-1 and uses thereof Download PDFInfo
- Publication number
- WO2017106656A1 WO2017106656A1 PCT/US2016/067200 US2016067200W WO2017106656A1 WO 2017106656 A1 WO2017106656 A1 WO 2017106656A1 US 2016067200 W US2016067200 W US 2016067200W WO 2017106656 A1 WO2017106656 A1 WO 2017106656A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- acid sequence
- cancer
- antibody molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- T cells The ability of T cells to mediate an immune response against an antigen requires two distinct signaling interactions (Viglietta, V. et al. (2007) Neurotherapeutics 4:666-675; Korman, A. J. et al. (2007) Adv. Immunol.90:297-339).
- APC antigen-presenting cells
- TCR T cell receptor
- the immune system is tightly controlled by a network of costimulatory and co-inhibitory ligands and receptors. These molecules provide the second signal for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection, while limiting immunity to self (Wang, L. et al. (Epub Mar.7, 2011) J. Exp. Med.208(3):577-92; Lepenies, B. et al. (2008) Endocrine, Metabolic & Immune Disorders--Drug Targets 8:279-288).
- costimulatory signals include the binding between the B7.1 (CD80) and B7.2 (CD86) ligands of the APC and the CD28 and CTLA-4 receptors of the CD4 + T-lymphocyte (Sharpe, A. H. et al. (2002) Nature Rev. Immunol.2:116-126; Lindley, P. S. et al. (2009) Immunol. Rev.229:307-321). Binding of B7.1 or B7.2 to CD28 stimulates T cell activation, whereas binding of B7.1 or B7.2 to CTLA-4 inhibits such activation (Dong, C. et al. (2003) Immunolog. Res.28(1):39-48; Greenwald, R. J. et al. (2005) Ann. Rev.
- CD28 is constitutively expressed on the surface of T cells (Gross, J., et al. (1992) J. Immunol.149:380-388), whereas CTLA-4 expression is rapidly up- regulated following T-cell activation (Linsley, P. et al. (1996) Immunity 4:535-543).
- B7 Superfamily B7 Superfamily
- FIG. 1 A. J. et al. (2001) Nature Immunol.2(3):203-209; Sharpe, A. H. et al. (2002) Nature Rev. Immunol.2:116-126; Collins, M. et al. (2005) Genome Biol.6:223.1-223.7; Korman, A. J. et al. (2007) Adv. Immunol.90:297-339).
- B7 Superfamily Several members of the B7 Superfamily are known, including B7.1 (CD80), B7.2 (CD86), the inducible co-stimulator ligand (ICOS-L), the programmed death-1 ligand (PD-L1; B7-H1), the programmed death-2 ligand (PD-L2; B7-DC), B7- H3, B7-H4 and B7-H6 (Collins, M. et al. (2005) Genome Biol.6:223.1-223.7).
- the Programmed Death 1 (PD-1) protein is an inhibitory member of the extended
- CD28/CTLA-4 family of T cell regulators (Okazaki et al. (2002) Curr Opin Immunol 14: 391779-82; Bennett et al. (2003) J. Immunol.170:711-8).
- Other members of the CD28 family include CD28, CTLA-4, ICOS and BTLA.
- PD-1 is suggested to exist as a monomer, lacking the unpaired cysteine residue characteristic of other CD28 family members. PD-1 is expressed on activated B cells, T cells, and monocytes.
- the PD-1 gene encodes a 55 kDa type I transmembrane protein (Agata et al. (1996) Int Immunol.8:765-72). Although structurally similar to CTLA-4, PD-1 lacks the MYPPY motif (SEQ ID NO: 236) that is important for B7-1 and B7-2 binding.
- Two ligands for PD-1 have been identified, PD-L1 (B7-H1) and PD-L2 (B7-DC), that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) J. Exp. Med.192:1027-34; Carter et al. (2002) Eur. J.
- Both PD-L1 and PD-L2 are B7 homologs that bind to PD-1, but do not bind to other CD28 family members.
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med.8:787-9).
- PD-1 is known as an immunoinhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J.11:3887-3895; Blank, C. et al. (Epub 2006 Dec.29) Immunol. Immunother. 56(5):739-745).
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to, e.g., a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and/or immune evasion by cancerous cells (Dong et al. (2003) J. Mol. Med.81:281-7; Blank et al. (2005) Cancer Immunol.
- immunoinhibitory proteins such as PD-1, thus leading to activation of the immune system.
- Such agents can be used, e.g., for cancer immunotherapy and treatment of other conditions, such as chronic infection.
- antibody molecules e.g., humanized antibody molecules
- PD-1 Programmed Death 1
- Nucleic acid molecules encoding the antibody molecules, expression vectors, host cells and methods for making the antibody molecules are also provided.
- Pharmaceutical compositions and dose formulations comprising the antibody molecules are also provided.
- the anti-PD-1 antibody molecules disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent and/or diagnose disorders, such as cancerous disorders (e.g., solid and soft-tissue tumors), as well as infectious diseases (e.g., chronic infectious disorders or sepsis).
- compositions and methods for detecting PD-1, as well as methods for treating various disorders including cancer and/or infectious diseases, using the anti-PD-1 antibody molecules are disclosed herein.
- the anti-PD-1 antibody molecule is administered or used at a flat or fixed dose.
- the invention features a method of treating (e.g., inhibiting, reducing, ameliorating, or preventing) a disorder, e.g., a hyperproliferative condition or disorder (e.g., a cancer) in a subject.
- the method includes administering to the subject an anti-PD-1 antibody molecule, e.g., an anti-PD-1 antibody molecule described herein, at a dose of about 300 mg to 400 mg once every three weeks or once every four weeks.
- the anti-PD-1 antibody molecule is administered at a dose of about 300 mg once every three weeks. In other embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks.
- the disorder is a cancer, e.g., a cancer described herein.
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In one embodiment, the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma. In other embodiments, the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2- negative breast cancer.
- TNBC triple negative breast cancer
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., a clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- GI gastrointestinal
- the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non-small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks or about 300 mg once every three weeks to treat a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC). In some embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 300 mg once every three weeks to treat a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non-small cell lung cancer
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In certain embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a Merkel cell carcinoma. In other embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a melanoma. In some embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer.
- TNBC triple negative breast cancer
- the anti- PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC). In some embodiments, the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- GI gastrointestinal
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a kidney cancer, e.g., a renal cell carcinoma (e.g., a clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- a renal cell carcinoma e.g., a clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat an ovarian cancer.
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a fallopian tube cancer.
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a colorectal cancer (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- a colorectal cancer e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a leukemia (e.g., an AML, e.g., a relapsed or refractory AML or a de novo AML).
- the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks to treat a myelodysplastic syndrome (MDS) (e.g.,
- the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 100 mg to 600 mg, e.g., about 200 mg to 500 mg, e.g., about 100 mg to 300 mg, about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 100 mg, about 200 mg, about 300 mg, or about 400 mg.
- the dosing schedule (e.g., flat dosing schedule) can vary from e.g., once a week to once every 2, 3, 4, 5, or 6 weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every three weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every three weeks.
- the invention features a method of reducing an activity (e.g., growth, survival, or viability, or all), of a hyperproliferative (e.g., a cancer) cell.
- the method includes contacting the cell with an anti-PD-1 antibody molecule, e.g., an anti-PD-1 antibody molecule described herein.
- the method can be performed in a subject, e.g., as part of a therapeutic protocol, e.g., at a dose of about 300 mg to 400 mg of an anti-PD-1 antibody molecule once every three weeks or once every four weeks, In certain embodiments, the dose is about 300 mg of an anti-PD-1 antibody molecule once every three weeks.
- the dose is about 400 mg of an anti-PD-1 antibody molecule once every four weeks.
- the cancer cell can be, e.g., a cell from a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), ovarian cancer, fallopian tube cancer, colorectal cancer, or breast cancer.
- a cancer described herein such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In one embodiment, the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma. In other embodiments, the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer. In other embodiments, the cancer is a kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)). In other embodiments, the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- ATC an anaplastic thyroid carcinoma
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- the cancer is a lung cancer, e.g., a non- small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non- small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the invention features a composition (e.g., one or more compositions or dosage forms), that includes an anti-PD-1 antibody molecule (e.g., an anti-PD-1 antibody molecule as described herein).
- a composition e.g., one or more compositions or dosage forms
- an anti-PD-1 antibody molecule e.g., an anti-PD-1 antibody molecule as described herein.
- Formulations, e.g., dosage formulations, and kits, e.g., therapeutic kits, that include an anti-PD-1 antibody molecule (e.g., an anti-PD-1 antibody molecule as described herein) are also described herein.
- the composition or formulation comprises 300 mg or 400 mg of an anti-PD-1 antibody molecule (e.g., an anti-PD-1 antibody molecule as described herein).
- the composition of formulation is administered or used once every three weeks or once every four weeks.
- compositions comprising a combination of two, three or more therapeutic agents chosen from one, two, or all of the following categories (i)-(iii): (i) an agent that enhances antigen presentation (e.g., tumor antigen presentation); (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression.
- the combination includes an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule as described herein).
- the anti-PD-1 antibody molecule is administered or used at a flat or fixed dose.
- therapeutic approaches that enhance anti-tumor immunity work more effectively when the immune response is optimized by targeting multiple components at one or more stages of an immune response, e.g., an anti-tumor immune response.
- approaches that enhance antigen presentation e.g., by activation and/or maturation of dendritic cells
- approaches that enhance cellular and humoral immune responses e.g., by stimulating, e.g., disinhibiting, phagocytes and/or tumor infiltrating lymphocytes (e.g., NK cells and T cells)
- tumor immunosuppressive signaling e.g., by increasing macrophage polarization, increasing T reg depletion and/or decreasing myeloid-derived suppressive cells (MDSCs)
- MDSCs myeloid-derived suppressive cells
- combination therapies that optimize one, two, or all of: (i) antigen presentation, e.g., increasing antigen presentation (e.g., by enhancing one or more of dendritic cell activity or maturation, antigen uptake, or antigen processing); (ii) effector cell response, e.g., increasing effector cell response (e.g., enhancing B cell and/or T cell activation and/or mobilization, e.g., in the lymph node); or (iii) tumor immunosuppression, e.g., decreasing tumor
- immunosuppression e.g., increasing T cell infiltration and tumor cell killing.
- the combinations described herein can provide a superior beneficial effect, e.g., in the treatment of a disorder, such as an enhanced anti-cancer effect, reduced toxicity and/or reduced side effects, compared to monotherapy administration of the therapeutic agents in the combination.
- a superior beneficial effect e.g., in the treatment of a disorder, such as an enhanced anti-cancer effect, reduced toxicity and/or reduced side effects
- one or more of the therapeutic agents in the combination can be administered at a lower dosage, or for a shorter period of administration, than would be required to achieve the same therapeutic effect compared to the monotherapy administration.
- compositions and methods for treating cancer and other immune disorders using the aforesaid combination therapies are disclosed.
- the invention features a method of treating (e.g., inhibiting, reducing, ameliorating, or preventing) a disorder, e.g., a hyperproliferative condition or disorder (e.g., a cancer) in a subject.
- a disorder e.g., a hyperproliferative condition or disorder (e.g., a cancer) in a subject.
- the method includes administering to the subject a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby treating the disorder, e.g., the hyperproliferative condition or disorder (e.g., the cancer).
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the cancer treated can be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), or breast cancer.
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
- the cancer is a Merkel cell carcinoma.
- the cancer is a melanoma.
- the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2- negative breast cancer.
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- NET neuroendocrine tumor
- GI gastrointestinal
- the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non-small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- the cancer is a myelodysplastic syndrome (MDS) (e.g., a high risk MDS).
- MDS myelodysplastic syndrome
- the invention features a method of reducing an activity (e.g., growth, survival, or viability, or all), of a hyperproliferative (e.g., a cancer) cell.
- the method includes contacting the cell with a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby reducing an activity in the hyperproliferative cell.
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the method can be performed in a subject, e.g., as part of a therapeutic protocol.
- the cancer cell can be, e.g., a cell from a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), ovarian cancer, fallopian tube cancer, colorectal cancer, or breast cancer.
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
- the cancer is a Merkel cell carcinoma.
- the cancer is a melanoma.
- the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer.
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor, or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non-small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the method further includes determining the level of an immune cell (e.g., a T cell) infiltrate (e.g., the level of tumor infiltrating lymphocytes (TIL)) in the subject.
- an immune cell e.g., a T cell
- TIL tumor infiltrating lymphocytes
- the level of the immune cell infiltrate is determined in vivo, e.g., non-invasively (e.g., by detecting an antibody to a T cell marker detectably labeled using a suitable imaging technique, e.g., positron emission tomography (PET) scan).
- PET positron emission tomography
- the level of the immune cell infiltrate is determined in a sample (e.g., a tumor biopsy) acquired from the subject (e.g., using immunohistochemical techniques).
- one or more agents of categories (i) or (ii), or both (i) and (ii), is/are administered.
- one or more agents of category (iii) is/are administered.
- the detection steps can also be used, e.g., to monitor the effectiveness of a therapeutic agent described herein.
- the detection step can be used to monitor the effectiveness of therapeutic agents of categories (i), (ii) and/or (iii).
- the invention features a composition (e.g., one or more compositions or dosage forms), that includes a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor immunosuppression.
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the invention features a composition (e.g., one or more compositions or dosage forms as described herein), for use in treating a disorder, e.g., a cancer.
- the composition for use includes a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor immunosuppression.
- the combination used includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the cancer can be, e.g., a cancer described herein, such as lung cancer
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In one embodiment, the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma.
- the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer.
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor, or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- NET neuroendocrine tumor
- GI gastrointestinal
- the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non-small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- Formulations e.g., dosage formulations, and kits, e.g., therapeutic kits, that include a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor immunosuppression, thereby reducing an activity in the cell, and (optionally) instructions for use, are also disclosed.
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the combinations of therapeutic agents disclosed herein include two or more therapeutic agents described herein.
- the therapeutic agents in the combination can belong to the same category, e.g., two or more therapeutic agents of category (i), or can include at least one agent of two or more categories (e.g., a therapeutic agent of category (i) combined with a therapeutic agent of category (ii)), as described below.
- Certain therapeutic agents can belong to two or more categories of categories (i)- (iii).
- a therapeutic agent e.g., a GITR agonist, an IDO antagonist, a TGF-b inhibitor, among others
- Additional features or embodiments of the methods, compositions, dosage formulations, and kits described herein include one or more of the following: Combinations
- the combination includes one, two, three, four or more therapeutic agents that enhance antigen (e.g., tumor antigen) presentation (referred to herein as an“antigen- presentation combination”).
- the antigen presentation combination includes one or more of: an agent that enhances antigen presentation (e.g., a vaccine, e.g., a cell- or antigen- based vaccine); an agent that enhances lysis of tumor cells (e.g., an oncolytic virus); an agent that stimulates (e.g., disinhibits) a phagocyte, e.g., a Type I interferon (IFN) activator (e.g., a TLR agonist, a RIG-I-like receptor agonist (RLRs)), and/or an agent that activates and/or recruits a dendritic cell or a macrophage (e.g., a macrophage I), e.g., a bi- or tri-specific cell engager.
- IFN Type I interferon
- the antigen-presentation combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) an agonist of Stimulator of Interferon Genes (a STING agonist), (ii) an agonist of a Toll-like receptor (TLR) (e.g., an agonist of TLR-3, -4, -5, -7, -8, or -9), (iii) a TIM-3 modulator (e.g., an anti-TIM-3 antibody molecule), (iv) a vascular endothelial growth factor receptor (VEGFR) inhibitor, (v) a c-Met inhibitor, (vi) a TGFb inhibitor (e.g., an anti- TGFb antibody), (vii) an IDO/TDO inhibitor, (viii) an A2AR antagonist, (ix) an oncolytic virus, (x) a vaccine (e.g., a scaffold vaccine), or (xi) a bi- or tri-specific cell engager.
- TLR Toll-like receptor
- the antigen-presentation combination includes a STING agonist.
- the antigen-presentation combination includes a TLR agonist (e.g., a TLR7 agonist).
- the antigen-presentation combination includes a STING agonist and a TLR agonist (e.g., a TLR7 agonist).
- the antigen presentation combination is chosen from a STING agonist, a TLR agonist, an A2AR antagonist, or an oncolytic virus or a combination thereof, and optionally, one or more of (iii)-(vii) or (x)-(xi).
- the antigen presentation combination is chosen from a STING agonist or a TLR agonist, or a combination of both, and optionally, one or more of (iii)-(xi).
- the antigen-presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a TIM-3 modulator (e.g., an anti-TIM-3 inhibitor).
- the antigen-presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a VEGFR inhibitor.
- the antigen-presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a c-MET inhibitor.
- the antigen-presenting combination includes an oncolytic virus.
- the antigen-presenting combination includes an oncolytic virus and a cytokine, e.g., an oncolytic virus expressing one or more of GM-CSF, or a CSF (e.g., CSF1, or CSF2).
- the antigen-presenting combination includes a bi- or tri-specific cell engager, e.g., a bi- or tri-specific antibody molecule to CD47 and CD19, with or without an Fc domain.
- the antigen-presenting combination includes a TGFb inhibitor (e.g., an anti-TGFb antibody).
- the antigen-presenting combination includes an IDO/TDO inhibitor.
- the antigen-presenting combination includes an A2AR antagonist.
- the antigen-presenting combination includes a vaccine (e.g., IL-2 in combination with MUC1, or a dendritic cell based vaccine (e.g., Provenge®)).
- the antigen-presenting combination includes a vaccine and a TLR agonist (e.g., a TLR agonist as described herein).
- the antigen-presentation combination includes a vaccine and a STING agonist.
- the antigen- presentation combination includes a vaccine, a STING agonist and a TLR agonist.
- the combination includes one, two, three, four, five or more therapeutic agents that enhance an effector cell response (referred to herein as an“effector cell combination”).
- the effector cell combination includes a lymphocyte activator, e.g., an NK cell activator and/or a T cell activator.
- the effector cell combination activates (e.g., disinhibits) a tumor infiltrating lymphocyte (TIL), e.g., an NK cell or a T cell.
- TIL tumor infiltrating lymphocyte
- the effector cell combination includes an NK cell modulator chosen from a modulator (e.g., an antibody molecule) of an NK receptor (e.g., a modulator of one or more of NKG2A, KIR3DL, NKp46, MICA or CEACAM1); an interleukin or an interleukin variant (e.g., IL-2, IL-15, IL-21, IL-13R or IL-12 cytokine or variant thereof, or a combination thereof); a bi- or tri- specific cell engager (e.g., a bispecific antibody molecule of NKG2A and CD138, or a bispecific antibody molecule of CD3 and TCR); an NK cell therapy; or a vaccine that includes NK cells and an antigen/immune stimulant.
- a modulator e.g., an antibody molecule
- an NK receptor e.g., a modulator of one or more of NKG2A, KIR3DL, NKp46, MICA or CE
- the effector cell combination includes an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule as described herein).
- the effector cell combination includes a T cell modulator chosen from an inhibitor of a checkpoint inhibitor (e.g., an inhibitor of one or more of: PD-1, PD-L1, TIM-3, LAG-3, VISTA, DKG- ⁇ , B7-H3, B7-H4, TIGIT, CTLA-4, BTLA, CD160, TIM1, IDO, LAIR1, IL-12, or a combination thereof, e.g., an inhibitor of PD-1 and TIM-3, or an inhibitor of PD-1 and LAG-3).
- an inhibitor of PD-1 and TIM-3 e.g., an inhibitor of PD-1 and TIM-3, or an inhibitor of PD-1 and LAG-3.
- the inhibitor of the checkpoint inhibitor is an antibody molecule (e.g., a mono- or bispecific antibody or fragment thereof as described herein).
- the inhibitor of the checkpoint inhibitor is an antibody molecule against PD-1, PD-L1, TIM-3, LAG-3, VISTA, B7-H4, CTLA-4 or TIGIT, or any combination thereof (e.g. a combination as described herein).
- the effector cell combination includes a T cell modulator chosen from an agonist or an activator of a costimulatory molecule.
- the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of GITR, OX40, ICOS, SLAM (e.g., SLAMF7), HVEM, LIGHT, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, CD7, NKG2C, NKp80, CD160, B7-H3, or CD83 ligand.
- an agonist e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
- GITR e.g., OX40, ICOS
- SLAM e.g., SLAMF7
- HVEM e.g., SLAMF7
- HVEM HVEM
- LIGHT LIGHT
- the effector cell combination includes a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
- a bispecific T cell engager e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
- the effector cell combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) a GITR modulator (e.g., a GITR agonist), (ii) a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), (iii) a PD-L1 inhibitor, (iv) an inhibitor of IAP (Inhibitor of Apoptosis Protein), (v) an inhibitor of EGFR (Epidermal Growth Factor Receptor), (vi) an inhibitor of target of rapamycin (mTOR), (vii) IL-15 or a variant thereof, (viii) a CTLA-4 inhibitor, (ix) a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others), (x) a CD40 agonist (e.g., an anti-GITR modul
- the effector cell combination includes a GITR agonist.
- the effector cell combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the effector cell combination includes a PD-L1 inhibitor.
- the effector cell combination includes a GITR agonist and a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- the effector cell combination includes a GITR agonist and a PD-L1 inhibitor.
- the effector cell combination includes a GITR agonist, a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), and a PD-L1 inhibitor. In other embodiments, the effector cell combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), and a PD-L1 inhibitor. In one embodiment, the effector cell combination includes a GITR agonist and an inhibitor of IAP. In another embodiment, the effector cell combination includes a GITR agonist and an inhibitor of an EGFR inhibitor. In yet another embodiment, the effector cell combination includes a GITR agonist and an inhibitor of an mTOR inhibitor.
- the effector cell combination includes IL-15 or a variant thereof. In one embodiment, the effector cell combination includes a CTLA-4 inhibitor. In one embodiment, the effector cell combination includes a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others). In one embodiment, the effector cell combination includes a CD40 agonist (e.g., an anti-CD40 antibody molecule). In one embodiment, the effector cell combination includes an OX40 agonist (e.g., an anti-OX40 antibody molecule). In one embodiment, the effector cell combination includes a CD27 agonist (e.g., an anti-CD27 antibody molecule).
- a bispecific T cell engager e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among
- the combination includes one, two, three, four, five or more therapeutic agents that decrease tumor immunosuppression (referred to herein as an“anti-tumor immunosuppression combination”).
- the combination modulates the activity or level of one or more of T reg , macrophage 2 or MDSCs.
- the combination increases one or more of M2 polarization, T reg depletion, or T cell recruitment.
- the anti-tumor immunosuppression combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule (e.g., a GITR agonist), or an inhibitor of an immune checkpoint molecule (e.g., one or more of PD-1, PD-L1, LAG-3, TIM-3 or CTLA-4), as described herein), (ii) a CSF-1/1R inhibitor (e.g., an inhibitor of macrophage colony-stimulating factor (M-CSF)), (iii) an IL-17 inhibitor, (iv) an IL-1 ⁇ inhibitor, (v) a CXCR2 inhibitor, (vi) an inhibitor of a phosphoinositide 3- kinase (PI3K, e.g., PI3K ⁇ or PI3K ⁇ ), (vii) a BAFF-R inhibitor, (viii) a M-CSF
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), or CTLA-4, or any combination thereof). Any combination of the aforesaid agents can be used in the tumor immunosuppression combination.
- an immune checkpoint molecule e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), or CTLA-4, or any combination thereof.
- the anti-tumor immunosuppression combination includes one, two, three, four, five or more therapeutic agents chosen from a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), a PD-L1 inhibitor, a LAG-3 inhibitor, a TIM-3 modulator (e.g., an anti-TIM-3 inhibitor), a GITR agonist, a CSF-1/1R inhibitor (e.g., an M-CSF inhibitor), an IL-17 inhibitor, an IL-1 ⁇ inhibitor, or a CXCR2 inhibitor.
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein
- a PD-L1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein
- a PD-L1 inhibitor e.g., a PD-L1 inhibitor
- LAG-3 inhibitor e.g., an anti-TIM-3 inhibitor
- a TIM-3 modulator e.g., an anti-TIM
- immunosuppression combination includes one, two, or all of a CSF-1/1R inhibitor (e.g., an M-CSF inhibitor), an IL-17 inhibitor, an IL-1 ⁇ inhibitor.
- a CSF-1/1R inhibitor e.g., an M-CSF inhibitor
- an IL-17 inhibitor e.g., an IL-17 inhibitor
- an IL-1 ⁇ inhibitor e.g., an IL-1 ⁇ inhibitor.
- immunosuppression combination includes an IL-17 inhibitor, a CXCR2 inhibitor, a CRTH2 inhibitor, an A2AR antagonist, or a PFKFB3 inhibitor, or a combination thereof.
- the combination includes one or more therapeutic agents of the antigen-presentation combination. In other embodiments, the combination includes one or more therapeutic agents of the effector cell combination. In yet other embodiments, the combination includes one or more therapeutic agents of the anti-tumor immunosuppression combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation combination and one or more therapeutic agents of the effector cell combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation combination and one or more therapeutic agents of the anti-tumor immunosuppression combination.
- the combination includes one or more therapeutic agents of the antigen- presentation combination, one or more therapeutic agents of the effector cell combination and one or more therapeutic agents of the anti-tumor immunosuppression combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation combination, one or more therapeutic agents of the effector cell combination and one or more therapeutic agents of the anti-tumor immunosuppression combination.
- the combination includes:
- one or more therapeutic agents of the antigen-presentation combination chosen from one, two or all of a STING agonist, a TLR agonist (e.g., a TLR7 agonist), or a TIM-3 modulator (e.g., a TIM-3 inhibitor);
- one or more therapeutic agents of the effector cell combination chosen from one, two or all of a GITR modulator (e.g., a GITR agonist), a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), or a PD-L1 inhibitor;
- a GITR modulator e.g., a GITR agonist
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein
- a PD-L1 inhibitor e.g., one or more therapeutic agents of the effector cell combination chosen from one, two or all of a GITR modulator (e.g., a GITR agonist), a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), or a PD-L1 inhibitor;
- one or more therapeutic agents of the anti-tumor immunosuppression combination chosen from one, two or all of a CSF-1/1R inhibitor (e.g., an M-CSF inhibitor), an IL-17 inhibitor, or an IL- 1 ⁇ inhibitor:
- the combination can be used to treat a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma (e.g., advanced melanoma), nasopharyngeal cancer, kidney cancer, neuroendocrine tumor (NET), ovarian cancer, fallopian tube cancer, colorectal cancer, or breast cancer.
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
- the cancer is a Merkel cell carcinoma.
- the cancer is a melanoma.
- the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer.
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- GI gastrointestinal
- the cancer is a lung cancer, e.g., a non- small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non- small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the combination includes a therapeutic agent from the antigen- presentation combination (e.g., one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus) in combination with a therapeutic agent from the effector cell and/or anti-tumor immunosuppression combination (e.g., an inhibitor of a checkpoint inhibitor, e.g., an inhibitor of PD- 1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), or CTLA-4, or any combination thereof.
- a therapeutic agent from the antigen- presentation combination e.g., one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus
- a therapeutic agent from the effector cell and/or anti-tumor immunosuppression combination e.g., an inhibitor of a checkpoint inhibitor, e.g., an inhibitor of PD- 1, PD-L1, LAG-3,
- one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus is administered in combination with an anti-PD-1 antibody molecule as described herein.
- a STING agonist and/or a vaccine is administered in combination with an anti-PD-1 antibody molecule as described herein.
- an oncolytic virus is administered in combination with an anti-PD-1 antibody molecule as described herein.
- the combination can be used to treat a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma (e.g., advanced melanoma), nasopharyngeal cancer, kidney cancer, neuroendocrine tumor (NET), ovarian cancer, fallopian tube cancer, colorectal cancer, or breast cancer.
- the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
- the cancer is a Merkel cell carcinoma.
- the cancer is a melanoma.
- the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC) or a HER2-negative breast cancer.
- the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC)).
- the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
- the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor or an NET in pancreas, gastrointestinal (GI) tract, or lung.
- NET neuroendocrine tumor
- GI gastrointestinal
- the cancer is a lung cancer, e.g., a non- small cell lung cancer (NSCLC) (e.g., a squamous NSCLC or a non-squamous NSCLC).
- NSCLC non- small cell lung cancer
- the cancer is an ovarian cancer.
- the cancer is a fallopian tube cancer.
- the cancer is a colorectal cancer (CRC) (e.g., a microsatellite instability-high colorectal cancer (MSI-high CRC) or a microsatellite stable colorectal cancer (MSS CRC)).
- CRC colorectal cancer
- MSI-high CRC microsatellite instability-high colorectal cancer
- MSS CRC microsatellite stable colorectal cancer
- the cancer is a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the combination includes a combination of therapeutic agents as provided in the section entitled“Exemplary Combinations of Antigen-Presentation Combinations, Effector Cell Combinations and Anti-tumor Immunosuppression Combinations” provided in the Detailed Description.
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an IAP inhibitor, (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2- oxoethyl)-2-(methylamino)propanamide (Compound A21), or a compound disclosed in U.S. Patent No.8,552,003.
- an inhibitor of an immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein)
- IAP inhibitor e.g., an IAP inhibitor, (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2-yl
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the IAP inhibitor (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2- yl)pyrrolidin-1-yl)-2-oxoethyl)-2-(methylamino)propanamide (Compound A21), or a compound disclosed in U.S. Patent No.8,552,003, is administered at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every week, e.g., orally.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- NSCLC non-small cell lung cancer
- NTBC triple-negative breast cancer
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an mTOR inhibitor, Everolimus (Compound A36), or a compound disclosed in PCT Publication No. WO 2014/085318.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the mTOR inhibitor, Everolimus (Compound A36), or a compound disclosed in PCT Publication No. WO 2014/085318 is administered at a dose between 2 mg and 8 mg (e.g., at a dose of 5 mg), e.g., once every week, e.g., orally.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- NSCLC non-small cell lung cancer
- NTBC triple-
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a DAC inhibitor, Panobinostat (Compound A19), or a compound disclosed in PCT Publication No. WO 2014/072493.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the DAC inhibitor, Panobinostat (Compound A19), or a compound disclosed in PCT Publication No. WO 2014/072493 is administered at a dose between 5 mg and 15 mg (e.g., at a dose of 10 mg), e.g., three times in a week (e.g., on the schedule of one week on/one week off), e.g., orally.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple- negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple- negative breast cancer (e.g., NT
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an IL-1 ⁇ inhibitor, canakinumab, or a compound disclosed in PCT Publication No. WO 2002/16436.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the IL-1 ⁇ inhibitor, canakinumab, or a compound disclosed in PCT Publication No. WO 2002/16436 is administered at a dose between 50 mg and 150 mg (e.g., at a dose of 100 mg), e.g., once every eight weeks, e.g., subcutaneously.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- NSCLC non-small cell lung cancer
- breast cancer e.g., a triple-negative breast cancer (e.g., NTBC)
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an IL-17 inhibitor, CJM112, or a compound disclosed in PCT Publication No. WO 2014/122613.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the IL-17 inhibitor, CJM112, or a compound disclosed in PCT Publication No. WO 2014/122613 is administered at a dose between 10 mg and 50 mg (e.g., at a dose of 25 mg), e.g., once every four weeks, e.g., intravenously.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer (e.g., an MSS CRC), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer (e.g., an MSS CRC), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a MEK inhibitor or trametinib.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the MEK inhibitor or trametinib is administered at a dose between 0.2 mg and 1 mg (e.g., at a dose of 0.5 mg), e.g., once a day, e.g., orally.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- NSCLC non-small cell lung cancer
- NTBC triple-negative breast cancer
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), a BRAF inhibitor or dabrafenib, and a MEK inhibitor or trametinib.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the BRAF inhibitor or dabrafenib is administered at a dose between 50 mg and 250 mg (e.g., at a dose of 150 mg) twice a day, e.g., orally.
- the MEK inhibitor or trametinib is administered at a dose between 1 mg and 3 mg (e.g., at a dose of 2 mg), e.g., once a day, e.g., orally.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the inhibitor of PD-1 is administered, e.g., at a dose between 200 mg and 600 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, after the BRAF inhibitor or dabrafenib, the MEK inhibitor or trametinib, or both, is administered, e.g., for a period of 2 to 8 weeks, e.g., 4 weeks.
- the combination is used to treat a cancer described herein, e.g., a skin cancer (e.g., a melanoma, e.g., an unresectable or metastatic melanoma).
- a cancer that has a BRAF mutation, e.g., a BRAF V600 mutation.
- the combination is used to treat a cancer in a subject having an elevated level of serum lactate dehydrogenase (LDH), compared to a reference LDH level.
- LDH serum lactate dehydrogenase
- the combination is used to treat a subject who has an unresectable or metastatic melanoma having a BRAF mutation (e.g., a BRAF V600 mutation) and has an elevated level of LDH in serum, compared to a reference serum LDH level.
- a BRAF mutation e.g., a BRAF V600 mutation
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an EGFR inhibitor, (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-1H- benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A40), or a compound disclosed in PCT Publication No. WO 2013/184757.
- an inhibitor of an immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein)
- an EGFR inhibitor e.g., an EGFR inhibitor, (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-1
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- WO 2013/184757 is administered at a dose between 10 mg and 50 mg (e.g., at a dose of 25 mg), e.g., once a day (e.g., on day 1 to day 10 of a first dosing cycle), e.g., orally.
- the combination is used to treat a cancer described herein, e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- a cancer described herein e.g., a colorectal cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)).
- NSCLC non-small cell lung cancer
- NTBC triple-negative breast cancer
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a CSF-1/1R binding agent (e.g., a CSF-1R tyrosine kinase inhibitor), 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide (Compound A15), or a compound disclosed in PCT Publication No. WO 2005/073224.
- an inhibitor of an immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein)
- a CSF-1/1R binding agent e.g., a CSF-1R tyrosine kinase inhibitor
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the CSF-1/1R binding agent e.g., a CSF-1R tyrosine kinase inhibitor
- a dose between 50 mg and 1000 mg e.g., at a dose of 100 mg, 150 mg, 300 mg, 600 mg, 900 mg
- the combination is used to treat a cancer described herein, e.g., a brain cancer (e.g., a glioblastoma multiforme (GBM)), a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)), or a pancreatic cancer.
- a cancer described herein e.g., a brain cancer (e.g., a glioblastoma multiforme (GBM)), a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)), or a pancreatic cancer.
- a cancer described herein e.g., a brain cancer (e.g., a glioblastoma multiforme (GBM)), a breast cancer (e.g., a triple-negative breast cancer (e.g., NTBC)), or a pancreatic cancer.
- GBM glioblastoma multiforme
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an inhibitor of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (PFKFB3), PFK-158, or a compound disclosed in PCT Publication No. WO 2013/148228.
- an inhibitor of an immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein)
- PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
- PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
- PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the combination is used to treat a cancer described herein, e.g., an ovarian cancer, a fallopian tube cancer, or a colorectal cancer (CRC).
- a cancer described herein e.g., an ovarian cancer, a fallopian tube cancer, or a colorectal cancer (CRC).
- a combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the inhibitor of PD-1 is administered at a dose between 200 mg and 600 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, e.g., intravenously.
- the chemotherapeutic agent e.g., a paclitaxel (e.g., a nab-paclitaxel)
- a paclitaxel e.g., a nab-paclitaxel
- the combination is used to treat a cancer described herein, e.g., a breast cancer (e.g., a HER2-negative breast cancer).
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.1 mg/kg and 15 mg/kg, e.g., between 0.1 mg/kg and 6 mg/kg or between 0.3 mg/kg and 3 mg/kg (e.g., at a dose of 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg), e.g., once every three weeks, e.g., intravenously.
- the combination is used to treat a cancer described herein, e.g., a pancreatic cancer, a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS-CRC)), a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a liver cancer (e.g., a hepatocellular carcinoma), a prostate cancer, or a renal cancer (e.g., a clear cell renal cell carcinoma).
- a cancer described herein e.g., a pancreatic cancer, a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS-CRC)), a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a liver cancer (e.g., a hepatocellular carcinoma), a prostate cancer,
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and an inhibitor of PD-L1 or an anti-PD-L1 antibody molecule disclosed in U.S. Patent Application Publication No.2016/0108123.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- is administered at a dose between 100 mg and 600 mg e.g., at a dose of 100 mg or 300 mg
- a dose of 100 mg or 300 mg e.g., once every 3 weeks, e.g., intravenously.
- the inhibitor of PD-L1 or an anti-PD-L1 antibody molecule disclosed in U.S. Patent Application Publication No. 2016/0108123 is administered at a dose between 10 mg and 2000 mg (e.g., between 20 mg and 1600 mg or between 80 mg and 1200 mg (e.g., at a dose of 20 mg, 80 mg, 240 mg, 800 mg, or 1200 mg), e.g., once every three weeks or once every six weeks, e.g., intravenously.
- the combination is used to treat a cancer described herein, e.g., a solid tumor, e.g., a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a uterine cancer (e.g., an endometrial carcinoma), or a thyroid cancer (e.g., an anaplastic thyroid carcinoma).
- a cancer described herein e.g., a solid tumor, e.g., a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a uterine cancer (e.g., an endometrial carcinoma), or a thyroid cancer (e.g., an anaplastic thyroid carcinoma).
- a cancer described herein e.g., a solid tumor, e.g., a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g.
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), and a chemotherapeutic agent (e.g., a hypomethylating agent, e.g., decitabine).
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- is administered at a dose between 200 mg and 600 mg e.g., between 300 mg and 500 mg, e.g., at a dose of 400 mg
- a dose between 200 mg and 600 mg e.g., between 300 mg and 500 mg, e.g., at a dose of 400 mg
- a dose between 200 mg and 600 mg e.g., between 300 mg and 500 mg, e.g., at a dose of 400 mg
- a dose between 200 mg and 600 mg e.g., between 300 mg and 500 mg, e.
- the chemotherapeutic agent e.g., a hypomethylating agent, e.g., decitabine
- a dose between 5 mg/m 2 and 50 mg/m 2 e.g., between 10 mg/m 2 and 30 mg/m 2 , e.g., at a dose of 20 mg/m 2
- a dose between 5 mg/m 2 and 50 mg/m 2 e.g., between 10 mg/m 2 and 30 mg/m 2 , e.g., at a dose of 20 mg/m 2
- daily e.g., for 1, 2, 3, 4, 5, 6, 7, 8, or more days, e.g., intravenously.
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule)
- the chemotherapeutic agent e.g., a hypomethylating agent, e.g., decitabine
- the combination is used to treat a cancer described herein, e.g., a
- hematological cancer e.g., a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML), or a myelodysplastic syndrome (MDS) (e.g., a high risk MDS).
- a leukemia e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML
- MDS myelodysplastic syndrome
- the combination includes an inhibitor of an immune checkpoint molecule, e.g., an inhibitor of TIM-3 or an anti-TIM-3 antibody molecule disclosed in U.S. Patent Application Publication No.2015/0218274, and a chemotherapeutic agent (e.g., a hypomethylating agent, e.g., decitabine).
- a chemotherapeutic agent e.g., a hypomethylating agent, e.g., decitabine
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of TIM-3 or an anti-TIM-3 antibody molecule disclosed in U.S.
- Patent Application Publication No.2015/0218274 is administered at a dose between 50 mg and 500 mg (e.g., between 100 mg and 400 mg, e.g., at a dose of 240 mg), e.g., once every 2 weeks, e.g., intravenously.
- the chemotherapeutic agent e.g., a hypomethylating agent, e.g., decitabine
- a dose between 5 mg/m 2 and 50 mg/m 2 e.g., between 10 mg/m 2 and 30 mg/m 2 , e.g., at a dose of 20 mg/m 2
- the inhibitor of an immune checkpoint molecule e.g., the inhibitor of TIM-3 or an anti-TIM-3 antibody molecule disclosed in U.S.
- Patent Application Publication No.2015/0218274 is administered on days 8 and 22 of a 28-day cycle, and the chemotherapeutic agent (e.g., a hypomethylating agent, e.g., decitabine) is administered on days 1, 2, 3, 4, and 5 of the 28-day cycle.
- the combination is used to treat a cancer described herein, e.g., a
- hematological cancer e.g., a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML), or a myelodysplastic syndrome (MDS) (e.g., a high risk MDS).
- a leukemia e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML
- MDS myelodysplastic syndrome
- the combination includes an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein), an inhibitor of TIM-3 (e.g., an anti-TIM-3 antibody molecule disclosed in U.S. Patent Application Publication No.2015/0218274), and a chemotherapeutic agent (e.g., a hypomethylating agent, e.g., decitabine).
- the inhibitor of PD-1 e.g., the anti-PD-1 antibody molecule
- the inhibitor of TIM-3 (e.g., an anti-TIM-3 antibody molecule disclosed in U.S. Patent Application Publication No.2015/0218274) is administered at a dose between 20 mg and 400 mg (e.g., between 40 mg and 200 mg or between 50 mg and 100 mg, e.g., at a dose of 80 mg), e.g., once every 2 weeks, e.g., intravenously.
- the chemotherapeutic agent e.g., a hypomethylating agent, e.g., decitabine
- a dose between 5 mg/m 2 and 50 mg/m 2 e.g., between 10 mg/m 2 and 30 mg/m 2 , e.g., at a dose of 20 mg/m 2
- a dose between 5 mg/m 2 and 50 mg/m 2 e.g., between 10 mg/m 2 and 30 mg/m 2 , e.g., at a dose of 20 mg/m 2
- daily e.g., for 1, 2, 3, 4, 5, 6, 7, 8, or more days, e.g., intravenously.
- the inhibitor of PD-1 e.g., the anti-PD-1 antibody molecule
- the inhibitor of TIM-3 is administered on day 8 of a 28-day cycle
- the inhibitor of TIM-3 e.g., an anti-TIM-3 antibody molecule disclosed in U.S. Patent Application Publication No.
- the combination is used to treat a cancer described herein, e.g., a hematological cancer, e.g., a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML), or a myelodysplastic syndrome (MDS) (e.g., a high risk MDS).
- a cancer described herein e.g., a hematological cancer, e.g., a leukemia (e.g., an acute myeloid leukemia (AML), e.g., a relapsed or refractory AML or a de novo AML), or a myelodysplastic syndrome (MDS) (e.g., a high risk MDS).
- a leukemia e.g., an acute myeloid leukemia (AML), e.g., a relapsed
- the combinations disclosed herein can be administered together in a single composition or administered separately in two or more different compositions, e.g., compositions or dosage forms as described herein.
- the administration of the therapeutic agents can be in any order.
- the first agent and the additional agents e.g., second, third agents
- a first therapeutic agent can be administered concurrently with, prior to, or subsequent to, the additional agent.
- a first agent is administered locally, e.g., a therapeutic agent of any of categories (i)-(iii) can be coupled to a tumor targeting agent, e.g., a tumor-targeting antibody (e.g., to form an antibody-drug conjugate), or any other delivery agent (e.g., a formulation such as a targeted formulation) such that administration of the first agent is localized to a desired site, e.g., a tumor site (e.g., a dendritic cell-enriched site).
- a tumor targeting agent e.g., a tumor-targeting antibody (e.g., to form an antibody-drug conjugate)
- any other delivery agent e.g., a formulation such as a targeted formulation
- the therapeutic agent is an antigen (e.g., a vaccine, e.g., an in situ cancer vaccine), which is targeted to the tumor environment, thus resulting in activation of dendritic cells.
- a vaccine e.g., an in situ cancer vaccine
- the therapeutic agent also can be locally administered, e.g., injected, at a tumor site (e.g., intratumoral or peritumoral administration). Localized delivery or administration of the therapeutic agent can reduce one or more side effects or toxicities that would otherwise be associated with systemic administration of the therapeutic agent.
- a therapeutic agent e.g., STING or a TLR
- a tumor-binding antibody e.g., an antibody that binds to HER2
- the first agent, the additional agent (e.g., second or third agent), or all can be administered in an amount or dose that is higher, lower or the same than the amount or dosage of each agent used individually, e.g., as a monotherapy.
- the administered amount or dosage of the first agent, the additional agent (e.g., second or third agent), or all is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually, e.g., as a monotherapy.
- the amount or dosage of the first agent, the additional agent (e.g., second or third agent), or all, that results in a desired effect is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower).
- the combinations can be in the form of an antibody molecule, e.g., a bi- or tri-specific molecule, against one or more therapeutic agents chosen from the antigen- presentation combination, the effector cell combination, or the anti-tumor immunosuppression combination, or any combination thereof.
- a bispecific molecule against two or more checkpoint inhibitors e.g., an anti-PD-1 and an anti-LAG-3 antibody molecule.
- the combinations can be in the form of an antibody molecule, e.g., a bi- or tri-specific molecule, against one or more therapeutic agents chosen from two or all of the antigen-presentation combination, the effector cell combination, and/or the anti-tumor immunosuppression combination.
- the antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
- the antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgG1 or IgG4 (e.g., human IgG1 or IgG4).
- Fc heavy chain constant region
- the heavy chain constant region is human IgG1 or human IgG4.
- the constant region is altered, e.g., mutated, to modify the properties of the antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- the antibody molecule is in the form of a bispecific or multispecific antibody molecule, e.g., a bispecific, trispecific antibody molecule as described herein.
- the immunomodulator used in the combinations disclosed herein is an inhibitor of an immune checkpoint molecule.
- the immunomodulator is an inhibitor of PD-1, PD-L1, PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or - 5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta.
- the inhibitor of an immune checkpoint molecule inhibits PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g.,
- CEACAM-1, -3 and/or -5 CEACAM-1, -3 and/or -5
- CTLA-4 CTLA-4, or any combination thereof.
- Inhibition of an inhibitory molecule can be performed at the DNA, RNA or protein level.
- an inhibitory nucleic acid e.g., a dsRNA, siRNA or shRNA
- a dsRNA, siRNA or shRNA can be used to inhibit expression of an inhibitory molecule.
- the inhibitor of an inhibitory signal is, a polypeptide e.g., a soluble ligand (e.g., PD-1-Ig or CTLA-4 Ig), or an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule; e.g., an antibody or fragment thereof (also referred to herein as“an antibody molecule”) that binds to PD-1, PD-L1, PD-L2, CEACAM (e.g., CEACAM-1, -3 and/or -5), CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta, or a combination thereof.
- a polypeptide e.g., a soluble ligand (e.g., PD-1-Ig or CTLA-4 Ig), or an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule; e.g., an antibody or fragment thereof
- the antibody molecule is in the form of a bispecific or multispecific antibody molecule.
- the bispecific antibody molecule has a first binding specificity to PD-1 or PD-L1 and a second binding specificity, e.g., a second binding specificity to TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, or PD-L2.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and TIM-3.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and LAG-3.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM (e.g., CEACAM-1, -3 and/or - 5). In another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM- 1. In still another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM-3. In yet another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM-5. In another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1. In yet another embodiment, the bispecific antibody molecule binds to PD-1 and PD-L2.
- CEACAM e.g., CEACAM-1, -3 and/or - 5
- the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM- 1. In still another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1
- the bispecific antibody molecule binds to TIM-3 and LAG-3. In another embodiment, the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or -5) and LAG-3. In another embodiment, the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or -5) and TIM-3.
- CEACAM e.g., CEACAM-1, -3 and/or -5
- CEACAM e.g., CEACAM-1, -3 and/or -5
- any combination of the aforesaid molecules can be made in a multispecific antibody molecule, e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specificities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1, - 3 and/or -5), LAG-3, or PD-L2.
- a multispecific antibody molecule e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specificities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1, - 3 and/or -5), LAG-3, or PD-L2.
- the immunomodulator is an inhibitor of PD-1, e.g., human PD-1 (e.g., an antibody molecule as described herein).
- the immunomodulator is an inhibitor of PD-L1, e.g., human PD-L1.
- the inhibitor of PD-1 or PD-L1 is an antibody molecule to PD-1 or PD-L1.
- the PD-1 or PD-L1 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM inhibitor (e.g., CEACAM-1, -3 and/or -5 inhibitor), e.g., an anti- CEACAM antibody molecule.
- a CEACAM inhibitor e.g., CEACAM-1, -3 and/or -5 inhibitor
- the inhibitor of PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti- CEACAM-1 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-5 inhibitor, e.g., an anti- CEACAM-5 antibody molecule.
- the inhibitor of PD-1 or PD- L1, e.g., the anti-PD-1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody molecule, and a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
- immunomodulators with a PD-1 inhibitor e.g., one or more of PD-L2, CTLA- 4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta
- a PD-1 inhibitor e.g., one or more of PD-L2, CTLA- 4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta
- VISTA e.g., VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta
- the immunomodulator is an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), e.g., human CEACAM (e.g., CEACAM-1, -3 and/or -5).
- the immunomodulator is an inhibitor of CEACAM-1, e.g., human CEACAM-1.
- the immunomodulator is an inhibitor of CEACAM-3, e.g., human CEACAM-3.
- the immunomodulator is an inhibitor of CEACAM-5, e.g., human CEACAM-5.
- the inhibitor of CEACAM is an antibody molecule to CEACAM (e.g., CEACAM-1, -3 and/or -5).
- the CEACAM (e.g., CEACAM-1, -3 and/or -5) inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of LAG-3, TIM-3, PD-1, PD-L1 or CTLA-4.
- the immunomodulator is an inhibitor of LAG-3, e.g., human LAG-3.
- the inhibitor of LAG-3 is an antibody molecule to LAG-3.
- the LAG-3 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3, PD-1, PD-L1 or CTLA-4.
- CEACAM e.g., CEACAM-1, -3 and/or -5
- TIM-3 e.g., PD-1, PD-L1 or CTLA-4.
- the immunomodulator is an inhibitor of TIM-3, e.g., human TIM-3.
- the inhibitor of TIM-3 is an antibody molecule to TIM-3.
- the TIM-3 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, PD-1, PD-L1 or CTLA-4.
- CEACAM e.g., CEACAM-1, -3 and/or -5
- LAG-3 e.g., PD-1, PD-L1 or CTLA-4.
- the immunomodulator used in the combinations disclosed herein is an activator or agonist of a costimulatory molecule.
- the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
- the immunomodulator is a GITR agonist.
- the GITR agonist is an antibody molecule to GITR.
- the GITR agonist can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
- the anti-GITR antibody molecule is a bispecific antibody that binds to GITR and PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
- the anti-GITR antibody molecule is administered in combination with an anti-PD-1 antibody molecule (e.g., an anti-PD-1 molecule as described herein).
- an anti-PD-1 antibody molecule e.g., an anti-PD-1 molecule as described herein.
- the GITR antibody molecule and the anti-PD-1 antibody molecule may be in the form of separate antibody composition, or as a bispecific antibody molecule.
- a GITR agonist can be administered in combination with other costimulatory molecule, e.g., an agonist of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
- costimulatory molecule e.g., an agonist of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
- the immunomodulator is an activator of a costimulatory molecule (e.g., an OX40 agonist).
- the OX40 agonist is an antibody molecule to OX40.
- the OX40 agonist can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or - 5), TIM-3 or LAG-3.
- the anti-OX40 antibody molecule is a bispecific antibody that binds to GITR and PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
- an OX40 antibody molecule is administered in combination with an anti-PD-1 antibody molecule (e.g., an anti-PD-1 molecule as described herein).
- the OX40 antibody molecule and the anti-PD-1 antibody molecule may be in the form of separate antibody composition, or as a bispecific antibody molecule.
- the OX40 agonist can be administered in combination with other costimulatory molecule, e.g., an agonist of GITR, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
- costimulatory molecule e.g., an agonist of GITR, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
- the PD-1 inhibitor is an anti-PD-1 antibody molecule as described in U.S. Patent Application Publication No.2015/0210769 (USSN 14/604,415), entitled“Antibody Molecules to PD-1 and Uses Thereof,” incorporated by reference in its entirety.
- the anti- PD-1 antibody molecule comprises at least one antigen-binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049- hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or
- the anti-PD-1 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical
- the anti-PD-1 antibody molecule comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e
- the anti-PD-1 antibody molecule comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4.
- the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1.
- the human IgG1 includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
- the human IgG1 includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
- the human IgG1 includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
- the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the anti-PD-1 antibody molecule includes a kappa light chain constant region, e.g., a human kappa light chain constant region.
- the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the human IgG1 includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
- the human IgG1 includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
- the human IgG1 includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
- the anti-PD-1 antibody molecule includes a heavy chain variable domain and a constant region, a light chain variable domain and a constant region, or both, comprising the amino acid sequence of BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
- the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as shown in Table 4; or a sequence substantially identical thereto.
- the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049- hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti- PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
- Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70,
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1, or closely related CDRs, e.g.
- the anti-PD-1 antibody molecule may include any CDR described herein.
- the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
- Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence.
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049- hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, B
- the anti-PD-1 antibody molecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049- hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP0
- the anti-PD-1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Cl
- the anti-PD-1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) of a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Cl
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six hypervariable loops (e.g., at least one, two, three, four, five, or six hypervariable loops according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049- Clone-B, BAP049-Cl
- the anti-PD-1 antibody molecule includes all six hypervariable loops (e.g., all six hypervariable loops according to the Chothia definition as set out in Table 1) of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049- Clone-C, BAP049-Clone-D, or BAP049-Clone-E, or closely related hypervariable
- the anti-PD-1 antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049- hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, e.g., the
- the anti-PD-1 antibody molecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al. and Chothia et al.
- the anti-PD-1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, according to the Kabat and Chothia definition (e.g.
- the anti-PD-1 antibody molecule can include VH CDR1 according to Kabat et al. or VH hypervariable loop 1 according to Chothia et al., or a combination thereof, e.g., as shown in Table 1.
- the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 224), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the anti-PD- 1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al. and VL CDRs 1-3 according to Kabat et al., e.g., as shown in Table 1. Accordingly, in some embodiments, framework regions are defined based on a combination of CDRs defined according to Kabat et al. and hypervariable loops defined according to Chothia et al. For example, the anti-PD-1 antibody molecule can include VH FR1 defined based on VH hypervariable loop 1 according to Chothia et al. and VH FR2 defined based on VH CDRs 1-2 according to Kabat et al., e.g., as shown in Table 1.
- the anti-PD-1 antibody molecule can further include, e.g., VH FRs 3-4 defined based on VH CDRs 2-3 according to Kabat et al. and VL FRs 1-4 defined based on VL CDRs 1-3 according to Kabat et al.
- the anti-PD-1 antibody molecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions.
- the anti-PD-1 antibody molecule includes at least one, two or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-
- the anti-PD-1 antibody molecule includes:
- VH heavy chain variable region
- VL light chain variable region
- VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32;
- a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33; or (d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
- the anti-PD-1 antibody molecule comprises (i) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1, SEQ ID NO: 4, or SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 5; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and (ii) a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 32 or SEQ ID NO: 33.
- VH heavy chain variable region
- VL light chain variable region
- the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- a CDR e.g., Chothia CDR or Kabat CDR
- the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- the antibody molecule is a bispecific antibody molecule having a first binding specificity for PD-1 and a second binding specificity for TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), PD-L1 or PD-L2.
- the bispecific antibody molecule binds to PD-1 and TIM-3.
- the bispecific antibody molecule binds to PD-1 and LAG-3.
- the bispecific antibody molecule binds to PD-1 and CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM- 5).
- the bispecific antibody molecule binds to PD-1 and CEACAM-1. In yet another embodiment, the bispecific antibody molecule binds to PD-1 and CEACAM-5. In another embodiment, the bispecific antibody molecule binds to PD-1 and PD-L1. In yet another embodiment, the bispecific antibody molecule binds to PD-1 and PD-L2.
- any combination of the aforesaid molecules can be made in a multispecific antibody molecule, e.g., a trispecific antibody that includes a first binding specificity to PD-1, and a second and third binding specificity to one or more of: TIM- 3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
- a multispecific antibody molecule e.g., a trispecific antibody that includes a first binding specificity to PD-1, and a second and third binding specificity to one or more of: TIM- 3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
- the anti-PD-1 antibody molecule is used in combination with a bispecific molecule comprising one or more of: TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
- a bispecific molecule comprising one or more of: TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
- the bispecific antibody molecule used in combination binds to CEACAM (e.g., CEACAM-1, CEACAM-3, and/or
- CEACAM-5) and LAG-3 In another embodiment, the bispecific antibody molecule used in combination binds to CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5) and TIM-3. In another embodiment, the bispecific antibody molecule used in combination binds to LAG-3 and TIM-3.
- the combinations disclosed herein can result in one or more of: an increase in antigen presentation, an increase in effector cell function (e.g., one or more of T cell proliferation, IFN- ⁇ secretion or cytolytic function), inhibition of regulatory T cell function, an effect on the activity of multiple cell types, such as regulatory T cell, effector T cells and NK cells), an increase in tumor infiltrating lymphocytes, an increase in T-cell receptor mediated proliferation, and a decrease in immune evasion by cancerous cells.
- the use of a PD-1 inhibitor in the combinations inhibits, reduces or neutralizes one or more activities of PD-1, resulting in blockade or reduction of an immune checkpoint.
- such combinations can be used to treat or prevent disorders where enhancing an immune response in a subject is desired.
- a method of modulating an immune response in a subject comprises administering to the subject a combination disclosed herein (e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule), alone or in combination with one or more agents or procedures, such that the immune response in the subject is modulated.
- the antibody molecule enhances, stimulates or increases the immune response in the subject.
- the subject can be a mammal, e.g., a primate, preferably a higher primate, e.g., a human (e.g., a patient having, or at risk of having, a disorder described herein).
- the subject is in need of enhancing an immune response.
- the subject has, or is at risk of, having a disorder described herein, e.g., a cancer or an infectious disorder as described herein.
- the subject is, or is at risk of being,
- the subject is undergoing or has undergone a chemotherapeutic treatment and/or radiation therapy.
- the subject is, or is at risk of being, immunocompromised as a result of an infection.
- a method of treating e.g., one or more of reducing, inhibiting, or delaying progression
- the method comprises administering to the subject a combination disclosed herein (e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule).
- the cancer treated with the combination includes but is not limited to, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion.
- a hematological cancer e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
- a metastatic lesion e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
- the cancer is a solid tumor.
- solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal cancer (e.g., renal-cell carcinoma (clear cell or non-clear cell renal cell carcinoma), liver cancer, lung cancer (e.g., non-small cell lung cancer (squamous or non-squamous non-small cell lung cancer)), cancer of the small intestine and cancer of the e
- the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)), a skin cancer (e.g., a Merkel cell carcinoma or a melanoma (e.g., an advanced melanoma)), a kidney cancer (e.g., a renal cancer (e.g., a renal cell carcinoma)), a liver cancer, a myeloma (e.g., a multiple myeloma), a prostate cancer, a breast cancer (e.g., a breast cancer that does not express one, two or all of estrogen receptor, progesterone receptor, or Her2/neu, e.g., a triple negative breast cancer), a colorectal cancer, a pancreatic cancer, a head and neck cancer (e.g., NSCLC
- the cancer is chosen form a carcinoma (e.g., advanced or metastatic carcinoma), melanoma or a lung carcinoma, e.g., a non-small cell lung carcinoma.
- a carcinoma e.g., advanced or metastatic carcinoma
- melanoma e.g., a non-small cell lung carcinoma.
- the cancer is a lung cancer, e.g., a non-small cell lung cancer or small cell lung cancer.
- the non-small cell lung cancer is a stage I (e.g., stage Ia or Ib), stage II (e.g., stage IIa or IIb), stage III (e.g., stage IIIa or IIIb), or stage IV, non-small cell lung cancer.
- the cancer is a melanoma, e.g., an advanced melanoma. In one embodiment, the cancer is an advanced or unresectable melanoma that does not respond to other therapies. In other embodiments, the cancer is a melanoma with a BRAF mutation (e.g., a BRAF V600 mutation). In yet other embodiments, the combination disclosed herein (e.g., the combination comprising the anti-PD-1 antibody molecule) is administered after treatment with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g., vemurafenib or dabrafenib).
- an anti-CTLA-4 antibody e.g., ipilimumab
- a BRAF inhibitor e.g., vemurafenib or dabrafenib.
- the cancer is a hepatocarcinoma, e.g., an advanced hepatocarcinoma, with or without a viral infection, e.g., a chronic viral hepatitis.
- a hepatocarcinoma e.g., an advanced hepatocarcinoma
- a viral infection e.g., a chronic viral hepatitis.
- the cancer is a prostate cancer, e.g., an advanced prostate cancer.
- the cancer is a myeloma, e.g., multiple myeloma.
- the cancer is a renal cancer, e.g., a renal cell carcinoma (RCC) (e.g., a metastatic RCC, a non-clear cell renal cell carcinoma (nccRCC), or clear cell renal cell carcinoma (CCRCC)).
- RCC renal cell carcinoma
- nccRCC non-clear cell renal cell carcinoma
- CCRCC clear cell renal cell carcinoma
- the cancer microenvironment has an elevated level of PD-L1 expression.
- the cancer microenvironment can have increased IFN ⁇ and/or CD8 expression.
- the subject has, or is identified as having, a tumor that has one or more of high PD-L1 level or expression, or as being Tumor Infiltrating Lymphocyte (TIL)+ (e.g., as having an increased number of TILs), or both.
- TIL Tumor Infiltrating Lymphocyte
- the subject has, or is identified as having, a tumor that has high PD-L1 level or expression and that is TIL+.
- the methods described herein further include identifying a subject based on having a tumor that has one or more of high PD-L1 level or expression, or as being TIL+, or both. In certain embodiments, the methods described herein further include identifying a subject based on having a tumor that has high PD-L1 level or expression and as being TIL+. In some embodiments, tumors that are TIL+ are positive for CD8 and IFN ⁇ . In some embodiments, the subject has, or is identified as having, a high percentage of cells that are positive for one, two or more of PD-L1, CD8, and/or IFN ⁇ . In certain embodiments, the subject has or is identified as having a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ .
- the methods described herein further include identifying a subject based on having a high percentage of cells that are positive for one, two or more of PD-L1, CD8, and/or IFN ⁇ . In certain embodiments, the methods described herein further include identifying a subject based on having a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ . In some embodiments, the subject has, or is identified as having, one, two or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a lung cancer, e.g., squamous cell lung cancer or lung
- adenocarcinoma e.g., an NSCLC
- a head and neck cancer e.g., a squamous cell cervical cancer; a stomach cancer; an esophageal cancer; a thyroid cancer (e.g., anaplastic thyroid carcinoma); a skin cancer (e.g., a Merkel cell carcinoma or a melanoma), a breast cancer (e.g., an NTBC), and/or a nasopharyngeal cancer (NPC).
- NSCLC nasopharyngeal cancer
- the methods described herein further describe identifying a subject based on having one, two or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a lung cancer, e.g., squamous cell lung cancer or lung adenocarcinoma (e.g., an NSCLC); a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer (e.g., anaplastic thyroid carcinoma); a skin cancer (e.g., a Merkel cell carcinoma or a melanoma), an neuroendocrine tumor, a breast cancer (e.g., an NTBC), and/or a nasopharyngeal cancer.
- a lung cancer e.g., squamous cell lung cancer or lung adenocarcinoma (e.g., an NSCLC); a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer (e.g
- Methods and compositions disclosed herein are useful for treating metastatic lesions associated with the aforementioned cancers.
- the invention provides a method of treating an infectious disease in a subject, comprising administering to a subject a combination as described herein, e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule described herein.
- the infection disease is chosen from hepatitis (e.g., hepatis C infection), or sepsis.
- the invention provides a method of enhancing an immune response to an antigen in a subject, comprising administering to the subject: (i) the antigen; and (ii) a combination as described herein, e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule described herein, such that an immune response to the antigen in the subject is enhanced.
- the antigen can be, for example, a tumor antigen, a viral antigen, a bacterial antigen or an antigen from a pathogen.
- the combinations as described herein can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
- the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
- the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 10 to 20 mg/kg every other week.
- the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 100 mg to 600 mg, e.g., about 200 mg to 500 mg, e.g., about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 100 mg, about 200 mg, about 300 mg, or about 400 mg.
- the dosing schedule (e.g., flat dosing schedule) can vary from e.g., once a week to once every 2, 3, 4, 5, or 6 weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks. In one embodiment, the anti- PD-1 antibody molecule is administered at a dose from about 300 mg once every three weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every three weeks.
- the anti-PD-1 antibody molecule is administered, alone or in combination (e.g., in combination with an anti-LAG-3 antibody molecule), at a dose of less than, or about, 5 mg/kg; less than, or about, 4 mg/kg; less than, or about, 3 mg/kg; less than, or about, 2 mg/kg; less than, or about, 1 mg/kg, every other week.
- the anti-PD-1 antibody molecule is administered at a dose of 1 to 5 mg/kg every other week; 1 to 4 mg/kg every other week, 1 to 3 mg/kg every other week, or 1 to 2 mg/kg every other week.
- the anti-LAG-3 antibody molecule is administered, alone or in combination (e.g., in combination with an anti-PD-1 antibody molecule) at a dose of 1 to 5 mg/kg every other week; 1 to 4 mg/kg every other week, 1 to 3 mg/kg every other week, or 1 to 2 mg/kg every other week.
- the methods and combinations described herein can include, or be used in combination with, other agents or therapeutic modalities.
- the methods described herein include administering to the subject a combination comprising an anti-PD-1 antibody molecule as described herein, in combination with an agent or therapeutic procedure or modality, in an amount effective to treat or prevent a disorder.
- the anti-PD-1 antibody molecule and the agent or therapeutic procedure or modality can be administered simultaneously or sequentially in any order. Any combination and sequence of the anti-PD-1 antibody molecules and other therapeutic agents, procedures or modalities (e.g., as described herein) can be used.
- the antibody molecule and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
- the antibody molecule can be administered before the other treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
- the methods and compositions described herein are administered in combination with one or more of other antibody molecules, chemotherapy, other anti-cancer therapy (e.g., targeted anti-cancer therapies, gene therapy, viral therapy, RNA therapy bone marrow transplantation, nanotherapy, or oncolytic drugs), cytotoxic agents, immune-based therapies (e.g., cytokines or cell-based immune therapies), surgical procedures (e.g., lumpectomy or mastectomy) or radiation procedures, or a combination of any of the foregoing.
- the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
- the additional therapy is an enzymatic inhibitor (e.g., a small molecule enzymatic inhibitor) or a metastatic inhibitor.
- Exemplary cytotoxic agents that can be administered in combination with include antimicrotubule agents, topoisomerase inhibitors, anti-metabolites, mitotic inhibitors, alkylating agents, anthracyclines, vinca alkaloids, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis, proteosome inhibitors, and radiation (e.g., local or whole body irradiation (e.g., gamma irradiation).
- the additional therapy is surgery or radiation, or a combination thereof.
- the additional therapy is a therapy targeting one or more of PI3K/AKT/mTOR pathway, an HSP90 inhibitor, or a tubulin inhibitor.
- the methods and compositions described herein can include, be administered in combination with, one or more of: an immunomodulator (e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule, e.g., an immune checkpoint molecule); a vaccine, e.g., a therapeutic cancer vaccine; or other forms of cellular immunotherapy.
- an immunomodulator e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule, e.g., an immune checkpoint molecule
- a vaccine e.g., a therapeutic cancer vaccine
- Exemplary non-limiting combinations and uses of the combinations disclosed herein, e.g., a combination comprising an anti-PD-1 antibody molecule, include the following.
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
- a modulator of a costimulatory molecule or an inhibitory molecule e.g., a co-inhibitory ligand or receptor.
- the combination disclosed herein, e.g., a combination comprising an anti- PD-1 antibody molecule includes or is administered in combination with a modulator, e.g., agonist, of a costimulatory molecule.
- the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3 or CD83 ligand.
- an agonist e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
- the combination disclosed herein includes or is administered in combination with an inhibitor of an inhibitory (or immune checkpoint) molecule chosen from PD-L1, PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta.
- the inhibitor is a soluble ligand (e.g., a CTLA-4-Ig), or an antibody or antibody fragment that binds to PD-L1, PD-L2 or CTLA-4.
- the anti-PD-1 antibody molecule can be administered in combination with an anti-CTLA-4 antibody, e.g., ipilimumab, for example, to treat a cancer (e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer).
- a cancer e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer.
- the anti-PD-1 antibody molecule is administered after treatment with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g., vemurafenib or dabrafenib).
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is administered in combination with an anti-LAG-3 antibody or antigen-binding fragment thereof.
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is administered in combination with an anti-TIM-3 antibody or antigen-binding fragment thereof.
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is administered in combination with an anti-LAG-3 antibody and an anti-TIM-3 antibody (or antigen-binding fragments thereof).
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is administered in combination with a CEACAM inhibitor (e.g., CEACAM-1 and/or CEACAM-5 inhibitor), e.g., an anti- CEACAM antibody molecule.
- a CEACAM inhibitor e.g., CEACAM-1 and/or CEACAM-5 inhibitor
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti- CEACAM-1 antibody molecule.
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM-5 inhibitor, e.g., an anti- CEACAM-5 antibody molecule.
- antibodies recited herein can be administered separately, e.g., as separate antibodies or antigen-binding fragments thereof, or linked, e.g., as a bispecific or trispecific antibody molecule.
- a bispecific antibody that includes an anti-PD-1 antibody molecule and an anti-TIM-3, anti-CEACAM (e.g., anti-CEACAM-1, CEACAM-3, and/or anti-CEACAM-5), or anti-LAG-3 antibody, or an antigen-binding fragment thereof, is administered.
- the combination of antibodies recited herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor or a hematologic malignancy).
- a cancer e.g., a cancer as described herein (e.g., a solid tumor or a hematologic malignancy).
- the combination disclosed herein includes or is administered in combination with a cytokine.
- the cytokine can be administered as a fusion molecule to the anti-PD-1 antibody molecule, or as separate compositions.
- the anti-PD-1 antibody is administered in combination with one, two, three or more cytokines, e.g., as a fusion molecule or as separate compositions.
- the cytokine is an interleukin (IL) chosen from one, two, three or more of IL-1, IL-2, IL- 12, IL-15 or IL-21.
- IL interleukin
- a bispecific antibody molecule has a first binding specificity to a first target (e.g., to PD-1), a second binding specificity to a second target (e.g., LAG-3 or TIM-3), and is optionally linked to an interleukin (e.g., IL-12) domain e.g., full length IL-12 or a portion thereof.
- a first target e.g., to PD-1
- a second binding specificity to a second target e.g., LAG-3 or TIM-3
- an interleukin e.g., IL-12 domain
- the combination of anti-PD-1 antibody molecule and the cytokine described herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor).
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
- an antibody specific against an HLA C e.g., an antibody specific to Killer-cell Immunoglobulin-like Receptors
- the combination of anti-PD-1 antibody molecule and anti-KIR antibody is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor, e.g., an advanced solid tumor).
- the combination disclosed herein e.g., a combination comprising an anti- PD-1 antibody molecule
- a cellular immunotherapy e.g., Provenge® (e.g., Sipuleucel-T)
- cyclophosphamide optionally in combination with cyclophosphamide.
- the combination of anti-PD-1 antibody molecule, Provenge® and/or cyclophosphamide is used to treat a cancer, e.g., a cancer as described herein (e.g., a prostate cancer, e.g., an advanced prostate cancer).
- the combination disclosed herein includes or is administered in combination with a vaccine, e.g., a cancer vaccine, (e.g., a dendritic cell renal carcinoma (DC-RCC) vaccine).
- a vaccine e.g., a cancer vaccine, (e.g., a dendritic cell renal carcinoma (DC-RCC) vaccine).
- the vaccine is peptide-based, DNA-based, RNA-based, or antigen-based, or a combination thereof.
- the vaccine comprises one or more peptides, nucleic acids (e.g., DNA or RNA), antigens, or a combination thereof.
- the combination of anti-PD-1 antibody molecule and the DC-RCC vaccine is used to treat a cancer, e.g., a cancer as described herein (e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)).
- a cancer e.g., a cancer as described herein (e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)).
- a cancer as described herein e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
- the combination disclosed herein, e.g., a combination comprising an anti-PD-1 antibody molecule includes or is administered in combination with chemotherapy, and/or immunotherapy.
- the anti-PD-1 antibody molecule can be used to treat a myeloma, alone or in combination with one or more of: chemotherapy or other anti-cancer agents (e.g., thalidomide analogs, e.g., lenalidomide), an anti-TIM-3 antibody, tumor antigen-pulsed dendritic cells, fusions (e.g., electrofusions) of tumor cells and dendritic cells, or vaccination with immunoglobulin idiotype produced by malignant plasma cells.
- chemotherapy or other anti-cancer agents e.g., thalidomide analogs, e.g., lenalidomide
- an anti-TIM-3 antibody tumor antigen-pulsed dendritic cells
- fusions e.g., electrofusions
- tumor cells and dendritic cells e.g., electrofusions
- the combination disclosed herein e.g., a combination comprising an anti- PD-1 antibody molecule
- a lung cancer e.g., non-small cell lung cancer.
- the anti-PD-1 antibody molecule is used with standard lung, e.g., NSCLC, chemotherapy, e.g., platinum doublet therapy, to treat lung cancer.
- the anti-PD-1 antibody molecule is used in combination with an indoleamine- pyrrole 2,3-dioxygenase (IDO) inhibitor (e.g., (4E)-4-[(3-chloro-4-fluoroanilino)- nitrosomethylidene]-1,2,5-oxadiazol-3-amine (also known as INCB24360), indoximod (1-methyl-D- tryptophan), ⁇ -cyclohexyl-5H-Imidazo[5,1-a]isoindole-5-ethanol (also known as NLG919), etc.) in a subject with advanced or metastatic cancer (e.g., a patient with metastic and recurrent NSCL cancer).
- IDO indoleamine- pyrrole 2,3-dioxygenase
- the combination disclosed herein includes or is used in combination with one or more of: an immune- based strategy (e.g., interleukin-2 or interferon- ⁇ ), a targeting agent (e.g., a VEGF inhibitor such as a monoclonal antibody to VEGF); a VEGF tyrosine kinase inhibitor such as sunitinib, sorafenib, axitinib and pazopanib; an RNAi inhibitor; or an inhibitor of a downstream mediator of VEGF signaling, e.g., an inhibitor of the mammalian target of rapamycin (mTOR), e.g., everolimus and temsirolimus.
- an immune- based strategy e.g., interleukin-2 or interferon- ⁇
- a targeting agent e.g., a VEGF inhibitor such as a monoclonal antibody to VEGF
- a VEGF tyrosine kinase inhibitor
- a renal cancer e.g., renal cell carcinoma (RCC) (e.g., clear cell renal cell carcinoma (CCRCC) or a non-clear cell renal cell carcinoma (nccRCC) or metastatic RCC, or a liver cancer (e.g., a hepatocellular carcinoma).
- RCC renal cell carcinoma
- CCRCC clear cell renal cell carcinoma
- nccRCC non-clear cell renal cell carcinoma
- metastatic RCC e.g., metastatic RCC
- liver cancer e.g., a hepatocellular carcinoma
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is used in combination with a MEK inhibitor (e.g., a MEK inhibitor as described herein).
- the combination of the anti-PD-1 antibody and the MEK inhibitor is used to treat a cancer (e.g., a cancer described herein).
- the cancer treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma.
- the cancer includes a BRAF mutation (e.g., a BRAF V600E mutation), a BRAF wildtype, a KRAS wildtype or an activating KRAS mutation.
- the cancer may be at an early, intermediate or late stage.
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is used in combination with one, two or all of oxaliplatin, leucovorin or 5-FU (e.g., a FOLFOX co-treatment).
- combination further includes a VEGF inhibitor (e.g., a VEGF inhibitor as disclosed herein).
- a VEGF inhibitor e.g., a VEGF inhibitor as disclosed herein.
- the combination of the anti-PD-1 antibody, the FOLFOX co-treatment, and the VEGF inhibitor is used to treat a cancer (e.g., a cancer described herein).
- a cancer e.g., a cancer described herein.
- the cancer treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma.
- the cancer may be at an early, intermediate or late stage.
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, includes or is administered with a tyrosine kinase inhibitor (e.g., axitinib) to treat renal cell carcinoma and other solid tumors.
- a tyrosine kinase inhibitor e.g., axitinib
- the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
- a 4-1BB receptor targeting agent e.g., an antibody that stimulates signaling through 4-1BB (CD-137), e.g., PF-2566.
- the anti-PD-1 antibody molecule is administered in combination with a tyrosine kinase inhibitor (e.g., axitinib) and a 4-1BB receptor targeting agent.
- the anti-PD-1 antibody molecule can be bound to a substance, e.g., a cytotoxic agent or moiety (e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein).
- a cytotoxic agent or moiety e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein).
- the antibody can be coupled to a radioactive isotope such as an ⁇ -, ⁇ -, or ⁇ -emitter, or a ⁇ -and ⁇ -emitter.
- any combination and sequence of the anti-PD-1 antibody molecules and other therapeutic agents, procedures or modalities can be used.
- the antibody molecule and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
- the antibody molecule can be administered before the other treatment, concurrently with the treatment, post-treatment, or during remission of the disorder. Additional Combination Therapies
- any of the combinations disclosed herein, alternatively or in combination, further includes one or more of the agents described in Table 7.
- the additional therapeutic agent is chosen from one or more of: 1) a protein kinase C (PKC) inhibitor; 2) a heat shock protein 90 (HSP90) inhibitor; 3) an inhibitor of a phosphoinositide 3-kinase (PI3K) and/or target of rapamycin (mTOR); 4) an inhibitor of cytochrome P450 (e.g., a CYP17 inhibitor or a 17alpha-Hydroxylase/C17-20 Lyase inhibitor); 5) an iron chelating agent; 6) an aromatase inhibitor; 7) an inhibitor of p53, e.g., an inhibitor of a p53/Mdm2 interaction; 8) an apoptosis inducer; 9) an angiogenesis inhibitor; 10) an aldosterone synthase inhibitor; 11) a smoothened (SMO) receptor inhibitor; 12) a prolactin receptor (PRLR) inhibitor; 13) a Wnt signaling inhibitor; 14)
- PIC protein
- the additional therapeutic agent is chosen from one or more of:
- the additional therapeutic agent is chosen from one or more of:
- the additional therapeutic agent is chosen from one or more of:
- the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma), or disclosed in a publication listed in Table 7.
- NSCLC non-small cell lung cancer
- Biomarkers e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma
- a method of evaluating or monitoring the effectiveness of a therapy e.g., a combination therapy described herein, in a subject (e.g., a subject having a cancer, e.g., a cancer described herein).
- the method includes acquiring a value of effectiveness to the therapy, wherein said value is indicative of the effectiveness of the therapy.
- the value of effectiveness to the therapy comprises a measure of one, two, three, four, five, six, seven, eight, nine or more (e.g., all) of the following:
- TIL tumor infiltrating lymphocyte
- the parameter of a TIL phenotype comprises the level or activity of one, two, three, four or more (e.g., all) of Hematoxylin and eosin (H&E) staining for TIL counts, CD8, FOXP3, CD4, or CD3, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- H&E Hematoxylin and eosin
- the parameter of a myeloid cell population comprises the level or activity of one or both of CD68 or CD163, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the parameter of a surface expression marker comprises the level or activity of one, two or more (e.g., all) of PD-L1, LAG-3, or TIM-3, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the parameter of a biomarker of an immunologic response comprises the level or sequence of one or more nucleic acid-based markers, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the parameter of systemic cytokine modulation comprises the level or activity of one, two, three, four, five, six, seven, eight, or more (e.g., all) of IL-18, IFN- ⁇ , ITAC (CXCL11), IL-6, IL-10, IL-4, IL-17, IL-15, or TGF-beta, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a plasma sample).
- a sample from the subject e.g., a blood sample, e.g., a plasma sample.
- the parameter of cfDNA comprises the sequence or level of one or more circulating tumor DNA (cfDNA) molecules, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a plasma sample).
- a sample from the subject e.g., a blood sample, e.g., a plasma sample.
- the parameter of systemic immune-modulation comprises phenotypic characterization of an activated immune cell, e.g., a CD3-expressing cell, a CD8-expressing cell, or both, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a PBMC sample).
- an activated immune cell e.g., a CD3-expressing cell, a CD8-expressing cell, or both
- a sample from the subject e.g., a blood sample, e.g., a PBMC sample.
- the parameter of microbiome comprises the sequence or expression level of one or more genes in the microbiome, in the subject, e.g., in a sample from the subject (e.g., a stool sample).
- the parameter of a marker of activation in a circulating immune cell comprises the level or activity of one, two, three, four, five or more (e.g., all) of circulating CD8+, HLA-DR+Ki67+, T cells, IFN- ⁇ , IL-18, or CXCL11 (IFN- ⁇ induced CCK) expressing cells, in a sample (e.g., a blood sample, e.g., a plasma sample).
- the parameter of a circulating cytokine comprises the level or activity of IL-6, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a plasma sample).
- the therapy comprises a combination of
- an inhibitor of a immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD- 1 antibody molecule);
- the measure of one or more of (i)-(x) is obtained from a sample acquired from the subject.
- the sample is chosen from a tumor sample, a blood sample (e.g., a plasma sample or a PBMC sample), or a stool sample.
- the subject is evaluated prior to receiving, during, or after receiving, the therapy, e.g., the combination therapy.
- the measure of one or more of (i)-(x) evaluates a profile for one or more of gene expression, flow cytometry or protein expression.
- the presence of an increased level or activity of one, two, three, four, five, or more (e.g., all) of circulating CD8+, HLA- DR+Ki67+, T cells, IFN- ⁇ , IL-18, or CXCL11 (IFN- ⁇ induced CCK) expressing cells, and/or the presence of an decreased level or activity of IL-6, in the subject or sample, is a positive predictor of the effectiveness of the therapy.
- administering to the subject an additional agent (e.g., a therapeutic agent described herein) in combination with the therapy (e.g., a combination therapy); or
- Additional embodiments provide a method of treating a cancer, comprising: identifying in a subject or a sample (e.g., a subject’s sample comprising cancer cells and optionally immune cells such as TILs) the presence of one, two or all of PD-L1, CD8, or IFN- ⁇ , thereby providing a value for one, two or all of PD-L1, CD8, and IFN- ⁇ .
- the method can further include comparing the PD-L1, CD8, and/or IFN- ⁇ values to a reference value, e.g., a control value.
- a combination as described herein e.g., a combination that includes an anti-PD-1 antibody described herein
- administering a therapeutically effective amount of a combination as described herein e.g., a combination that includes an anti-PD-1 antibody described herein
- a combination as described herein (e.g., a combination that includes an anti-PD-1 antibody described herein) to the subject, optionally in combination with one or more other agents, thereby treating the cancer.
- the cancer may be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer (e.g., anaplastic thyroid carcinoma), skin cancer (e.g., Merkel cell carcinoma or melanoma), nasopharyngeal cancer, neuroendocrine tumor (e.g., an atypical pulmonary carcinoid tumor), or breast cancer, e.g., TN breast cancer, e.g., IM-TN breast cancer.
- the cancer is ER+ breast cancer or pancreatic cancer.
- Also provided is a method of treating a cancer comprising: testing a subject or a sample (e.g., a subject’s sample comprising cancer cells) for the presence of PD-L1, thereby identifying a PD-L1 value, comparing the PD-L1 value to a control value, and if the PD-L1 value is greater than the control value, administering a therapeutically effective amount of a combination as described herein (e.g., a combination that includes an anti-PD-1 antibody described herein) to the subject, optionally in combination with one or more other agents, thereby treating the cancer.
- a combination as described herein e.g., a combination that includes an anti-PD-1 antibody described herein
- the cancer may be, e.g., a cancer as described herein, such as cancer is non-small cell lung (NSCLC) adenocarcinoma (ACA), NSCLC squamous cell carcinoma (SCC), or hepatocellular carcinoma (HCC).
- NSCLC non-small cell lung
- ACA adenocarcinoma
- SCC NSCLC squamous cell carcinoma
- HCC hepatocellular carcinoma
- the invention features diagnostic or therapeutic kits that include the antibody molecules described herein and instructions for use.
- Figure 1 depicts the amino acid sequences of the light and heavy chain variable regions of murine anti-PD-1 mAb BAP049.
- the upper and lower sequences were from two independent analyses.
- the light and heavy chain CDR sequences based on Kabat numbering are underlined.
- the light heavy chain CDR sequences based on Chothia numbering are shown in bold italics.
- the unpaired Cys residue at position 102 of the light chain sequence is boxed. Sequences are disclosed as SEQ ID NOs: 8, 228, 16 and 229, respectively, in order of appearance.
- Figure 2A depicts the amino acid sequences of the light and heavy chain variable regions of murine anti-PD-1 mAb BAP049 aligned with the germline sequences.
- the upper and lower sequences are the germline (GL) and BAP049 (Mu mAb) sequences, respectively.
- the light and heavy chain CDR sequences based on Kabat numbering are underlined.
- the light heavy chain CDR sequences based on Chothia numbering are shown in bold italics.“-” means identical amino acid residue.
- Figure 2B depicts the sequence of murine ⁇ J2 gene and the corresponding mutation in murine anti-PD-1 mAb BAP049.“-” means identical nucleotide residue. Sequences disclosed as SEQ ID NOs: 233, 232, 234 and 235, respectively, in order of appearance.
- FIGS 3A-3B depict the competition binding between fluorescently labeled murine anti-PD- 1 mAb BAP049 (Mu mAb) and three chimeric versions of BAP049 (Chi mAb). Experiment was performed twice, and the results are shown in Figures 3A and 3B, respectively.
- the three chimeric BAP049 antibodies (Chi mAb (Cys), Chi mAb (Tyr) and Chi mAb (Ser)) have Cys, Tyr and Ser residue at position 102 of the light chain variable region, respectively.
- Chi mAb (Cys), Chi mAb (Tyr) and Chi mAb (Ser) are also known as BAP049-chi, BAP049-chi-Y, and BAP049-chi-S, respectively.
- Figure 4 is a bar graph showing the results of FACS binding analysis for the sixteen humanized BAP049 clones (BAP049-hum01 to BAP049-hum16).
- the antibody concentrations are 200, 100, 50, 25 and 12.5 ng/ml from the leftmost bar to the rightmost bar for each tested mAb.
- Figure 5 depicts the structural analysis of the humanized BAP049 clones (a, b, c, d and e represent various types of framework region sequences). The concentrations of the mAbs in the samples are also shown.
- Figure 6A-6B depicts the binding affinity and specificity of humanized BAP049 mAbs measured in a competition binding assay using a constant concentration of Alexa 488-labeled murine mAb BAP049, serial dilutions of the test antibodies, and PD-1-expressing 300.19 cells. Experiment was performed twice, and the results are shown in Figures 6A and 6B, respectively.
- Figure 7 depicts the ranking of humanized BAP049 clones based on FACS data, competition binding and structural analysis. The concentrations of the mAbs in the samples are also shown.
- Figures 8A-8B depict blocking of ligand binding to PD-1 by selected humanized BAP049 clones. Blocking of PD-L1-Ig and PD-L2-Ig binding to PD-1 is shown in Figure 8A. Blocking of PD-L2-Ig binding to PD-1 is shown in Figure 8B. BAP049-hum01, BAP049-hum05, BAP049- hum08, BAP049-hum09, BAP049-hum10, and BAP049-hum11 were evaluated. Murine mAb BAP049 and chimeric mAb having Tyr at position 102 of the light chain variable region were also included in the analyses.
- Figures 9A-9B depict the alignment of heavy chain variable domain sequences for the sixteen humanized BAP049 clones and BAP049 chimera (BAP049-chi).
- Figure 9A all of the sequences are shown (SEQ ID NOs: 22, 38, 38, 38, 38, 38, 38, 38, 38, 38, 50, 50, 50, 50, 82, 82 and 86, respectively, in order of appearance).
- Figure 9B only amino acid sequences that are different from mouse sequence are shown (SEQ ID NOs: 22, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 50, 50, 50, 50, 82, 82 and 86, respectively, in order of appearance).
- Figures 10A-10B depict the alignment of light chain variable domain sequences for the sixteen humanized BAP049 clones and BAP049 chimera (BAP049-chi).
- Figure 10A all of the sequences are shown (SEQ ID NOs: 24, 66, 66, 66, 66, 70, 70, 70, 58, 62, 78, 74, 46, 46, 42, 54 and 54, respectively, in order of appearance).
- Figure 10B only amino acid sequences that are different from mouse sequence are shown (SEQ ID NOs: 24, 66, 66, 66, 66, 70, 70, 70, 58, 62, 78, 74, 46, 46, 42, 54 and 54, respectively, in order of appearance).
- Figure 11 is a schematic diagram that outlines the antigen processing and presentation, effector cell responses and immunosuppression pathways targeted by the combination therapies disclosed herein.
- Figure 12 depicts the predicted C trough (C min ) concentrations across the different weights for patients while receiving the same dose of an exemplary anti-PD-1 antibody molecule.
- C min C trough
- Figure 13 depicts obvserved versus model predicted (population or individual based) Cmin concentrations.
- Figures 14A-14B depict the accumulation, time course and within subject variability of the model used to analyze pharmacokinetics.
- the shaded areas represent 90% prediction interval; solid lines are the median of prediction at each time point; black dots represent observed pharmacokinetic data.
- Figure 15 depicts the percent survival of mice implanted with MC38 cells after treatment with anti-PD-1 antibody, Compound A21, or a combination of anti-PD-1 antibody and Compound A21.
- Figure 16A depicts the body weights for ten animals per group treated with vehicle, anti- mouse PD-1 antibody (10 mg/kg IV QW for four doses), panobinostat (Compound A19, 10 mg/kg QOD for five doses), or the combination of panobinostat and anti-mouse PD-1 antibody.
- Figure 16B depicts the responses of individual tumors to treatment with vehicle control, anti- mouse PD-1 antibody, panobinostat (Compound A19), or the combination of panobinostat and anti- mouse PD-1 antibody.
- Figure 17 depicts the percent survival of mice bearing A20 lymphoma allografts after treatment with Compound A40, ibrutinib, anti-PD-L1 antibody, a combination of Compound A40 and anti-PD-L1 antibody, or a combination of ibrutinib and anti-PD-L1 antibody (anti-PD-L1 indicated as aPD-L1).
- Figure 18 depicts the mean tumor volume in mice bearing A20 lymphoma allografts after treatment with Compound A40, ibrutinib, anti-PD-L1 antibody, a combination of Compound A40 and anti-PD-L1 antibody, or a combination of ibrutinib and anti-PD-L1 antibody (anti-PD-L1 indicated as aPD-L1).
- MTD maximum-tolerated dose
- NSCLC non-small cell lung cancer
- RP2D recommended phase II dose
- TNBC triple-negative breast cancer.
- Figure 20 depicts the percent change in target lesions over time for each of the
- radiographically evaluable patients treated with the anti-PD-1 antibody molecule in the phase I/II study were treated at the following dosing schedules: 1mg/kg q2w, 3 mg/kg q2w, 10 mg/kg q2w, 3 mg/kg q4w, or 5 mg/kg q4w (exemplary lines in the figure are indicated with the dosing schedules).
- Figures 21A-21C depict the tumor assessments and immunohistochemical detection of CD8+ T lymphocytes in a patient having metastatic atypical pulmonary carcinoid tumor with clinical response to the anti-PD-1 antibody molecule in the phase I/II study.
- Figure 21A depicts CT scan images showing response in the patient.
- the left panel shows liver metastasis prior to antibody treatment.
- the middle panel shows pseudo-progression in the liver (accompanied by significant shrinkage of lung lesions not shown) in the first restaging.
- the right panel shows response in all lesions in the second restaging.
- Figure 21B depicts the reduction in metastatic atypical pulmonary carcinoid tumor burden (% change from baseline) and individual lesions (lesion size (nm)) in the patient.
- Figure 21C depicts the images of immunohistochemistry staining showing high levels of CD8+ T lymphocytes in a tumor sample obtained from the patient during Cycle 2, Day 1.
- BL baseline
- C2D Cycle 2, Day 1.
- Figure 22A depicts the percent survival of mice implanted with MC38 cells after treatment with anti-PD-1 antibody, Compound A15 (once a week or daily), or a combination of anti-PD-1 antibody and Compound A15 (once a week or daily).
- Figure 22B depicts the mean tumor volume in mice implanted with MC38 cells after treatment with anti-PD-1 antibody, Compound A15 (daily), or a combination of anti-PD-1 antibody and Compound A15 (daily).
- Figure 22C depicts the mean tumor volume in mice implanted with MC38 cells after treatment with anti-PD-1 antibody, Compound A15 (once a week), or a combination of anti-PD-1 antibody and Compound A15 (once a week).
- Figure 23 depicts the enhancement in time to end point observed in animals treated with an anti-PD-L1 antibody molecule in combination with an anti-PD-1 antibody.
- Table 1 is a summary of the amino acid and nucleotide sequences for the murine, chimeric and humanized anti-PD-1 antibody molecules.
- the antibody molecules include murine mAb BAP049, chimeric mAbs BAP049-chi and BAP049-chi-Y, and humanized mAbs BAP049-hum01 to BAP049-hum16 and BAP049-Clone-A to BAP049-Clone-E.
- the amino acid and nucleotide sequences of the heavy and light chain CDRs, the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the amino acid and nucleotide sequences of the heavy and light chains are shown in this Table.
- Table 2 depicts the amino acid and nucleotide sequences of the heavy and light chain framework regions for humanized mAbs BAP049-hum01 to BAP049-hum16 and BAP049-Clone-A to BAP049-Clone-E.
- Table 3 depicts the constant region amino acid sequences of human IgG heavy chains and human kappa light chain.
- Table 4 shows the amino acid sequences of the heavy and light chain leader sequences for humanized mAbs BAP049-Clone-A to BAP049-Clone-E.
- Table 5 depicts exemplary PK parameters based on flat dosing schedules.
- Table 6 provides an exemplary listing of the therapeutic agents from Antigen-Presentation Combinations (Category A), Effector Cell Combinations (Category B) and Anti-tumor
- Table 7 is a summary of selected therapeutic agents that can be administered in combination with the anti-PD-1 antibody molecules and other immunomodulators (e.g., one or more of: an activator of a costimulatory molecule and/or an inhibitor of an immune checkpoint molecule) described herein.
- Table 7 provides from left to right the following: the Compound Designation of the second therapeutic agent, the Compound structure, and Patent publication(s) disclosing the Compound.
- Table 8 is a summary of exemplary biomarkers and sample collection, e.g., for evaluation of the effectiveness of the therapies (e.g., combination therapies) described herein.
- Table 9 is a summary of the objectives and endpoints in the phase I/II study.
- Table 10 is a summary of the patient demographics and characteristics in the phase I/II study.
- Table 11 shows the patient disposition in the phase I/II study.
- Table 12 shows the adverse events regardless of study drug relationship in the phase I/II study (any grad occurring in ⁇ 20% of patients– safety set).
- Table 13 shows the best overall response (based on investigator’s assessment of disease status using RECIST v1.1 criteria).
- antibody molecules e.g., humanized antibody molecules
- PD-1 Programmed Death 1
- Nucleic acid molecules encoding the antibody molecules, expression vectors, host cells and methods for making the antibody molecules are also provided.
- Pharmaceutical compositions and dose formulations comprising the antibody molecules are also provided.
- the anti-PD-1 antibody molecules disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent and/or diagnose disorders, such as cancerous disorders (e.g., solid and soft-tissue tumors), as well as infectious diseases (e.g., chronic infectious disorders or sepsis).
- compositions and methods for detecting PD-1, as well as methods for treating various disorders including cancer and/or infectious diseases, using the anti-PD-1 antibody molecules are disclosed herein.
- the anti-PD-1 antibody molecule is administered or used at a flat or fixed dose.
- compositions comprising a combination of two, three or more therapeutic agents chosen from one, two, or all of the following categories (i)-(iii): (i) an agent that enhances antigen presentation (e.g., tumor antigen presentation) (e.g., by enhancing one or more of dendritic cell activity or maturation, antigen uptake, or antigen processing); (ii) an agent that enhances an effector cell response (e.g., an immune effector cell response, e.g., B cell and/or T cell activation and/or mobilization, e.g., in the lymph node); or (iii) an agent that decreases tumor immunosuppression (e.g., increasing T cell infiltration and tumor cell killing).
- an agent that enhances antigen presentation e.g., tumor antigen presentation
- an agent that enhances an effector cell response e.g., an immune effector cell response, e.g., B cell and/or T cell activation and/or mobilization, e.g
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- the therapeutic agents in the combination can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
- the therapeutic agents or therapeutic protocol can be administered in any order. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
- the additional therapeutic agent utilized in this combination may be administered together in a single composition or administered separately in different compositions. In general, it is expected that additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- the additional therapeutic agent is administered at a therapeutic or lower- than therapeutic dose.
- the concentration of the second therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the second therapeutic agent is administered in combination with the first therapeutic agent, e.g., the anti-PD-1 antibody molecule, than when the second therapeutic agent is administered individually.
- the concentration of the first therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the first therapeutic agent is administered in combination with the second therapeutic agent than when the first therapeutic agent is administered individually.
- the concentration of the second therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower than the therapeutic dose of the second therapeutic agent as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70- 80%, or 80-90% lower.
- the concentration of the first therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower than the therapeutic dose of the first therapeutic agent as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40- 50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- inhibitortion includes a reduction in a certain parameter, e.g., an activity, of a given molecule, e.g., an immune checkpoint inhibitor.
- a certain parameter e.g., an activity, of a given molecule
- an immune checkpoint inhibitor e.g., an enzyme that catalyzes azes the oxidation of a compound that has a reduced capacity.
- inhibition of an activity e.g., a PD-1 or PD-L1 activity, of at least 5%, 10%, 20%, 30%, 40% or more is included by this term. Thus, inhibition need not be 100%.
- activation includes an increase in a certain parameter, e.g., an activity, of a given molecule, e.g., a costimulatory molecule.
- a certain parameter e.g., an activity, of a given molecule
- a costimulatory molecule e.g., a costimulatory molecule
- increase of an activity, e.g., a costimulatory activity, of at least 5%, 10%, 25%, 50%, 75% or more is included by this term.
- anti-cancer effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
- An“anti-cancer effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place.
- anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
- cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and
- lymphatic system to other parts of the body.
- cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain
- tumor cancer
- lung cancer cancer
- tumor and cancer are used interchangeably herein, e.g., both terms encompass solid and liquid, e.g., diffuse or
- cancer or“tumor” includes premalignant, as well as malignant cancers and tumors.
- the term“antigen presenting cell” or“APC” refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface.
- T-cells may recognize these complexes using their T-cell receptors (TCRs).
- APCs process antigens and present them to T-cells.
- costimulatory molecule refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
- Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
- Costimulatory molecules include, but are not limited to, an MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CD11a/CD18), 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, I
- Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
- immune effector cells include T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloid-derived phagocytes.
- Immuno effector refers to function or response, e.g., of an immune effector cell, that enhances or promotes an immune attack of a target cell.
- an immune effector function or response refers a property of a T or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
- primary stimulation and co-stimulation are examples of immune effector function or response.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- the terms“treat,”“treatment” and“treating” refer to the reduction or amelioration of the progression, severity and/or duration of a disorder, e.g., a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of the disorder resulting from the administration of one or more therapies.
- the terms“treat,”“treatment” and“treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
- compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%.91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- “functional variant” refers to polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol.48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- XBLAST and NBLAST can be used. See www.ncbi.nlm.nih.gov.
- hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
- Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
- Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2X SSC, 0.1% SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C; 3) high stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1% SDS at 65°C. Very high stringency conditions (4) are the preferred conditions and the ones that should be used unless otherwise specified.
- molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L- optical isomers and peptidomimetics.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- polypeptide polypeptide
- peptide protein
- protein protein
- the terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co- existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- Exemplary combinations of therapeutic agents from two or more of the antigen-presentation category (A), effector cell category (B), and anti-tumor immunosuppression category (C) are provided herein.
- the combinations of the present invention include one or more of the following: A1B1, A1B2, A1B3, A1B4, A1B5, A1B6, A1B7, A1B8, A1B9, A1B10, A1B11, A1B12, A2B1, A2B2, A2B3, A2B4, A2B5, A2B6, A2B7, A2B8, A2B9, A2B10, A2B11, A2B12, A3B1, A3B2, A3B3, A3B4, A3B5, A3B6, A3B7, A3B8, A3B9, A3B10, A3B11, A3B12, A4B1, A4B2, A4B3, A4B4, A4B5, A4B6, A4B7, A4B8, A4B9, A4B10, A4B11, A4B12, A5B1, A5B2, A5B3, A5B4, A5B5, A5B6,
- A11B12C5 A11B12C6, A11B12C7, A11B12C8, A11B12C9, A11B12C10, A11B12C11,
- the antibody molecule binds to a mammalian, e.g., human, PD-1.
- the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, (e.g., an epitope as described herein) on PD-1.
- antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
- the term“antibody molecule” includes, for example, a monoclonal antibody (including a full length antibody which has an immunoglobulin Fc region).
- an antibody molecule comprises a full length antibody, or a full length immunoglobulin chain.
- an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain.
- an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- an antibody molecule is a monospecific antibody molecule and binds a single epitope.
- a monospecific antibody molecule having a plurality of immunoglobulin variable domain sequences, each of which binds the same epitope.
- an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap. In an embodiment the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
- a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or tetraspecific antibody molecule, In an embodiment a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
- the first epitope is located on PD-1 and the second epitope is located on a TIM-3, LAG-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1, or PD-L2.
- an antibody molecule comprises a diabody, and a single-chain molecule, as well as an antigen-binding fragment of an antibody (e.g., Fab, F(ab’) 2 , and Fv).
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- VH heavy chain variable domain sequence
- VL light chain variable domain sequence
- an antibody molecule comprises or consists of a heavy chain and a light chain (referred to herein as a half antibody.
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab’, F(ab’) 2 , Fc, Fd, Fd’, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
- the preparation of antibody molecules can be monoclonal or polyclonal.
- An antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- the term“immunoglobulin” (Ig) is used interchangeably with the term“antibody” herein.
- antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab')2 fragment a bivalent fragment comprising two Fab fragment
- antibody includes intact molecules as well as functional fragments thereof.
- Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
- variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- VH and VL regions can be subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- CDR complementarity determining region
- HCDR1, HCDR2, HCDR3 three CDRs in each heavy chain variable region
- LCDR1, LCDR2, LCDR3 three CDRs in each light chain variable region
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991),“Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the“Chothia” number scheme are also sometimes referred to as“hypervariable loops.”
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- the CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
- the anti-PD-1 antibody molecules can include any combination of one or more Kabat CDRs and/or Chothia hypervariable loops, e.g., described in Table 1.
- the following definitions are used for the anti-PD-1 antibody molecules described in Table 1: HCDR1 according to the combined CDR definitions of both Kabat and Chothia, and HCCDRs 2-3 and LCCDRs 1-3 according the CDR definition of Kabat.
- each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- an“immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the PD-1 polypeptide, or an epitope thereof.
- the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the PD-1 polypeptide.
- the antigen-binding site of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- the terms“compete” or“cross-compete” are used interchangeably herein to refer to the ability of an antibody molecule to interfere with binding of an anti-PD-1 antibody molecule, e.g., an anti-PD-1 antibody molecule provided herein, to a target, e.g., human PD-1.
- the interference with binding can be direct or indirect (e.g., through an allosteric modulation of the antibody molecule or the target).
- the extent to which an antibody molecule is able to interfere with the binding of another antibody molecule to the target, and therefore whether it can be said to compete can be determined using a competition binding assay, for example, a FACS assay, an ELISA or BIACORE assay.
- a competition binding assay is a quantitative competition assay.
- a first anti-PD-1 antibody molecule is said to compete for binding to the target with a second anti-PD-1 antibody molecule when the binding of the first antibody molecule to the target is reduced by 10% or more, e.g., 20% or more, 30% or more, 40% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more in a competition binding assay (e.g., a competition assay described herein).
- a competition binding assay e.g., a competition assay described herein.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An“effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- the antibody molecule can be a polyclonal or a monoclonal antibody.
- the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No.5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International Publication WO 92/20791; Markland et al. International Publication No. WO 92/15679; Breitling et al. International Publication WO 93/01288; McCafferty et al. International Publication No. WO 92/01047; Garrard et al. International Publication No.
- the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- a rodent mouse or rat
- the non-human antibody is a rodent (mouse or rat antibody).
- Methods of producing rodent antibodies are known in the art.
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg, N. et al.1994 Nature 368:856-859; Green, L.L.
- An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No.4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al. (1987) PNAS 84:3439-3443; Liu et al., 1987, J. Immunol.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immunoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to PD-1.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Patent 5,225,539; Jones et al.1986 Nature 321:552-525; Verhoeyan et al.1988 Science 239:1534; Beidler et al.1988 J. Immunol.141:4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on March 26, 1987; Winter US 5,225,539), the contents of which is expressly incorporated by reference.
- humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in US 5,585,089, e.g., columns 12-16 of US 5,585,089, e.g., columns 12-16 of US
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. No.5,624,821 and U.S. Pat. No.5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- an antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
- a "derivatized" antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- another antibody e.g., a bispecific antibody or a diabody
- detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or
- Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5dimethylamine-1- napthalenesulfonyl chloride, phycoerythrin and the like.
- An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable.
- An antibody molecule may also be derivatized with a prosthetic group (e.g.,
- streptavidin/biotin and avidin/biotin may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin.
- Labeled antibody molecule can be used, for example, diagnostically and/or experimentally in a number of contexts, including (i) to isolate a predetermined antigen by standard techniques, such as affinity chromatography or immunoprecipitation; (ii) to detect a predetermined antigen (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the protein; (iii) to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
- standard techniques such as affinity chromatography or immunoprecipitation
- detect a predetermined antigen e.g., in a cellular lysate or cell supernatant
- a predetermined antigen e.g., in a cellular lysate or cell supernatant
- An antibody molecules may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety.
- Radioactive isotopes can be used in diagnostic or therapeutic applications.
- the invention provides radiolabeled antibody molecules and methods of labeling the same.
- a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
- the antibody molecule can be conjugated to a therapeutic agent.
- therapeutically active radioisotopes have already been mentioned.
- examples of other therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see e.g., U.S.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, CC-1065, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclinies (e.g., daunorubicin (formerly daunomycin) and
- the invention features a method of providing a target binding molecule that specifically binds to a target disclosed herein, e.g., PD-1 receptor.
- the target binding molecule is an antibody molecule.
- the method includes: providing a target protein that comprises at least a portion of non-human protein, the portion being homologous to (at least 70, 75, 80, 85, 87, 90, 92, 94, 95, 96, 97, 98% identical to) a corresponding portion of a human target protein, but differing by at least one amino acid (e.g., at least one, two, three, four, five, six, seven, eight, or nine amino acids); obtaining an antibody molecule that specifically binds to the antigen; and evaluating efficacy of the binding agent in modulating activity of the target protein.
- the method can further include administering the binding agent (e.g., antibody molecule) or a derivative (e.g., a humanized antibody molecule) to a human subject.
- the antibody molecule is a multi-specific (e.g., a bispecific or a trispecific) antibody molecule.
- Protocols for generating bispecific or heterodimeric antibody molecules are known in the art; including but not limited to, for example, the“knob in a hole” approach described in, e.g., US5731168; the electrostatic steering Fc pairing as described in, e.g., WO 09/089004, WO 06/106905 and WO 2010/129304; Strand Exchange Engineered Domains (SEED) heterodimer formation as described in, e.g., WO 07/110205; Fab arm exchange as described in, e.g., WO 08/119353, WO 2011/131746, and WO 2013/060867; double antibody conjugate, e.g., by antibody cross-linking to generate a bi-specific structure using a heterobifunctional reagent having an amine-reactive group and a sulfhydryl reactive group as described in
- the anti-PD-1 antibody molecule (e.g., a monospecific, bispecific, or multispecific antibody molecule) is covalently linked, e.g., fused, to another partner e.g., a protein e.g., one, two or more cytokines, e.g., as a fusion molecule for example a fusion protein.
- the fusion molecule comprises one or more proteins, e.g., one, two or more cytokines.
- the cytokine is an interleukin (IL) chosen from one, two, three or more of IL-1, IL-2, IL-12, IL-15 or IL-21.
- IL interleukin
- a bispecific antibody molecule has a first binding specificity to a first target (e.g., to PD-1), a second binding specificity to a second target (e.g., LAG-3 or TIM-3), and is optionally linked to an interleukin (e.g., IL-12) domain e.g., full length IL-12 or a portion thereof.
- a first target e.g., to PD-1
- a second binding specificity to a second target e.g., LAG-3 or TIM-3
- an interleukin e.g., IL-12 domain e.g., full length IL-12 or a portion thereof.
- A“fusion protein” and a“fusion polypeptide” refer to a polypeptide having at least two portions covalently linked together, where each of the portions is a polypeptide having a different property.
- the property may be a biological property, such as activity in vitro or in vivo.
- the property can also be simple chemical or physical property, such as binding to a target molecule, catalysis of a reaction, etc.
- the two portions can be linked directly by a single peptide bond or through a peptide linker, but are in reading frame with each other.
- This invention provides an isolated nucleic acid molecule encoding the above antibody molecule, vectors and host cells thereof.
- the nucleic acid molecule includes but is not limited to RNA, genomic DNA and cDNA.
- compositions that include a combination of one or more of: (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby treating the disorder, e.g., the hyperproliferative condition or disorder (e.g., the cancer).
- the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
- PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein.
- the combination includes a STING agonist.
- the combination is used to treat a cancer, e.g., a cancer described herein e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, an ovarian cancer, a fallopian tube carcinoma, a peritoneal carcinoma, a soft tissue sarcoma, an esophageal cancer, a head and neck cancer, an endometrial cancer, a cervical cancer, or a basal cell carcinoma), e.g., a hematologic malignancy (e.g., a leukemia (e.g., a chronic lymphocytic leukemia (CLL), or a lymphoma (e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma, Hodgkin lymphoma, non-
- a cancer
- the cancer is chosen from a head and neck cancer (e.g., a head and neck squamous cell carcinoma (HNSCC), a skin cancer (e.g., melanoma), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple negative breast cancer (TNBC)).
- HNSCC head and neck squamous cell carcinoma
- a skin cancer e.g., melanoma
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- TNBC triple negative breast cancer
- the STING agonist is cyclic dinucleotide, e.g., a cyclic dinucleotide comprising purine or pyrimidine nucleobases (e.g., adenosine, guanine, uracil, thymine, or cytosine nucleobases).
- the nucleobases of the cyclic dinucleotide comprise the same nucleobase or different nucleobases.
- the STING agonist comprises an adenosine or a guanosine nucleobase. In some embodiments, the STING agonist comprises one adenosine nucleobase and one guanosine nucleobase. In some embodiments, the STING agonist comprises two adenosine nucleobases or two guanosine nucleobases.
- the STING agonist comprises a modified cyclic dinucleotide, e.g., comprising a modified nucleobase, a modified ribose, or a modified phosphate linkage.
- the modified cyclic dinucleotide comprises a modified phosphate linkage, e.g., a thiophosphate.
- the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with 2’,5’ or 3’,5’ phosphate linkages. In some embodiments, the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with Rp or Sp stereochemistry around the phosphate linkages.
- the STING agonist is Rp,Rp dithio 2’,3’ c-di-AMP (e.g., Rp,Rp-dithio c-[A(2',5')pA(3',5')p]), or a cyclic dinucleotide analog thereof.
- the STING agonist is a compound depicted in U.S. Patent Publication No. US2015/0056224 (e.g., a compound in Figure 2c, e.g., compound 21 or compound 22).
- the STING agonist is c- [G(2',5')pG(3',5')p], a dithio ribose O-substituted derivative thereof, or a compound depicted in Fig.4 of PCT Publication Nos. WO 2014/189805 and WO 2014/189806.
- the STING agonist is c-[A(2',5')pA(3',5')p] or a dithio ribose O-substitued derivative thereof, or is a compound depicted in Fig.5 of PCT Publication Nos. WO 2014/189805 and WO 2014/189806.
- the STING agonist is c-[G(2',5')pA(3',5')p], or a dithio ribose O-substitued derivative thereof, or is a compound depicted in Fig.5 of PCT Publication Nos. WO 2014/189805 and WO 2014/189806.
- the STING agonist is 2'-0-propargyl-cyclic-[A(2',5')pA(3',5')p] (2'-0-propargyl- ML-CDA) or a compound depicted in Fig.7 of PCT Publication No. WO
- a combination described herein includes a Toll-like receptor (TLR) agonist.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, an ovarian cancer, a fallopian tube carcinoma, a peritoneal carcinoma, a soft tissue sarcoma, an esophageal cancer, a head and neck cancer, an endometrial cancer, a cervical cancer, or a basal cell carcinoma), e.g., a hematologic malignancy (e.g., a leukemia (e.g., a chronic lymphocytic leukemia (CLL), or a lymphoma (e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma
- a cancer
- TLRs are a family of pattern recognition receptors that were initially identified as sensors of the innate immune system that recognize microbial pathogens.
- the TLRs include TLR-1, TLR-2, TLR-3, TLR-4, TLR-5, TLR-6, TLR-7, TLR-8, TLR-9, and TLR-10.
- TLR-1, -2, -4, -5, and - 6, are expressed on the surface of cells and TLR-3, -7/8, and -9 are expressed with the ER compartment.
- Human dendritic cell subsets can be identified on the basis of distinct TLR expression patterns.
- the myeloid or“conventional” subset of human dendritic cells express TLRs 1-8 and the plasmacytoid subset of dendritic cells express only TLR-7 and TLR-9.
- Ligand binding to TLRs invokes a cascade of intra-cellular signaling pathways that induce the production of factors involved in inflammation and immunity.
- the myeloid subset and the plasmacytoid subset of human dendritic cells result in antigen-specific CD4+ and CD8+ T cell priming and activation of NK cells and T-cells, respectively.
- the TLR agonist is chosen from one or more of a TLR-1 agonist, a TLR-2 agonist, a TLR-3 agonist, a TLR-4 agonist, a TLR-5 agonist, a TLR-6 agonist, a TLR-7 agonist, a TLR-8 agonist, a TLR-9 agonist, a TLR-10 agonist, a TLR-1/2 agonist, a TLR-2/6 agonist, or a TLR-7/8 agonist.
- the TLR agonist is a TLR7 agonist.
- the TLR agonist is imiquimod or 3-(2-Methylpropyl)-3,5,8- triazatricyclo[7.4.0.02,6]trideca-1(9),2(6),4,7,10,12-hexaen-7-amine.
- Imiquimod or 3-(2- Methylpropyl)-3,5,8-triazatricyclo[7.4.0.02,6]trideca-1(9),2(6),4,7,10,12-hexaen-7-amine can bind to and activate TLR-7 and/or TLR-8.
- the TLR agonist is 852A.
- 852A is disclosed, e.g., in Inglefield et al. J Interferon Cytokine Res.2008;28(4):253-63. 852A can bind to and activate TLR-7 and/or TLR-8.
- the TLR agonist is Bacille Calmette-Guérin (BCG). BCG can bind to and activate TLR-9.
- the TLR agonist is EMD 120108.
- EMD 120108 is a synthetic oligonucleotide containing phosphorothioate oligodeoxynucleotide.
- EMD 1201081 can bind to and activate TLR-9, e.g., in monocytes/macrophages, plasmacytoid dendritic cells (DCs) and B cells, initiating immune signaling pathways, activating B cells and inducing T-helper cell cytokine production.
- the TLR agonist is IMO-2055.
- IMO-2055 is a synthetic oligonucleotide containing phosphorothioate oligodeoxynucleotide.
- EMD 1201081 can bind to and activate TLR-9, e.g., in monocytes/macrophages, plasmacytoid dendritic cells (DCs) and B cells, initiating immune signaling pathways, activating B cells and inducing T-helper cell cytokine production.
- IMO-2055 can bind to and activate TLR-9, e.g., in
- monocytes/macrophages monocytes/macrophages, plasmacytoid dendritic cells (DCs) and B cells, initiating immune signaling pathways and activating B cells and DCs and inducing T-helper cell cytokine production.
- DCs plasmacytoid dendritic cells
- B cells B cells
- TLR-1/2 agonists e.g., Pam3Cys
- TLR-2 agonists e.g., CFA, MALP2, Pam2Cys, FSL-1, or Hib-OMPC
- TLR-3 agonists e.g., polyribosinic:polyribocytidic acid (Poly I:C), polyadenosine-polyuridylic acid (poly AU), polyinosinic-polycytidylic acid stabilized with poly-L-lysine and carboxymethylcellulose (Hiltonol®)
- TLR-4 agonists e.g., monophosphoryl lipid A (MPL), LPS, sialyl-Tn (STn)
- TLR-5 agonists e.g., bacterial flagellin
- TLR-7 agonists e.g., imiquimod
- TLR-7/8 agonists e.g.
- the TLR agonist is used in combination with a GITR agonist, e.g., as described in WO2004060319, and International Publication No.: WO2014012479.
- a GITR agonist e.g., as described in WO2004060319, and International Publication No.: WO2014012479.
- a combination described herein includes a vascular endothelial growth factor (VEGF) receptor inhibitor (e.g., an inhibitor of one or more of VEGFR (e.g., VEGFR-1, VEGFR-2, VEGFR-3) or VEGF).
- VEGF vascular endothelial growth factor
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a melanoma, a breast cancer, a colon cancer, an esophageal cancer, a gastrointestinal stromal tumor (GIST), a kidney cancer (e.g., a renal cell cancer), a liver cancer, a non-small cell lung cancer (NSCLC), an ovarian cancer, a pancreatic cancer, a prostate cancer, or a stomach cancer), e.g., a hematologic malignancy (e.g., a lymphoma).
- a cancer described herein e.g., a solid tumor (e.g., a melanoma, a breast cancer, a colon cancer, an esophageal cancer, a gastrointestinal stromal tumor (GIST), a kidney cancer (e.g., a renal cell cancer), a liver cancer, a non-small cell
- the VEGFR inhibitor is vatalanib succinate (Compound A47) or a compound disclosed in EP 296122.
- the VEGFR inhibitor is an inhibitor of one or more of VEGFR-2, PDGFRbeta, KIT or Raf kinase C, 1-methyl-5-((2-(5-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-4- yl)oxy)-N-(4-(trifluoromethyl)phenyl)-1H-benzo[d]imidazol-2-amine (Compound A37) or a compound disclosed in PCT Publication No. WO 2007/030377.
- VEGFR pathway inhibitors that can be used in the combinations disclosed herein include, e.g., bevacizumab (AVASTIN®), axitinib (INLYTA®); brivanib alaninate (BMS- 582664, (S)-((R)-1-(4-(4-Fluoro-2-methyl-1H-indol-5-yloxy)-5-methylpyrrolo[2,1-f][1,2,4]triazin-6- yloxy)propan-2-yl)2-aminopropanoate); sorafenib (NEXAVAR®); pazopanib (VOTRIENT®); sunitinib malate (SUTENT®); cediranib (AZD2171, CAS 288383-20-1); vargatef (BIBF1120, CAS 928326-83-4); Foretinib (GSK1363089); telatinib (BAY57-9352, CAS 33
- vandetanib CAPRELSA® or AZD6474
- motesanib diphosphate AMG706, CAS 857876-30-3, N- (2,3-dihydro-3,3-dimethyl-1H-indol-6-yl)-2-[(4-pyridinylmethyl)amino]-3-pyridinecarboxamide, described in PCT Publication No.
- WO 02/066470 dovitinib dilactic acid (TKI258, CAS 852433-84- 2); linfanib (ABT869, CAS 796967-16-3); cabozantinib (XL184, CAS 849217-68-1); lestaurtinib (CAS 111358-88-4); N-[5-[[[5-(1,1-dimethylethyl)-2-oxazolyl]methyl]thio]-2-thiazolyl]-4- piperidinecarboxamide (BMS38703, CAS 345627-80-7); (3R,4R)-4-amino-1-((4-((3- methoxyphenyl)amino)pyrrolo[2,1-f][1,2,4]triazin-5-yl)methyl)piperidin-3-ol (BMS690514); N-(3,4- Dichloro-2-fluorophenyl)-6-methoxy-7-[[(
- anti-VEGF antibodies that can be used in the combinations disclosed herein include, e.g., a monoclonal antibody that binds to the same epitope as the monoclonal anti-VEGF antibody A4.6.1 produced by hybridoma ATCC HB 10709; a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res.57:4593-4599.
- the anti-VEGF antibody is Bevacizumab (BV), also known as rhuMAb VEGF or AVASTIN®. It comprises mutated human IgG1 framework regions and antigen-binding
- antibodies include those that bind to a functional epitope on human VEGF comprising of residues F17, Ml 8, D19, Y21, Y25, Q89, 191 , Kl 01, El 03, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183 and Q89.
- exemplary c-MET Inhibitors comprising of residues F17, Ml 8, D19, Y21, Y25, Q89, 191 , Kl 01, El 03, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183 and Q89.
- a combination described herein includes an inhibitor of c-MET.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a non-small cell lung cancer, a pancreatic cancer, a liver cancer, a thyroid cancer (e.g., anaplastic thyroid carcinoma), a brain tumor (e.g., a glioblastoma), a kidney cancer (e.g., a renal cell carcinoma), or a head and neck cancer (e.g., a head and neck squamous cell carcinoma).
- the cancer is a liver cancer, e.g., a hepatocellular carcinoma (HCC) (e.g., a c-MET- expressing HCC).
- HCC hepatocellular carcinoma
- the c-MET inhibitor is Compound A17 or a compound described in U.S. Patent Nos.7,767,675 and 8,420,645).
- c-MET a receptor tyrosine kinase overexpressed or mutated in many tumor cell types, plays key roles in tumor cell proliferation, survival, invasion, metastasis, and tumor angiogenesis. Inhibition of c-MET may induce cell death in tumor cells overexpressing c-MET protein or expressing constitutively activated c-MET protein.
- the c-MET inhibitor is JNJ-38877605.
- JNJ-38877605 is an orally available, small molecule inhibitor of c-Met. JNJ-38877605 selectively binds to c-MET, thereby inhibiting c-MET phosphorylation and disrupting c-Met signal transduction pathways.
- the c-Met inhibitor is AMG 208.
- AMG 208 is a selective small- molecule inhibitor of c-MET.
- AMG 208 inhibits the ligand-dependent and ligand-independent activation of c-MET, inhibiting its tyrosine kinase activity, which may result in cell growth inhibition in tumors that overexpress c-Met.
- the c-Met inhibitor is AMG 337.
- AMG 337 is an orally bioavailable inhibitor of c-Met.
- AMG 337 selectively binds to c-MET, thereby disrupting c-MET signal transduction pathways.
- the c-Met inhibitor is LY2801653.
- LY2801653 is an orally available, small molecule inhibitor of c-Met. LY2801653 selectively binds to c-MET, thereby inhibiting c-MET phosphorylation and disrupting c-Met signal transduction pathways.
- c-Met inhibitor is MSC2156119J.
- MSC2156119J is an orally bioavailable inhibitor of c-Met.
- MSC2156119J selectively binds to c-MET, which inhibits c-MET phosphorylation and disrupts c-Met-mediated signal transduction pathways.
- the c-MET inhibitor is capmatinib.
- Capmatinib is also known as INCB028060.
- Capmatinib is an orally bioavailable inhibitor of c-MET.
- Capmatinib selectively binds to c-Met, thereby inhibiting c-Met phosphorylation and disrupting c-Met signal transduction pathways.
- the c-MET inhibitor is crizotinib.
- Crizotinib is also known as PF- 02341066.
- Crizotinib is an orally available aminopyridine-based inhibitor of the receptor tyrosine kinase anaplastic lymphoma kinase (ALK) and the c-Met/hepatocyte growth factor receptor (HGFR).
- ALK receptor tyrosine kinase anaplastic lymphoma kinase
- HGFR c-Met/hepatocyte growth factor receptor
- Crizotinib in an ATP-competitive manner, binds to and inhibits ALK kinase and ALK fusion proteins.
- crizotinib inhibits c-Met kinase, and disrupts the c-Met signaling pathway. Altogether, this agent inhibits tumor cell growth.
- the c-MET inhibitor is golvatinib.
- Golvatinib is an orally bioavailable dual kinase inhibitor of c-MET and VEGFR-2 with potential antineoplastic activity. Golvatinib binds to and inhibits the activities of both c-MET and VEGFR-2, which may inhibit tumor cell growth and survival of tumor cells that overexpress these receptor tyrosine kinases.
- the c-MET inhibitor is tivantinib. Tivantinib is also known as ARQ 197. Tivantinib is an orally bioavailable small molecule inhibitor of c-MET.
- Tivantinib binds to the c-MET protein and disrupts c-Met signal transduction pathways, which may induce cell death in tumor cells overexpressing c-MET protein or expressing consitutively activated c-Met protein.
- a combination described herein includes a transforming growth factor beta (TGF- ⁇ ) inhibitor.
- TGF- ⁇ transforming growth factor beta
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a brain cancer (e.g., a glioma), a melanoma, a kidney cancer (e.g., a renal cell carcinoma), a pleural malignant mesothelioma (e.g., a relapsed pleural malignant mesothelioma), or a breast cancer (e.g., a metastatic breast cancer)).
- a cancer described herein e.g., a solid tumor (e.g., a brain cancer (e.g., a glioma), a melanoma, a kidney cancer (e.g., a renal cell carcinoma), a pleural malignant mesotheli
- the cancer is chosen from a colorectal cancer (e.g., a microsatelliate stable colorectal cancer (MSS CRC), a liver cancer (e.g., a hepatocellular carcinoma), a lung cancer (e.g., a non-small cell lung cancer (HSCLC)), a breast cancer (e.g., a triple negative breast cancer (TNBC)), a TGFb-expressing cancer, a pancreatic cancer, a prostate cancer, or a renal cancer (e.g., a renal cell carcinoma).
- a colorectal cancer e.g., a microsatelliate stable colorectal cancer (MSS CRC)
- a liver cancer e.g., a hepatocellular carcinoma
- a lung cancer e.g., a non-small cell lung cancer (HSCLC)
- HSCLC non-small cell lung cancer
- TNBC triple negative breast cancer
- TGFb-expressing cancer e.g.,
- TGF- ⁇ belongs to a large family of structurally-related cytokines including, e.g., bone morphogenetic proteins (BMPs), growth and differentiation factors, activins and inhibins.
- BMPs bone morphogenetic proteins
- the TGF- ⁇ inhibitors described herein can bind and/or inhibit one or more isoforms of TGF- ⁇ (e.g., one, two, or all of TGF- ⁇ 1, TGF- ⁇ 2, or TGF- ⁇ 3).
- TGF- ⁇ maintains homeostasis and limits the growth of epithelial, endothelial, neuronal and hematopoietic cell lineages, e.g., through the induction of anti-proliferative and apoptotic responses.
- Canonical and non-canonical signaling pathways are involved in cellular responses to TGF- ⁇ . Activation of the TGF- ⁇ /Smad canonical pathway can mediate the anti- proliferative effects of TGF- ⁇ .
- the non-canonical TGF- ⁇ pathway can activate additional intra- cellular pathways, e.g., mitogen-activated protein kinases (MAPK), phosphatidylinositol 3 kinase/Protein Kinase B, Rho-like GTPases (Tian et al. Cell Signal.2011; 23(6):951-62; Blobe et al. N Engl J Med.2000; 342(18):1350-8), thus modulating epithelial to mesenchymal transition (EMT) and/or cell motility.
- MTK mitogen-activated protein kinases
- EMT epithelial to mesenchymal transition
- TGF- ⁇ signaling pathway is associated with human diseases, e.g., cancers, cardio-vascular diseases, fibrosis, reproductive disorders, and wound healing.
- diseases e.g., cancers, cardio-vascular diseases, fibrosis, reproductive disorders, and wound healing.
- the role of TGF- ⁇ in cancer is dependent on the disease setting (e.g., tumor stage and genetic alteration) and/or cellular context.
- TGF- ⁇ can modulate a cancer-related process, e.g., by promoting tumor growth (e.g., inducing EMT), blocking anti-tumor immune responses, increasing tumor-associated fibrosis, or enhancing angiogenesis (Wakefield and Hill Nat Rev Cancer.2013; 13(5):328-41).
- a combination comprising a TGF- ⁇ inhibitor described herein is used to treat a cancer in a late stage, a metastatic cancer, or an advanced cancer.
- Preclinical evidence indicates that TGF- ⁇ plays an important role in immune regulation (Wojtowicz-Praga Invest New Drugs.2003; 21(1):21-32; Yang et al. Trends Immunol.2010;
- TGF- ⁇ can down-regulate the host-immune response via several mechanisms, e.g., shift of the T-helper balance toward Th2 immune phenotype; inhibition of anti-tumoral Th1 type response and M1-type macrophages; suppression of cytotoxic CD8+ T lymphocytes (CTL), NK lymphocytes and dendritic cell functions, generation of CD4+CD25+ T-regulatory cells; or promotion of M2-type macrophages with pro-tumoral activity mediated by secretion of immunosuppressive cytokines (e.g., IL10 or VEGF), pro-inflammatory cytokines (e.g., IL6, TNF ⁇ , or IL1) and generation of reactive oxygen species (ROS) with genotoxic activity (Yang et al.
- immunosuppressive cytokines e.g., IL10 or VEGF
- pro-inflammatory cytokines e.g., IL6, TNF ⁇ , or IL1
- the TGF- ⁇ inhibitor is fresolimumab (CAS Registry Number: 948564- 73-6).
- Fresolimumab is also known as GC1008.
- Fresolimumab is a human monoclonal antibody that binds to and inhibits TGF-beta isoforms 1, 2 and 3.
- the heavy chain of fresolimumab has the amino acid sequence of:
- the TGF- ⁇ inhibitor is XOMA 089.
- XOMA 089 is also known as XPA.42.089.
- XOMA 089 is a fully human monoclonal antibody that specifically binds and neutralizes TGF-beta 1 and 2 ligands.
- the heavy chain variable region of XOMA 089 has the amino acid sequence of:
- the light chain variable region of XOMA 089 has the amino acid sequence of: SYELTQPPSVSVAPGQTARITCGANDIGSKSVHWYQQKAGQAPVLVVSEDIIRPSGIPERISGS NSGNTATLTISRVEAGDEADYYCQVWDRDSDQYVFGTGTKVTVLG (SEQ ID NO: 241) (disclosed as SEQ ID NO: 8 in WO 2012/167143).
- XOMA 089 binds with high affinity to the human TGF- ⁇ isoforms. Generally, XOMA 089 binds with high affinity to TGF- ⁇ 1 and TGF- ⁇ 2, and to a lesser extent to TGF- ⁇ 3. In Biacore assays, the K D of XOMA 089 on human TGF- ⁇ is 14.6 pM for TGF- ⁇ 1, 67.3 pM for TGF- ⁇ 2, and 948 pM for TGF- ⁇ 3. Given the high affinity binding to all three TGF- ⁇ isoforms, in certain embodiments, XOMA 089 is expected to bind to TGF- ⁇ 1, 2 and 3 at a dose of XOMA 089 as described herein. XOMA 089 cross-reacts with rodent and cynomolgus monkey TGF- ⁇ and shows functional activity in vitro and in vivo, making rodent and cynomolgus monkey relevant species for toxicology studies.
- the combination includes an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule described herein) and a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein).
- an inhibitor of PD-1 e.g., an anti-PD-1 antibody molecule described herein
- a TGF- ⁇ inhibitor e.g., a TGF- ⁇ inhibitor described herein.
- resistance to PD-1 immunotherapy is associated with the presence of a transcriptional signature which includes, e.g., genes connected to TGF- ⁇ signaling and TGF- ⁇ -dependent processes, e.g., wound healing or angiogenesis (Hugo et al. Cell.2016; 165(1):35-44).
- TGF- ⁇ blockade extends the therapeutic window of a therapy that inhibits the PD-1/PD-L1 axis.
- TGF- ⁇ inhibitors can affect the clinical benefits of PD-1 immunotherapy, e.g., by modulating tumor microenvironment, e.g., vasculogenesis, fibrosis, or factors that affect the recruitment of effector T cells (Yang et al. Trends Immunol.2010; 31(6):220-7; Wakefield and Hill Nat Rev Cancer.2013; 13(5):328-41; Truty and Urrutia Pancreatology.2007; 7(5-6):423-35).
- tumor microenvironment e.g., vasculogenesis, fibrosis
- factors that affect the recruitment of effector T cells Yang et al. Trends Immunol.2010; 31(6):220-7; Wakefield and Hill Nat Rev Cancer.2013; 13(5):328-41; Truty and Urrutia Pancreatology.2007; 7(5-6):423-35).
- a number of elements of the anti-tumor immunity cycle express both PD-1 and TGF- ⁇ receptors, and PD-1 and TGF- ⁇ receptors are likely to propagate non-redundant cellular signals.
- PD-1 and TGF- ⁇ receptors are likely to propagate non-redundant cellular signals.
- TGF- ⁇ signaling in adoptively transferred T cells increases their persistence and antitumor activity (Chou et al. J Immunol. 2012; 189(8):3936-46).
- the antitumor activity of the transferred T cells may decrease over time, partially due to PD-1 upregulation in tumor-infiltrating lymphocytes, supporting a combination of PD- 1 and TGF- ⁇ inhibition as described herein.
- the use of neutralizing antibodies against either PD-1 or TGF- ⁇ can also affect Tregs, given their high expression levels of PD-1 and their responsiveness to TGF- ⁇ stimulation (Riella et al. Am J Transplant.2012; 12(10):2575-87), supporting a combination of PD-1 and TGF- ⁇ inhibition to treat cancer, e.g., by enhancing the modulation of Tregs
- cancers can use TGF- ⁇ to escape immune surveillance to facilitate tumor growth and metastatic progression.
- TGF- ⁇ pathway can promote one or more of cancer cell motility, invasion, EMT, or a stem cell phenotype.
- Immune regulation mediated by cancer cells and leukocyte populations e.g., through a variety of cell-expressed or secreted molecules, e.g., IL-10 or TGF- ⁇ may limit the response to checkpoint inhibitors as monotherapy in certain patients.
- a combined inhibition of TGF- ⁇ with a checkpoint inhibitor is used to treat a cancer that does not respond, or responds poorly, to a checkpoint inhibitor (e.g., anti-PD-1) monotherapy, e.g., a pancreatic cancer or a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS-CRC)).
- a checkpoint inhibitor e.g., anti-PD-1 monotherapy, e.g., a pancreatic cancer or a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS-CRC)).
- a combined inhibition of TGF- ⁇ with a checkpoint inhibitor is used to treat a cancer that shows a high level of effector T cell infiltration, e.g., a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a liver cancer (e.g., a hepatocellular carcinoma), a prostate cancer, or a renal cancer (e.g., a clear cell renal cell carcinoma).
- a lung cancer e.g., a non-small cell lung cancer
- a breast cancer e.g., a triple negative breast cancer
- a liver cancer e.g., a hepatocellular carcinoma
- a prostate cancer e.g., a clear cell renal cell carcinoma
- a renal cancer e.g., a clear cell renal cell carcinoma
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.1 mg/kg and 20 mg/kg, e.g., between 0.1 mg/kg and 15 mg/kg, between 0.1 mg/kg and 12 mg/kg, between 0.3 mg/kg and 6 mg/kg, between 1 mg/kg and 3 mg/kg, between 0.1 mg/kg and 1 mg/kg, between 0.1 mg/kg and 0.5 mg/kg, between 0.1 mg/kg and 0.3 mg/kg, between 0.3 mg/kg and 3 mg/kg, between 0.3 mg/kg and 1 mg/kg, between 3 mg/kg and 6 mg/kg, or between 6 mg/kg and 12 mg/kg, e.g., at a dose of about 0.1 mg/kg, 0.3 mg/kg, 0.5 mg/kg, 1 mg/kg, 3 mg/kg, 6 mg/kg, 12 mg/kg, or 15 mg/kg, e.g.,
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.1 mg/kg and 15 mg/kg (e.g., between 0.3 mg/kg and 12 mg/kg or between 1 mg/kg and 6 mg, e.g., about 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 6 mg/kg, 12 mg/kg, or 15 mg/kg), e.g., once every three weeks.
- WO 2012/167143 can be administered at a dose between 0.1 mg/kg and 1 mg/kg (e.g., between 0.1 mg/kg and 1 mg/kg, e.g., 0.3 mg/kg), e.g., once every three weeks.
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered intravenously.
- the combination includes a TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143, and an inhibitor of PD-1 (e.g., an anti-PD-1 antibody described herein).
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.1 mg/kg and 15 mg/kg (e.g., between 0.3 mg/kg and 12 mg/kg or between 1 mg/kg and 6 mg, e.g., about 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 6 mg/kg, 12 mg/kg, or 15 mg/kg), e.g., once every three weeks, e.g., intravenously, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 50 mg and 500 mg (e.g., between 100 mg and 400 mg, e.g., at a dose of about 100 mg, 200 mg, 300 mg, or 400 mg), e.g., once every 3 weeks or once every 4 weeks, e.g., by intravenous infusion.
- PD-1 e.g.,
- the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 100 mg and 300 mg (e.g., at a dose of about 100 mg, 200 mg, or 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion.
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose of about 0.1 mg/kg or 0.3 mg/kg, e.g., once every 3 weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose of about 100 mg, e.g., once every 3 weeks, e.g., by intravenous infusion.
- WO 2012/167143 is administered at a dose of about 0.3 mg/kg, e.g., once every 3 weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose of about 100 mg or 300 mg, e.g., once every 3 weeks, e.g., by intravenous infusion.
- WO 2012/167143 is administered at a dose of about 1 mg/kg, 3 mg/kg, 6 mg/kg, 12 mg/kg, or 15 mg/kg, e.g., once every 3 weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose of about 300 mg, e.g., once every 3 weeks, e.g., by intravenous infusion.
- the inhibitor of PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.1 mg and 0.2 mg (e.g., about 0.1 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 50 mg and 200 mg (e.g., about 100 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.2 mg and 0.5 mg (e.g., about 0.3 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 50 mg and 200 mg (e.g., about 100 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 0.2 mg and 0.5 mg (e.g., about 0.3 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- WO 2012/167143 is administered at a dose between 0.5 mg and 2 mg (e.g., about 1 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 2 mg and 5 mg (e.g., about 3 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 5 mg and 10 mg (e.g., about 6 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 10 mg and 15 mg (e.g., about 12 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered at a dose between 10 mg and 20 mg (e.g., about 15 mg/kg), e.g., once every three weeks, e.g., by intravenous infusion, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered at a between 200 mg and 400 mg (e.g., about 300 mg), e.g., once every three weeks, e.g., by intravenous infusion.
- PD-1 e.g., the anti-PD-1 antibody molecule
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered before the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered.
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered after the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) is administered.
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143, and the inhibitor of PD-1 (e.g., the anti-PD-1 antibody molecule) are administered separately with at least a 30-minute (e.g., at least 1, 1.5, or 2 hours) break between the two administrations.
- the TGF- ⁇ inhibitor, XOMA 089, or a compound disclosed in PCT Publication No. WO 2012/167143 is administered in combination with an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule) to treat a pancreatic cancer, a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS-CRC)), a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), a liver cancer (e.g., a hepatocellular carcinoma), a prostate cancer, or a renal cancer (e.g., a clear cell renal cell carcinoma).
- PD-1 e.g., an anti-PD-1 antibody molecule
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS-CRC)
- a lung cancer e.g., a non-small cell lung cancer
- a combination described herein includes an inhibitor of indoleamine 2,3- dioxygenase (IDO) and/or tryptophan 2,3-dioxygenase (TDO).
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., melanoma, non-small cell lung cancer, colon cancer, squamous cell head and neck cancer, ovarian cancer, peritoneal cancer, fallopian tube cancer, breast cancer (e.g., metastatic or HER2-negative breast cancer)), e.g., a hematologic malignancy (e.g., a lymphoma, e.g., a non-Hodgkin's lymphoma or a Hodgkin’s lymphoma (e.g., a diffuse large B-cell lymphoma (DLBCL))).
- a cancer described herein e.g., a
- the IDO/TDO inhibitor is chosen from (4E)-4-[(3-chloro-4- fluoroanilino)-nitrosomethylidene]-1,2,5-oxadiazol-3-amine (also known as INCB24360), indoximod (1-methyl-D-tryptophan), or ⁇ -cyclohexyl-5H-Imidazo[5,1-a]isoindole-5-ethanol (also known as NLG919).
- the IDO/TDO inhibitor is epacadostat (CAS Registry Number:
- Epacadostat is also known as INCB24360 or INCB024360 (Incyte). Epacadostat is a potent and selective indoleamine 2,3-dioxygenase (IDO1) inhibitor with IC50 of 10 nM, highly selective over other related enzymes such as IDO2 or tryptophan 2,3-dioxygenase (TDO).
- IDO1 indoleamine 2,3-dioxygenase
- TDO tryptophan 2,3-dioxygenase
- the IDO/TDO inhibitor is indoximod (New Link Genetics).
- Indoximod the D isomer of 1-methyl-tryptophan, is an orally administered small-molecule indoleamine 2,3- dioxygenase (IDO) pathway inhibitor that disrupts the mechanisms by which tumors evade immune- mediated destruction.
- IDO indoleamine 2,3- dioxygenase
- the IDO/TDO inhibitor is NLG919 (New Link Genetics).
- NLG919 is a potent IDO (indoleamine-(2,3)-dioxygenase) pathway inhibitor with Ki/EC50 of 7 nM/75 nM in cell- free assays.
- the IDO/TDO inhibitor is F001287 (Flexus/BMS).
- F001287 is a small molecule inhibitor of indoleamine 2,3-dioxygenase 1 (IDO1).
- IDO1 indoleamine 2,3-dioxygenase 1
- a combination described herein includes an adenosine A2a receptor (A2aR) antagonist (e.g., an inhibitor of A2aR pathway, e.g., an adenosine inhibitor, e.g., an inhibitor of A2aR or CD-73).
- A2aR adenosine A2a receptor
- the combination is used to treat a cancer, e.g., a cancer described herein.
- the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- the A2aR antagonist is istradefylline (CAS Registry Number: 155270- 99-8).
- Istradefylline is also known as KW-6002 or 8-[(E)-2-(3,4-dimethoxyphenyl)vinyl]-1,3-diethyl- 7-methyl-3,7-dihydro-1H-purine-2,6-dione.
- Istradefylline is disclosed, e.g., in LeWitt et al. (2008) Annals of Neurology 63 (3): 295–302).
- the A2aR antagonist is tozadenant (Biotie). Tozadenant is also known as SYN115 or 4-hydroxy-N-(4-methoxy-7-morpholin-4-yl-1,3-benzothiazol-2-yl)-4- methylpiperidine-1-carboxamide. Tozadenant blocks the effect of endogenous adenosine at the A2a receptors, resulting in the potentiation of the effect of dopamine at the D2 receptor and inhibition of the effect of glutamate at the mGluR5 receptor. In some embodiments, the A2aR antagonist is preladenant (CAS Registry Number: 377727-87-2).
- Preladenant is also known as SCH 420814 or 2- (2-Furanyl)-7-[2-[4-[4-(2-methoxyethoxy)phenyl]-1-piperazinyl]ethyl]7H-pyrazolo[4,3- e][1,2,4]triazolo[1,5-c]pyrimidine-5-amine.
- Preladenant was developed as a drug that acted as a potent and selective antagonist at the adenosine A2A receptor.
- the A2aR antagonist is vipadenan. Vipadenan is also known as BIIB014, V2006, or 3-[(4-amino-3-methylphenyl)methyl]-7-(furan-2-yl)triazolo[4,5-d]pyrimidin-5- amine.
- the A2aR antagonist is PBF-509 (Palobiofarma).
- the A2aR antagonist, e.g., PBF-509 is administered at a daily dose of about 80 mg, 160 mg, or 240 mg.
- A2aR antagonists include, e.g., ATL-444, MSX-3, SCH-58261, SCH- 412,348, SCH-442,416, VER-6623, VER-6947, VER-7835, CGS-15943, or ZM-241,385.
- the A2aR antagonist is an A2aR pathway antagonist (e.g., a CD-73 inhibitor, e.g., an anti-CD73 antibody) is MEDI9447.
- MEDI9447 is a monoclonal antibody specific for CD73. Targeting the extracellular production of adenosine by CD73 may reduce the
- MEDI9447 was reported to have a range of activities, e.g., inhibition of CD73 ectonucleotidase activity, relief from AMP-mediated lymphocyte suppression, and inhibition of syngeneic tumor growth. MEDI9447 can drive changes in both myeloid and lymphoid infiltrating leukocyte populations within the tumor microenvironment. These changes include, e.g., increases in CD8 effector cells and activated macrophages, as well as a reduction in the proportions of myeloid-derived suppressor cells (MDSC) and regulatory T lymphocytes.
- MDSC myeloid-derived suppressor cells
- a combination as described herein includes an oncolytic virus.
- oncolytic viruses are capable of selectively replicating in and triggering the death of or slowing the growth of a cancer cell. In some cases, oncolytic viruses have no effect or a minimal effect on non-cancer cells.
- the combination is used to treat a cancer, e.g., a cancer described herein.
- the cancer is a brain cancer, e.g., a glioblastoma (GBM).
- An oncolytic virus includes, but is not limited to, an oncolytic adenovirus, oncolytic Herpes Simplex Viruses, oncolytic retrovirus, oncolytic parvovirus, oncolytic vaccinia virus, oncolytic Sindbis virus, oncolytic influenza virus, or oncolytic RNA virus (e.g., oncolytic reovirus, oncolytic Newcastle Disease Virus (NDV), oncolytic measles virus, or oncolytic vesicular stomatitis virus (VSV)).
- an oncolytic adenovirus e.g., oncolytic Herpes Simplex Viruses, oncolytic retrovirus, oncolytic parvovirus, oncolytic vaccinia virus, oncolytic Sindbis virus, oncolytic influenza virus, or oncolytic RNA virus (e.g., oncolytic reovirus, oncolytic Newcastle Disease Virus (NDV), oncolytic measles virus, or oncolytic vesicular stomatitis
- the oncolytic virus is a recombinant herpes virus, e.g., a herpes simplex virus (HSV) that comprises a gene encoding GM-CSF.
- HSV herpes simplex virus
- insertion of GM-CSF gene can enhance an anti-tumor immune response, e.g., by recruiting and stimulating dendritic cells to tumor site.
- Other modifications can be made to the virus, e.g., to attenuate the virus and/or to increase selectivity for cancer cells.
- the recombinant herpes virus lacks a functional ICP34.5 gene, a functional ICP47 gene, or both.
- deletion of ICP34.5 gene prevents HSV infection of non-tumor cells or provides tumor-selective replication.
- deletion of ICP47 gene allows for or increases antigen presentation. Deletion of ICP47 can cause increased expression of the HSV US11 gene and allows US11 to be expressed as an immediate early and not a late gene. This may further enhance the degree of viral replication and oncolysis of tumor cells.
- HSV-1 strain JS1 is used, e.g., to improve tumor cell killing ability compared with other HSV-1 strains.
- the recombinant herpes virus is talimogene laherparepvec (T-VEC). T-VEC is based on herpes simplex virus type 1 (HSV-1) modified to include a gene that codes for human GM-CSF. Talimogene laherparepvec is described, e.g., in International Application
- the combination is used to treat a melanoma, a head and neck cancer, a pancreatic cancer, a breast cancer, a colorectal cancer, or a renal cancer (e.g., a renal cell carcinoma).
- the oncolytic virus is recombinant herpes virus, e.g., a neuroattenuated, replication-restricted herpes simplex virus type 1 (HSV-1).
- the recombinant herpes virus is ICP34.5 gene-deleted.
- the recombinant herpes virus is not capable of replication in non-divising cells.
- the recombinant herpes virus is engineered from wild-type strain 17.
- the recombinant herpes virus is HSV1716 (SEPREHVIR®).
- HSV1716 SEPREHVIR®
- oncolytic HSV1716 replicates in, and lyses dividing cells such as tumor cells.
- HSV1716 is described, e.g., in International Application Publication No. WO 2003/068809.
- the combination is used to treat a glioma (e.g., a high grade glioma), a head and neck cancer (e.g., a squamous cell carcinoma of head and neck), a melanoma, a liver cancer (e.g., a hepatocellular carcinoma), a pleural mesothelioma, or a non-CNS pediatric cancer.
- a glioma e.g., a high grade glioma
- a head and neck cancer e.g., a squamous cell carcinoma of head and neck
- a melanoma e.g., a melanoma
- a liver cancer e.g., a hepatocellular carcinoma
- a pleural mesothelioma e.g., a non-CNS pediatric cancer.
- the oncolytic virus is a vaccinia virus.
- the vaccinia virus includes a gene that activate cytotoxic T cell production (e.g., a TIR-domain-containing adapter-inducing interferon- ⁇ (TRIF) gene), a gene that decreases immune blockade (e.g., a hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD) gene), or both.
- the surface of the vaccinia virus is deglycosylated.
- the vaccinia virus has one or more (e.g., two, three or all) of the properties chosen from cancer lysis, immune adaptation, T cell stimulation, or removal of immune inhibition.
- the vaccinia virus is engineered from strain Western Reserve.
- the oncolytic virus is WO-12 (Western Oncolytics Ltd., US).
- the combination is used to treat a solid tumor.
- the oncolytic virus is a recombinant poliovirus, e.g., a live attenuated, nonpathogenic oncolytic virus in which the internal ribosomal entry site (IRES) is replaced with a heterologous IRES, e.g., to reduce or avoid neurovirulence.
- the heterologous IRES is an IRES from human rhinovirus type 2 (HRV2).
- the recombinant poliovirus is oncolytic poliovirus PVS-RIPO (also known as PVSRIPO). PVS-RIPO is a genetically modified nonpathogenic version of the oral poliovirus Sabin type 1 where the internal ribosomal entry site (IRES) on the poliovirus is replaced with the IRES from human rhinovirus type 2 (HRV2).
- PVS-RIPO preferentially propagates in susceptible, nonneuronal cells (e.g., glioblastoma multiforme (GBM)) due to the heterologous HRV2 in this recombinant virus.
- GBM glioblastoma multiforme
- the poliovirus can be selectively taken up by and replicates in tumor cells expressing CD155
- CD155 an oncofetal cell adhesion molecule and tumor antigen, is ectopically expressed in certain cancers, such as GMB, and plays a role in tumor cell migration, invasion, and metastasis.
- PVS-RIPO is described, e.g., in International Application Publication No. WO 2014/081937.
- the combination is used to treat a solid tumor, e.g., a solid tumor expressing CD155.
- the combination is used to treat a brain cancer, e.g., a glioblastoma.
- the oncolytic virus is a virus, e.g., recombinant oncolytic virus, described in US2010/0178684 A1, which is incorporated herein by reference in its entirety.
- a recombinant oncolytic virus comprises, or comprises a nucleic acid sequence (e.g., heterologous nucleic acid sequence) encoding, an inhibitor of an immune or inflammatory response, e.g., as described in US2010/0178684 A1, incorporated herein by reference in its entirety.
- the recombinant oncolytic virus comprises, or comprises a nucleic acid sequence encoding, a pro-apoptotic protein (e.g., apoptin), a cytokine (e.g., GM-CSF, CSF, interferon-gamma, interleukin-2 (IL-2), tumor necrosis factor-alpha), an immunoglobulin (e.g., an antibody against ED-B firbonectin), a tumor associated antigen, a bispecific adapter protein (e.g., bispecific antibody or antibody fragment directed against NDV HN protein and a T cell co- stimulatory receptor, such as CD3 or CD28; or a fusion protein between human IL-2 and single chain antibody directed against NDV HN protein).
- a pro-apoptotic protein e.g., apoptin
- a cytokine e.g., GM-CSF, CSF, interferon-gamma, interleukin-2 (IL-2
- the oncolytic virus is a chimeric oncolytic NDV described in US 8591881 B2, US 2012/0122185 A1, or US 2014/0271677 A1, each of which is incorporated herein by reference in their entireties.
- the oncolytic virus comprises a conditionally replicative adenovirus (CRAd), which is designed to replicate exclusively in cancer cells. See, e.g., Alemany et al. Nature Biotechnol.18(2000):723-27.
- CRAd conditionally replicative adenovirus
- an oncolytic adenovirus comprises one described in Table 1 on page 725 of Alemany et al., incorporated herein by reference in its entirety.
- Exemplary oncolytic viruses include but are not limited to the following:
- Group B Oncolytic Adenovirus (ColoAd1) (PsiOxus Therapeutics Ltd.) (see, e.g., Clinical Trial Identifier: NCT02053220);
- ONCOS-102 (previously called CGTG-102), which is an adenovirus comprising granulocyte- macrophage colony stimulating factor (GM-CSF) (Oncos Therapeutics) (see, e.g., Clinical Trial Identifier: NCT01598129);
- GM-CSF granulocyte- macrophage colony stimulating factor
- VCN-01 which is a genetically modified oncolytic human adenovirus encoding human PH20 hyaluronidase (VCN Biosciences, S.L.) (see, e.g., Clinical Trial Identifiers: NCT02045602 and NCT02045589);
- Conditionally Replicative Adenovirus ICOVIR-5 which is a virus derived from wild-type human adenovirus serotype 5 (Had5) that has been modified to selectively replicate in cancer cells with a deregulated retinoblastoma/E2F pathway (Institut Català d'Oncologia) (see, e.g., Clinical Trial Identifier: NCT01864759);
- Celyvir which comprises bone marrow-derived autologous mesenchymal stem cells (MSCs) infected with ICOVIR5, an oncolytic adenovirus (Hospital Infantil Universitario Ni ⁇ o Jes ⁇ s, Madrid, Spain/ Ramon Alemany) (see, e.g., Clinical Trial Identifier: NCT01844661);
- CG0070 which is a conditionally replicating oncolytic serotype 5 adenovirus (Ad5) in which human E2F-1 promoter drives expression of the essential E1a viral genes, thereby restricting viral replication and cytotoxicity to Rb pathway-defective tumor cells (Cold Genesys, Inc.) (see, e.g., Clinical Trial Identifier: NCT02143804); or
- DNX-2401 (formerly named Delta-24-RGD), which is an adenovirus that has been engineered to replicate selectively in retinoblastoma (Rb)-pathway deficient cells and to infect cells that express certain RGD-binding integrins more efficiently (Clinica Universidad de Navarra, Universidad de Navarra/ DNAtrix, Inc.) (see, e.g., Clinical Trial Identifier: NCT01956734).
- an oncolytic virus described herein is administering by injection, e.g., subcutaneous, intra-arterial, intravenous, intramuscular, intrathecal, or intraperitoneal injection.
- an oncolytic virus described herein is administered intratumorally, transdermally, transmucosally, orally, intranasally, or via pulmonary administration.
- Exemplary Vaccines e.g., Scaffold Vaccines
- a combination described herein includes a vaccine, e.g., a scaffold vaccine.
- the combination is used to treat a cancer, e.g., a cancer described herein.
- Cancer vaccines are disclosed, e.g., in PCT Publication Nos. WO 2007/070660 and WO 2012/167230, EP 1960009 B1, U.S. Patent Nos. US 8,067,237 and US 8,932,583, and U.S. Publication No. US 2011/0020216.
- the components that can be used within cancer vaccines e.g., implantable scaffold materials
- Methods that can be used for administration of cancer vaccines are disclosed, e.g., in PCT Publication Nos. WO 2013/158673, WO 2012/048165, and WO 2012/149358.
- the cancer vaccine includes a macroporous scaffold comprising (i) cells or a cell recruitment composition, and (ii) a deployment signal capable of inducing or promoting migration of cells, and (iii) a bioactive composition coated or seeded onto/into the scaffold, which causes cells recruited into the scaffold be modified. Migration of the modified cells can be promoted by the open, interconnected macropores and the deployment signal.
- the cancer vaccine induces an endogenous immune response to a cancer target via administration of a porous scaffold bearing a recruitment composition and a target antigen composition, wherein an endogenous antigen presenting cell is recruited into the scaffold to encounter antigen and where said cell resides until a deployment signal induces egress to a lymph node tissue outside the scaffold, thereby stimulating an endogenous immune response to said cancer target.
- the cancer vaccine is used to remove a target cell from a mammal using a scaffold composition.
- an in situ cancer vaccine is generated via recruitment of cancer cells to an implanted scaffold and destruction of the cells using a cytotoxic agent.
- a cytosine-guanosine oligonucleotide (CpG-ODN) is used as a component of a scaffold, which can effectively reprogram and deploy dendritic cells recruited to the scaffold, and generate an effective anti-tumor response.
- polyinosine-polycytidylic acid (poly I:C) and/or CpG ODN are used to exert a synergistic effect on tumor inhibition.
- porous rods comprising an immune cell recruitment compound (e.g. GM-CSF) and an immune cell activation compound (e.g. CpG ODN), and optionally comprising an antigen such as a tumor lysate, are used, e.g., to elicit an immune response to a vaccine antigen.
- an immune cell recruitment compound e.g. GM-CSF
- an immune cell activation compound e.g. CpG ODN
- an antigen such as a tumor lysate
- pores that facilitate recruitment or release of cells are formed in situ within hydrogels following hydrogel injection.
- injectable shape memory porous hydrogel polymer is used for administration.
- the combinations disclosed herein include a cancer or tumor vaccine.
- tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MART1 and/or tyrosinase, tumor cells transfected to express the cytokine GM-CSF, DNA-based vaccines, RNA-based vaccines, and viral transduction- based vaccines.
- the cancer vaccine may be prophylactic or therapeutic.
- GM-CSF has been shown to be a potent activator of antigen presentation for tumor vaccination (Dranoff et al. (1993) Proc. Natl. Acad. Sci. U.S.A.90: 3539-43).
- the combinations disclosed herein can be used in conjunction with a collection of recombinant proteins and/or peptides expressed in a tumor in order to generate an immune response to these proteins.
- These proteins are normally viewed by the immune system as self antigens and are therefore tolerant to them.
- the tumor antigen may also include the protein telomerase, which is required for the synthesis of telomeres of chromosomes and which is expressed in more than 85% of human cancers and in only a limited number of somatic tissues (Kim, N et al. (1994) Science 266: 2011-2013). (These somatic tissues may be protected from immune attack by various means).
- Tumor antigen may also be "neo-antigens" expressed in cancer cells because of somatic mutations that alter protein sequence or create fusion proteins between two unrelated sequences (e.g., bcr-abl in the Philadelphia chromosome), or idiotype from B cell tumors.
- tumor vaccines may include the proteins from viruses implicated in human cancers such a Human Papilloma Viruses (HPV), Hepatitis Viruses (HBV and HCV), Kaposi's Herpes Sarcoma Virus (KHSV), and Epstein–Barr virus (EBV).
- HPV Human Papilloma Viruses
- HBV and HCV Hepatitis Viruses
- KHSV Kaposi's Herpes Sarcoma Virus
- EBV Epstein–Barr virus
- Another form of tumor specific antigen which may be used in conjunction with PD-1 blockade is purified heat shock proteins (HSP) isolated from the tumor tissue itself. These heat shock proteins contain fragments of proteins from the tumor cells and these HSPs are highly efficient at delivery to antigen presenting cells for eliciting tumor immunity (Suot, R & Srivastava, P (1995) Science 269:1585-1588; Tamura, Y. et al. (1997) Science 278:117-
- DC Dendritic cells
- DC's can be produced ex vivo and loaded with various protein and peptide antigens as well as tumor cell extracts (Nestle, F. et al. (1998) Nature Medicine 4: 328-332). DCs may also be transduced by genetic means to express these tumor antigens as well. DCs have also been fused directly to tumor cells for the purposes of immunization (Kugler, A. et al. (2000) Nature Medicine 6:332-336). As a method of vaccination, DC immunization may be effectively combined with other agent, e.g., PD-1 blockade, to activate more potent anti-tumor responses.
- Exemplary Bispecific T-cell engagers e.g., PD-1 blockade
- a combination described herein includes a bispecific T-cell engager.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a gastrointestinal cancer, a melanoma, or a lung cancer) or a hematologic malignancy (e.g., a lymphoma (e.g., non-Hodgkin’s lymphoma) or a leukemia (e.g., an acute lymphoblastic leukemia).
- a cancer e.g., a cancer described herein, e.g., a solid tumor (e.g., a gastrointestinal cancer, a melanoma, or a lung cancer) or a hematologic malignancy (e.g., a lymphoma (e.g., non-Hodgkin’s lymphoma) or a leukemia (e.g., an acute lymphoblastic
- Bi-specific T-cell engagers are a class of artificial bispecific monoclonal antibodies that can direct a host's immune system, e.g., the T cells' cytotoxic activity, against cancer cells.
- Bi- specific T-cell engagers can form a link between T cells and tumor cells, which causes T cells to exert cytotoxic activity on tumor cells by producing proteins like perforin and granzymes, independently of the presence of MHC I or co-stimulatory molecules. These proteins enter tumor cells and initiate the cell's apoptosis. This action mimics physiological processes observed during T cell attacks against tumor cells.
- the bi-specific T-cell engager is a fusion protein comprising two single-chain variable fragments (scFvs) of different antibodies.
- one of the scFvs binds to T cells, e.g., via the CD3 receptor, and the other to a tumor cell, e.g., via a tumor specific molecule.
- the bi-specific T-cell engager is a bispecific antibody molecule of NKG2A and CD138, or a bispecific antibody molecule of CD3 and TCR. In some embodiments, the bispecific T-cell engager is a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
- a tumor antigen e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others.
- the bi-specific T-cell engager is blinatumomab (CAS Registry Number: 853426-35-4).
- Blinatumomab is also known as MT103.
- Blinatumomab specifically targets a CD3 site for T cells and a CD19 site for B cells.
- the bi-specific T-cell engager is MT110.
- MT110 is a single-chain antibody that targets EpCAM and CD3.
- MT110 is disclosed, e.g., in Amann et al. J Immunother. 2009;32(5):452-64.
- the bi-specific T-cell engager targets melanoma-associated chondroitin sulfate proteoglycan (MCSP). In some embodiments, the bi-specific T-cell engager targets CD33. In some embodiments the bi-specific T-cell engager comprises trastuzumab (targeting HER2/neu), cetuximab, or panitumumab (both targeting the EGF receptor), a functional fragment thereof. In some embodiments, the bi-specific T-cell engager targets CD66e and EphA2. Exemplary GITR agonist
- a combination described herein includes a GITR agonist.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
- the cancer is chosen from a forkhead box P3 (FoxP3)-expressing cancer, a head and neck cancer (e.g., a head and neck squamous cell carcinoma (HNSCC)), or a lung cancer (e.g., a non-small cell lung cancer (NSCLC)).
- the GITR agonist is an anti-GITR antibody molecule.
- anti-GITR antibody molecules are described, e.g., in International Application Publication No. WO 2016/057846 (e.g., Mab7).
- the anti-GITR antibody molecule comprises an HCDR1 sequence of GFSLSSY (SEQ ID NO: 301) (disclosed as SEQ ID NO: 84 of WO
- the anti-GITR antibody molecule comprises an HCDR1 sequence of SYGVD (SEQ ID NO: 307) (disclosed as SEQ ID NO: 22 of WO
- VIWGGGGTYYASSLMG (SEQ ID NO: 308) (disclosed as SEQ ID NO: 25 of WO 2016/057846), an HCDR3 sequence of HAYGHDGGFAMDY (SEQ ID NO: 303) (disclosed as SEQ ID NO: 29 of WO 2016/057846), an LCDR1 of RASESVSSNVA (SEQ ID NO: 309) (disclosed as SEQ ID NO: 30 of WO 2016/057846), an LCDR2 of GASNRAT (SEQ ID NO: 310) (disclosed as SEQ ID NO: 33 of WO 2016/057846), and an LCDR3 of GQSYSYPFT (SEQ ID NO: 311) (disclosed as SEQ ID NO: 34 of WO 2016/057846), all according to Kabat CDR definition.
- the anti-GITR antibody molecule comprises a heavy chain variable region (VH) amino acid sequence of
- the anti-GITR antibody molecule comprises a light chain variable region (VL) amino acid sequence of EIVMTQSPATLSVSPGERATLSCRASESVSSNVAWYQQRPGQAPRLLIYGASNRATGIPARFS GSGSGTDFTLTISRLEPEDFAVYYCGQSYSYPFTFGQGTKLEIK (SEQ ID NO: 313) (disclosed as SEQ ID NO: 7 of WO 2016/057846).
- VL light chain variable region
- the anti-GITR antibody molecule comprises a heavy chain (HC) amino acid sequence of:
- Exemplary GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies), such as, a GITR fusion protein described in U.S. Patent No.:
- the GITR agonist is used in combination with a PD-1 inhibitor, e.g., as described in WO2015/026684.
- the GITR agonist is used in combination with a TLR agonist, e.g., as described in WO2004/060319, and International Publication No.: WO2014/012479.
- a TLR agonist e.g., as described in WO2004/060319, and International Publication No.: WO2014/012479.
- PD-1 is a CD28/CTLA-4 family member expressed, e.g., on activated CD4 + and CD8 + T cells, T regs , and B cells. It negatively regulates effector T cell signaling and function. PD-1 is induced on tumor-infiltrating T cells, and can result in functional exhaustion or dysfunction (Keir et al. (2008) Annu. Rev. Immunol.26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). PD-1 delivers a coinhibitory signal upon binding to either of its two ligands, Programmed Death-Ligand 1 (PD-L1) or Programmed Death-Ligand 2 (PD-L2).
- PD-L1 Programmed Death-Ligand 1
- PD-L2 Programmed Death-Ligand 2
- PD-L1 is expressed on a number of cell types, including T cells, natural killer (NK) cells, macrophages, dendritic cells (DCs), B cells, epithelial cells, vascular endothelial cells, as well as many types of tumors.
- High expression of PD-L1 on murine and human tumors has been linked to poor clinical outcomes in a variety of cancers (Keir et al. (2008) Annu. Rev. Immunol.26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64).
- PD-L2 is expressed on dendritic cells, macrophages, and some tumors. Blockade of the PD-1 pathway has been pre- clinically and clinically validated for cancer immunotherapy.
- blockade of PD-1 pathway can restore exhausted/dysfunctional effector T cell function (e.g., proliferation, IFN- ⁇ secretion, or cytolytic function) and/or inhibit T reg cell function (Keir et al. (2008) Annu. Rev. Immunol.26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64).
- Blockade of the PD-1 pathway can be effected with an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide of PD-1, PD-L1 and/or PD-L2.
- the term“Programmed Death 1” or“PD-1” include isoforms, mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1.
- the amino acid sequence of PD-1, e.g., human PD-1 is known in the art, e.g., Shinohara T et al. (1994) Genomics 23(3):704-6; Finger LR, et al. Gene (1997) 197(1-2):177-87.
- the anti-PD-1 antibody molecules described herein can be used alone or in combination with one or more additional agents described herein in accordance with a method described herein.
- the combinations described herein include a PD-1 inhibitor, e.g., an anti-PD-1 antibody molecule (e.g., humanized antibody molecules) as described herein.
- the anti-PD-1 antibody molecule (e.g., an isolated or recombinant antibody molecule) has one or more of the following properties:
- PD-1 e.g., human PD-1
- high affinity e.g., with an affinity constant of at least about 10 7 M -1 , typically about 10 8 M -1 , and more typically, about 10 9 M -1 to 10 10 M -1 or stronger;
- PD-1 ligand e.g., PD-L1 or PD-L2, or both
- binds specifically to an epitope on PD-1 e.g., the same or similar epitope as the epitope recognized by murine monoclonal antibody BAP049 or a chimeric antibody BAP049, e.g., BAP049- chi or BAP049-chi-Y;
- (v) shows the same or similar binding affinity or specificity, or both, as any of BAP049- hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049- hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
- (vii) shows the same or similar binding affinity or specificity, or both, as an antibody molecule (e.g., a heavy chain variable region and light chain variable region) having an amino acid sequence shown in Table 1; (viii) shows the same or similar binding affinity or specificity, or both, as an antibody molecule (e.g., a heavy chain variable region and light chain variable region) encoded by the nucleotide sequence shown in Table 1;
- (ix) inhibits, e.g., competitively inhibits, the binding of a second antibody molecule to PD-1, wherein the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
- (x) binds the same or an overlapping epitope with a second antibody molecule to PD-1, wherein the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
- (xi) competes for binding, and/or binds the same epitope, with a second antibody molecule to PD-1, wherein the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E;
- (xii) has one or more biological properties of an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E;
- an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049
- (xiii) has one or more pharmacokinetic properties of an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; (xiv) inhibits one or more activities of PD-1, e.g., results
- (xvi) binds to one or more residues within the C strand, CC’ loop, C’ strand, or FG loop of PD-1, or a combination two, three or all of the C strand, CC’ loop, C’ strand or FG loop of PD-1, e.g., wherein the binding is assayed using ELISA or Biacore; or
- (xvii) has a VL region that contributes more to binding to PD-1 than a VH region.
- the antibody molecule binds to PD-1 with high affinity, e.g., with a KD that is about the same, or at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% higher or lower than the K D of a murine or chimeric anti-PD-1 antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
- the K D of the murine or chimeric anti-PD-1 antibody molecule is less than about 0.4, 0.3, 0.2, 0.1, or 0.05 nM, e.g., measured by a Biacore method.
- the K D of the murine or chimeric anti-PD-1 antibody molecule is less than about 0.2 nM, e.g., about 0.135 nM. In other embodiments, the K D of the murine or chimeric anti PD-1 antibody molecule is less than about 10, 5, 3, 2, or 1 nM, e.g., measured by binding on cells expressing PD-1 (e.g., 300.19 cells). In some embodiments, the K D of the murine or chimeric anti PD-1 antibody molecule is less than about 5 nM, e.g., about 4.60 nM (or about 0.69 ⁇ g/mL).
- the anti-PD-1 antibody molecule binds to PD-1 with a K off slower than 1 ⁇ 10 -4 , 5 ⁇ 10 -5 , or 1 ⁇ 10 -5 s -1 , e.g., about 1.65 ⁇ 10 -5 s -1 . In some embodiments, the anti-PD-1 antibody molecule binds to PD-1 with a K on faster than 1 ⁇ 10 4 , 5 ⁇ 10 4 , 1 ⁇ 10 5 , or 5 ⁇ 10 5 M -1 s -1 , e.g., about 1.23 ⁇ 10 5 M -1 s -1 .
- the expression level of the antibody molecule is higher, e.g., at least about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10-fold higher, than the expression level of a murine or chimeric antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
- the antibody molecule is expressed in CHO cells.
- the anti-PD-1 antibody molecule reduces one or more PD-1-associated activities with an IC 50 (concentration at 50% inhibition) that is about the same or lower, e.g., at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% lower, than the IC 50 of a murine or chimeric anti-PD-1 antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
- the IC 50 of the murine or chimeric anti-PD-1 antibody molecule is less than about 6, 5, 4, 3, 2, or 1 nM, e.g., measured by binding on cells expressing PD-1 (e.g., 300.19 cells).
- the IC 50 of the murine or chimeric anti-PD-1 antibody molecule is less than about 4 nM, e.g., about 3.40 nM (or about 0.51 ⁇ g/mL).
- the PD-1-associated activity reduced is the binding of PD-L1 and/or PD-L2 to PD-1.
- the anti-PD-1 antibody molecule binds to peripheral blood mononucleated cells (PBMCs) activated by Staphylococcal enterotoxin B (SEB).
- SEB Staphylococcal enterotoxin B
- the anti-PD-1 antibody molecule increases the expression of IL-2 on whole blood activated by SEB.
- the anti-PD-1 antibody increases the expression of IL-2 by at least about 2, 3, 4, or 5-fold, compared to the expression of IL-2 when an isotype control (e.g., IgG4) is used.
- the anti PD-1 antibody molecule is a humanized antibody molecule and has a risk score based on T cell epitope analysis of 300 to 700, 400 to 650, 450 to 600, or a risk score as described herein.
- the anti-PD-1 antibody molecule comprises at least one antigen- binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encode
- the anti-PD-1 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical
- the anti-PD-1 antibody molecule comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e
- the anti-PD-1 antibody molecule comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4.
- the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1.
- the human IgG1 includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
- the human IgG1 includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
- the human IgG1 includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
- the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the anti-PD-1 antibody molecule includes a kappa light chain constant region, e.g., a human kappa light chain constant region.
- the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
- the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
- the human IgG1 includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
- the human IgG1 includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
- the human IgG1 includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
- the anti-PD-1 antibody molecule includes a heavy chain variable domain and a constant region, a light chain variable domain and a constant region, or both, comprising the amino acid sequence of BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
- the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as shown in Table 4; or a sequence substantially identical thereto.
- the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049- hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti- PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
- Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70,
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1, or closely related CDRs, e.g.
- the anti-PD-1 antibody molecule may include any CDR described herein.
- the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
- Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence.
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049- hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, B
- the anti-PD-1 antibody molecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049- hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP0
- the anti-PD-1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Cl
- the anti-PD-1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) of a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049- hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Cl
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six hypervariable loops (e.g., at least one, two, three, four, five, or six hypervariable loops according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049- Clone-B, BAP049-Cl
- the anti-PD-1 antibody molecule includes all six hypervariable loops (e.g., all six hypervariable loops according to the Chothia definition as set out in Table 1) of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049- Clone-C, BAP049-Clone-D, or BAP049-Clone-E, or closely related hypervariable
- the anti-PD-1 antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049- hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, e.g., the
- the anti-PD-1 antibody molecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al. and Chothia et al.
- the anti-PD-1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, according to the Kabat and Chothia definition (e.g.
- the anti-PD-1 antibody molecule can include VH CDR1 according to Kabat et al. or VH hypervariable loop 1 according to Chothia et al., or a combination thereof, e.g., as shown in Table 1.
- the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 224), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the anti-PD- 1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al. and VL CDRs 1-3 according to Kabat et al., e.g., as shown in Table 1. Accordingly, in some embodiments, framework regions are defined based on a combination of CDRs defined according to Kabat et al. and hypervariable loops defined according to Chothia et al. For example, the anti-PD-1 antibody molecule can include VH FR1 defined based on VH hypervariable loop 1 according to Chothia et al. and VH FR2 defined based on VH CDRs 1-2 according to Kabat et al., e.g., as shown in Table 1.
- the anti-PD-1 antibody molecule can further include, e.g., VH FRs 3-4 defined based on VH CDRs 2-3 according to Kabat et al. and VL FRs 1-4 defined based on VL CDRs 1-3 according to Kabat et al.
- the anti-PD-1 antibody molecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions.
- the anti-PD-1 antibody molecule includes at least one, two or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049- hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-
- the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- the antibody molecule is a bispecific antibody molecule having a first binding specificity for PD-1 and a second binding specificity for TIM-3, LAG-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1 or PD-L2.
- the anti-PD-1 antibody molecule includes:
- VH heavy chain variable region
- VL light chain variable region
- VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32;
- a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33;
- VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
- the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33.
- the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
- the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33.
- the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
- the antibody molecule is a humanized antibody molecule. In another embodiment, the antibody molecule is a monospecific antibody molecule. In yet another embodiment, the antibody molecule is a bispecific antibody molecule.
- the anti-PD-1 antibody molecule includes:
- VH heavy chain variable region
- VL light chain variable region
- the anti-PD-1 antibody molecule includes:
- VH heavy chain variable region
- VL light chain variable region
- the anti-PD-1 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 1. In another embodiment, the anti-PD-1 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 4. In yet another embodiment, the anti-PD-1 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 224.
- the light or the heavy chain variable framework (e.g., the region encompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-PD-1 antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or preferably 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (c) a non-human framework (e.g., a rodent framework); or
- the light or heavy chain variable framework region (particularly FR1, FR2 and/or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
- the anti-PD-1 antibody molecule comprises a heavy chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of BAP049-chi-HC, e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIGs.9A-9B, or SEQ ID NO: 18, 20, 22 or 30.
- the anti-PD-1 antibody molecule comprises a heavy chain variable domain having one or more of: E at position 1, V at position 5, A at position 9, V at position 11, K at position 12, K at position 13, E at position 16, L at position 18, R at position 19, I or V at position 20, G at position 24, I at position 37, A or S at position 40, T at position 41, S at position 42, R at position 43, M or L at position 48, V or F at position 68, T at position 69, I at position 70, S at position 71, A or R at position 72, K or N at position 74, T or K at position 76, S or N at position 77, L at position 79, L at position 81, E or Q at position 82, M at position 83, S or N at position 84, R at position 87, A at position 88, or T at position 91 of amino acid sequence of BAP049- chi-HC, e.g., the amino acid sequence of the FR in the entire variable region, e.g., shown
- the anti-PD-1 antibody molecule comprises a light chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more amino acid changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of BAP049-chi-LC, e.g., the amino acid sequence shown in FIGs.10A-10B, or SEQ ID NO: 24 or 26.
- the anti-PD-1 antibody molecule comprises a heavy chain variable domain having one or more of: E at position 1, V at position 2, Q at position 3, L at position 4, T at position 7, D or L or A at position 9, F or T at position 10, Q at position 11, S or P at position 12, L or A at position 13, S at position 14, P or L or V at position 15, K at position 16, Q or D at position 17, R at position 18, A at position 19, S at position 20, I or L at position 21, T at position 22, L at position 43, K at position 48, A or S at position 49, R or Q at position 51, Y at position 55, I at position 64, S or P at position 66, S at position 69, Y at position 73, G at position 74, E at position 76, F at position 79, N at position 82, N at position 83, L or I at position 84, E at position 85, S or P at position 86, D at position 87, A or F or I at position 89, T or Y at position 91, F at position
- the anti-PD-1 antibody molecule includes one, two, three, or four heavy chain framework regions (e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
- heavy chain framework regions e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
- the anti-PD-1 antibody molecule includes one, two, three, or four light chain framework regions (e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
- light chain framework regions e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
- the anti-PD-1 antibody molecule includes one, two, three, or four heavy chain framework regions (e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto; and one, two, three, or four light chain framework regions (e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
- heavy chain framework regions e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
- light chain framework regions e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
- the anti-PD-1 antibody molecule comprises the heavy chain framework region 1 (VHFW1) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum15, BAP049- hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E (e.g., SEQ ID NO: 147).
- the antibody molecule comprises the heavy chain framework region 1 (VHFW1) of BAP049-hum14 or BAP049-hum15 (e.g., SEQ ID
- the anti-PD-1 antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-hum01, BAP049-hum02, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum09, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049-Clone-E (e.g., SEQ ID NO: 153).
- VHFW2 heavy chain framework region 2
- the antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-hum03, BAP049-hum04, BAP049-hum08, BAP049-hum10, BAP049-hum14, BAP049-hum15, or BAP049-Clone-D (e.g., SEQ ID NO: 157).
- the antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-hum16 (e.g., SEQ ID NO: 160).
- the anti-PD-1 antibody molecule comprises the heavy chain framework region 3 (VHFW3) of BAP049-hum01, BAP049-hum02, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum09, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049-Clone-E (e.g., SEQ ID NO: 162).
- VHFW3 heavy chain framework region 3
- the antibody molecule comprises the heavy chain framework region 3 (VHFW3) of BAP049-hum03, BAP049-hum04, BAP049-hum08, BAP049-hum10, BAP049-hum14, BAP049-hum15, BAP049-hum16, or BAP049-Clone-D (e.g., SEQ ID NO: 166).
- VHFW3 heavy chain framework region 3
- the anti-PD-1 antibody molecule comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169).
- VHFW4 heavy chain framework region 4
- the anti-PD-1 antibody molecule comprises the light chain framework region 1 (VLFW1) of BAP049-hum08, BAP049-hum09, BAP049-hum15, BAP049-hum16, or BAP049-Clone-C (e.g., SEQ ID NO: 174).
- VLFW1 light chain framework region 1
- the antibody molecule comprises the light chain framework region 1 (VLFW1) of BAP049-hum01, BAP049-hum04, BAP049-hum05, BAP049-hum07, BAP049-hum10, BAP049-hum11, BAP049-hum14, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 177).
- the antibody molecule comprises the light chain framework region 1 (VLFW1) of BAP049-hum06 (e.g., SEQ ID NO: 181).
- the antibody molecule comprises the light chain framework region 1 (VLFW1) of BAP049-hum13 (e.g., SEQ ID NO: 183). In some embodiments, the antibody molecule comprises the light chain framework region 1 (VLFW1) of BAP049-hum02, BAP049-hum03, or BAP049-hum12 (e.g., SEQ ID NO: 185).
- the anti-PD-1 antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum06, BAP049- hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 187).
- VLFW2 light chain framework region 2
- the antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049-hum04, BAP049-hum05, BAP049-hum07, BAP049- hum13, or BAP049-Clone-C (e.g., SEQ ID NO: 191).
- the antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049-hum12 (e.g., SEQ ID NO: 194).
- the anti-PD-1 antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 196).
- VLFW3 light chain framework region 3
- the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum02 or BAP049-hum03 (e.g., SEQ ID NO: 200). In some embodiments, the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum01 or BAP049- Clone-A (e.g., SEQ ID NO: 202). In some embodiments, the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum04, BAP049-hum05, or BAP049-Clone-B (e.g., SEQ ID NO: 205).
- the anti-PD-1 antibody molecule comprises the light chain framework region 4 (VLFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049- hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E (e.g., SEQ ID NO: 208).
- VLFW4 light chain framework region 4
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum01, BAP049-hum02, BAP049-hum05, BAP049-hum06, BAP- hum07, BAP049-hum09, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049-Clone-E (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)).
- VHFW1 VHFW1
- VHFW2 VHFW3
- the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum03, BAP049-hum04, BAP049- hum08, BAP049-hum10, or BAP049-Clone-D (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
- the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum14 or BAP049-hum15 (e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
- the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049- hum16 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
- VHFW1 SEQ ID NO: 147
- VHFW2 SEQ ID NO: 160
- VHFW3 SEQ ID NO: 166
- the antibody molecule further comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169).
- VHFW4 heavy chain framework region 4
- the anti-PD-1 antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 202 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum02 or BAP049-hum03 (e.g., SEQ ID NO: 185 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049- hum04, BAP049-hum05, or BAP049-Clone-B (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum06 (e.g., SEQ ID NO: 181 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum07 (e.g., SEQ ID NO: 177
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum08, BAP049- hum09, BAP049-hum15, BAP049-hum16, or BAP049-Clone-C (e.g., SEQ ID NO: 174 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum10, BAP049-hum11, BAP049-hum14, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum12 (e.g., SEQ ID NO: 185 (VLFW1), SEQ ID NO: 194 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum13 (e.g., SEQ ID NO: 183 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- VLFW1 SEQ ID NO: 183
- VLFW2 SEQ ID NO: 191
- VLFW3 SEQ ID NO: 196
- the antibody molecule further comprises the light chain framework region 4 (VLFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 208).
- VLFW4 light chain framework region 4
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 202 (VLFW3)).
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum02 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum02 (e.g., SEQ ID NO: 185 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
- BAP049-hum02 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum02
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum03 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum03 (e.g., SEQ ID NO: 185 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
- BAP049-hum03 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum03
- VLFW1 SEQ ID NO: 185
- VLFW2 SEQ ID NO: 187
- SEQ ID NO: 200 VLFW3
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum04 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum04 (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
- BAP049-hum04 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum04
- VLFW1 SEQ ID NO: 177
- SEQ ID NO: 191 VLFW2
- SEQ ID NO: 205 VLFW3
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum05 or BAP049-Clone-B (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum05 or BAP049-Clone-B (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum06 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum06 (e.g., SEQ ID NO: 181 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum06 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum06
- VLFW1 SEQ ID NO: 181
- VLFW2 SEQ ID NO: 187
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum07 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum07 (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum07 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum07
- VLFW1 SEQ ID NO: 177
- SEQ ID NO: 191 VLFW2
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum08 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum08 (e.g., SEQ ID NO: 174 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum08 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum08
- VLFW1 SEQ ID NO: 174
- VLFW2 SEQ ID NO: 187
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum09 or BAP049-Clone-C (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum09 or BAP049-Clone-C (e.g., SEQ ID NO: 174 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum10 or BAP049-Clone-D (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum10 or BAP049-Clone-D (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- VHFW1 VHFW1
- VHFW2 SEQ ID NO: 157
- VHFW3 SEQ ID NO: 166
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum11 or BAP049-Clone-E (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum11 or BAP049-Clone-E (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum12 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum12 (e.g., SEQ ID NO: 185 (VLFW1), SEQ ID NO: 194 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum12 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum12
- VLFW1 SEQ ID NO: 185
- VLFW2 SEQ ID NO: 194
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum13 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum13 (e.g., SEQ ID NO: 183 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum13 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum13
- VLFW1 SEQ ID NO: 183
- VLFW2 SEQ ID NO: 191
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum14 (e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum14 (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum14 e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum14
- VLFW1 SEQ ID NO: 177
- SEQ ID NO: 187 VLFW2
- SEQ ID NO: 196 VLFW3
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum15 (e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum15 (e.g., SEQ ID NO: 174 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum15 e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum15
- VLFW1 SEQ ID NO: 174
- VLFW2 SEQ ID NO: 187
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum16 (e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049- hum16 (e.g., SEQ ID NO: 174 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
- BAP049-hum16 e.g., SEQ ID NO: 147 (VHFW1), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)
- VHFW3 the heavy chain framework regions 1-3 of BAP049-hum16
- VLFW1 SEQ ID NO: 174
- VLFW2 SEQ ID NO: 187
- VLFW3 SEQ ID NO: 196
- the anti-PD-1 antibody molecule further comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049- hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049- hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169) and the light chain framework region 4 (VLFW4) of BAP049-hum01, BAP049-hum02, BAP049-
- the anti-PD-1 antibody molecule comprises a heavy chain framework region having a combination of framework regions FW1, FW2 and FW3 as shown in FIGs.5 or 7. In other embodiment, the antibody molecule comprises a light chain framework region having a combination of framework regions FW1, FW2 and FW3 as shown in FIGs.5 or 7. In yet other embodiments, the antibody molecule comprises a heavy chain framework region having a combination of framework regions FW1, FW2 and FW3 as shown in FIGs.5 or 7, and a light chain framework region having a combination of framework regions FW1, FW2 and FW3 as shown in FIGs.5 or 7.
- the heavy or light chain variable domain, or both, of the anti-PD-1 antibody molecule includes an amino acid sequence, which is substantially identical to an amino acid disclosed herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049- hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049- hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, B
- the heavy or light chain variable region, or both, of the anti-PD-1 antibody molecule includes an amino acid sequence encoded by a nucleic acid sequence described herein or a nucleic acid that hybridizes to a nucleic acid sequence described herein (e.g., a nucleic acid sequence as shown in Tables 1 and 2) or its complement, e.g., under low stringency, medium stringency, or high stringency, or other hybridization condition described herein.
- the anti-PD-1 antibody molecule comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 1.
- antigen-binding regions e.g., variable regions, having an amino acid sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 1.
- the anti-PD-1 antibody molecule includes a VH and/or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 1.
- the anti-PD-1 antibody molecule comprises at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence as set forth in Table 1, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
- the anti-PD-1 antibody molecule comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table 1, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
- the anti-PD-1 antibody molecule comprises at least one, two, three, four, five or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table 1), or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
- the anti-PD-1 antibody molecule comprises at least one, two, or three CDRs and/or hypervariable loops from a heavy chain variable region having an amino acid sequence of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049- hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, as summarized in Table 1,
- the anti-PD-1 antibody molecule comprises at least one, two, or three CDRs and/or hypervariable loops from a light chain variable region having an amino acid sequence of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, as summarized in Table 1, or
- the anti-PD-1 antibody molecule has a variable region that is identical in sequence, or which differs by 1, 2, 3, or 4 amino acids from a variable region described herein (e.g., an FR region disclosed herein).
- the anti-PD-1 antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
- the anti-PD-1 antibody molecule is a monoclonal antibody or an antibody with single specificity.
- the anti-PD-1 antibody molecule can also be a humanized, chimeric, camelid, shark, or an in vitro-generated antibody molecule.
- the anti-PD-1 antibody molecule thereof is a humanized antibody molecule.
- the heavy and light chains of the anti-PD-1 antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody).
- an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
- an antigen-binding fragment e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody
- the anti-PD-1 antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgG1 or IgG2 (e.g., human IgG1, IgG2 or IgG4).
- the heavy chain constant region is human IgG1.
- the anti-PD-1 antibody molecule has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa).
- the constant region is altered, e.g., mutated, to modify the properties of the anti-PD-1 antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218).
- the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to
- the heavy chain constant region of an IgG4, e.g., a human IgG4, is mutated at position 228 according to EU numbering (e.g., S to P), e.g., as shown in Table 3.
- the anti-PD-1 antibody molecules comprises a human IgG4 mutated at position 228 according to EU numbering (e.g., S to P), e.g., as shown in Table 3; and a kappa light chain constant region, e.g., as shown in Table 3.
- the heavy chain constant region of an IgG1 is mutated at one or more of position 297 according to EU numbering (e.g., N to A), position 265 according to EU numbering (e.g., D to A), position 329 according to EU numbering (e.g., P to A), position 234 according to EU numbering (e.g., L to A), or position 235 according to EU numbering (e.g., L to A), e.g., as shown in Table 3.
- the anti-PD-1 antibody molecules comprises a human IgG1 mutated at one or more of the aforesaid positions, e.g., as shown in Table 3; and a kappa light chain constant region, e.g., as shown in Table 3.
- the anti-PD-1 antibody molecule is isolated or recombinant.
- the anti-PD-1 antibody molecule is a humanized antibody molecule. In one embodiment, the anti-PD-1 antibody molecule has a risk score based on T cell epitope analysis of less than 700, 600, 500, 400 or less.
- the anti-PD-1 antibody molecule is a humanized antibody molecule and has a risk score based on T cell epitope analysis of 300 to 700, 400 to 650, 450 to 600, or a risk score as described herein.
- the anti-PD-1 antibody molecule includes:
- VH heavy chain variable region
- VL light chain variable region
- VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32;
- a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33;
- VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
- the anti-PD-1 antibody molecule comprises:
- VH heavy chain variable region
- VL light chain variable region
- the anti-PD-1 antibody molecule comprises:
- VH heavy chain variable region
- VL light chain variable region
- the VHCDR1 comprises the amino acid sequence of SEQ ID NO: 1. In other embodiments, the VHCDR1 comprises the amino acid sequence of SEQ ID NO: 4. In yet other embodiments, the VHCDR1 amino acid sequence of SEQ ID NO: 224.
- the aforesaid antibody molecules have a heavy chain variable region comprising at least one framework (FW) region comprising the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169, or an amino acid sequence at least 90% identical thereto, or having no more than two amino acid substitutions, insertions or deletions compared to the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
- FW framework
- the aforesaid antibody molecules have a heavy chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
- the aforesaid antibody molecules have a heavy chain variable region comprising at least two, three, or four framework regions comprising the amino acid sequences of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
- the aforesaid antibody molecules comprise a VHFW1 amino acid sequence of SEQ ID NO: 147 or 151, a VHFW2 amino acid sequence of SEQ ID NO: 153, 157, or 160, and a VHFW3 amino acid sequence of SEQ ID NO: 162 or 166, and, optionally, further comprising a VHFW4 amino acid sequence of SEQ ID NO: 169.
- the aforesaid antibody molecules have a light chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208, or an amino acid sequence at least 90% identical thereto, or having no more than two amino acid substitutions, insertions or deletions compared to the amino acid sequence of any of 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
- the aforesaid antibody molecules have a light chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
- the aforesaid antibody molecules have a light chain variable region comprising at least two, three, or four framework regions comprising the amino acid sequences of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
- the aforesaid antibody molecules comprise a VLFW1 amino acid sequence of SEQ ID NO: 174, 177, 181, 183, or 185, a VLFW2 amino acid sequence of SEQ ID NO: 187, 191, or 194, and a VLFW3 amino acid sequence of SEQ ID NO: 196, 200, 202, or 205, and, optionally, further comprising a VLFW4 amino acid sequence of SEQ ID NO: 208.
- the aforesaid antibodies comprise a heavy chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 38, 50, 82, or 86.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38, 50, 82, or 86.
- the aforesaid antibody molecules comprise a light chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 42, 46, 54, 58, 62, 66, 70, 74, or 78.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42, 46, 54, 58, 62, 66, 70, 74, or 78.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38. In other embodiments, the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 or SEQ ID NO: 102.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 86.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 88.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 44.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 48.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 56.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 60.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 62.
- the aforesaid antibodies comprise a light chain comprising the amino acid sequence of SEQ ID NO: 64. In other embodiments, the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 68.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 72.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 74.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 76.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 78.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 80.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54. In other embodiments, the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 62.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 74.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 78.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 86 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 44.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 68. In other embodiments, the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 44.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 48.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 48.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
- the aforesaid antibodies comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 60.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 64.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 72. In other embodiments, the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 76.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 80.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
- the aforesaid antibodies comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 88 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
- the aforesaid antibody molecules are chosen from a Fab, F(ab')2, Fv, or a single chain Fv fragment (scFv).
- the aforesaid antibody molecules comprise a heavy chain constant region selected from IgG1, IgG2, IgG3, and IgG4.
- the aforesaid antibody molecules comprise a light chain constant region chosen from the light chain constant regions of kappa or lambda.
- the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a mutation at position 228 according to EU numbering or position 108 of SEQ ID NO: 212 or 214 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a Serine to Proline mutation at position 228 according to EU numbering or position 108 of SEQ ID NO: 212 or 214 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgG1 heavy chain constant region with an Asparagine to Alanine mutation at position 297 according to EU numbering or position 180 of SEQ ID NO: 216 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgG1 heavy chain constant region with an Aspartate to Alanine mutation at position 265 according to EU numbering or position 148 of SEQ ID NO: 217, and Proline to Alanine mutation at position 329 according to EU numbering or position 212 of SEQ ID NO: 217 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgG1 heavy chain constant region with a Leucine to Alanine mutation at position 234 according to EU numbering or position 117 of SEQ ID NO: 218, and Leucine to Alanine mutation at position 235 according to EU numbering or position 118 of SEQ ID NO: 218 and a kappa light chain constant region.
- the aforesaid antibody molecules are capable of binding to human PD- 1 with a dissociation constant (K D ) of less than about 0.2 nM.
- the aforesaid antibody molecules bind to human PD-1 with a K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.13 nM to 0.03 nM, e.g., about 0.077 nM to 0.088 nM, e.g., about 0.083 nM, e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to cynomolgus PD-1 with a K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.11 nM to 0.08 nM, e.g., about 0.093 nM, e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to both human PD-1 and cynomolgus PD-1 with similar K D , e.g., in the nM range, e.g., as measured by a Biacore method. In some embodiments, the aforesaid antibody molecules bind to a human PD-1-Ig fusion protein with a K D of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.04 nM, e.g., as measured by ELISA.
- the aforesaid antibody molecules bind to Jurkat cells that express human PD-1 (e.g., human PD-1-transfected Jurkat cells) with a K D of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.06 nM, e.g., as measured by FACS analysis.
- human PD-1 e.g., human PD-1-transfected Jurkat cells
- the aforesaid antibody molecules bind to cynomolgus T cells with a K D of less than about 1nM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.1 nM, e.g., about 0.4 nM, e.g., as measured by FACS analysis.
- the aforesaid antibody molecules bind to cells that express cynomolgus PD-1 (e.g., cells transfected with cynomolgus PD-1) with a K D of less than about 1nM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
- cynomolgus PD-1 e.g., cells transfected with cynomolgus PD-1
- K D a K D of less than about 1nM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
- the aforesaid antibody molecules are not cross-reactive with mouse or rat PD-1.
- the aforesaid antibodies are cross-reactive with rhesus PD-1.
- the cross-reactivity can be measured by a Biacore method or a binding assay using cells that expresses PD-1 (e.g., human PD-1-expressing 300.19 cells).
- the aforesaid antibody molecules bind an extracellular Ig-like domain of PD-1.
- the aforesaid antibody molecules are capable of reducing binding of PD-1 to PD-L1, PD-L2, or both, or a cell that expresses PD-L1, PD-L2, or both.
- the aforesaid antibody molecules reduce (e.g., block) PD-L1 binding to a cell that expresses PD-1 (e.g., human PD-1-expressing 300.19 cells) with an IC50 of less than about 1.5 nM, 1 nM, 0.8 nM, 0.6 nM, 0.4 nM, 0.2 nM, or 0.1 nM, e.g., between about 0.79 nM and about 1.09 nM, e.g., about 0.94 nM, or about 0.78 nM or less, e.g., about 0.3 nM.
- the aforesaid antibodies reduce (e.g., block) PD-L2 binding to a cell that expresses PD-1 (e.g., human PD- 1-expressing 300.19 cells) with an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
- PD-1 e.g., human PD- 1-expressing 300.19 cells
- an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
- the aforesaid antibody molecules are capable of enhancing an antigen-specific T cell response.
- the antibody molecule is a monospecific antibody molecule or a bispecific antibody molecule.
- the antibody molecule has a first binding specificity for PD-1 and a second binding specificity for TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), PD-L1 or PD-L2.
- the antibody molecule comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- the aforesaid antibody molecules increase the expression of IL-2 from cells activated by Staphylococcal enterotoxin B (SEB) (e.g., at 25 ⁇ g/mL) by at least about 2, 3, 4, 5- fold, e.g., about 2 to 3-fold, e.g., about 2 to 2.6-fold, e.g., about 2.3-fold, compared to the expression of IL-2 when an isotype control (e.g., IgG4) is used, e.g., as measured in a SEB T cell activation assay or a human whole blood ex vivo assay.
- SEB Staphylococcal enterotoxin B
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells stimulated by anti-CD3 (e.g., at 0.1 ⁇ g/mL) by at least about 2, 3, 4, 5-fold, e.g., about 1.2 to 3.4-fold, e.g., about 2.3-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated by SEB (e.g., at 3 pg/mL) by at least about 2, 3, 4, 5-fold, e.g., about 0.5 to 4.5- fold, e.g., about 2.5-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated with an CMV peptide by at least about 2, 3, 4, 5-fold, e.g., about 2 to 3.6-fold, e.g., about 2.8-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- an isotype control e.g., IgG4
- the aforesaid antibody molecules has a Cmax between about 100 ⁇ g/mL and about 500 ⁇ g/mL, between about 150 ⁇ g/mL and about 450 ⁇ g/mL, between about 250 ⁇ g/mL and about 350 ⁇ g/mL, or between about 200 ⁇ g/mL and about 400 ⁇ g/mL, e.g., about 292.5 ⁇ g/mL, e.g., as measured in monkey.
- the aforesaid antibody molecules has a T 1/2 between about 250 hours and about 650 hours, between about 300 hours and about 600 hours, between about 350 hours and about 550 hours, or between about 400 hours and about 500 hours, e.g., about 465.5 hours, e.g., as measured in monkey.
- the aforesaid antibody molecules bind to PD-1 with a Kd slower than 5 ⁇ 10 -4 , 1 ⁇ 10 -4 , 5 ⁇ 10 -5 , or 1 ⁇ 10 -5 s -1 , e.g., about 2.13 ⁇ 10 -4 s -1 , e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to PD-1 with a Ka faster than 1 ⁇ 10 4 , 5 ⁇ 10 4 , 1 ⁇ 10 5 , or 5 ⁇ 10 5 M -1 s -1 , e.g., about 2.78 ⁇ 10 5 M -1 s -1 , e.g., as measured by a Biacore method.
- the aforesaid anti-PD-1 antibody molecules bind to one or more residues within the C strand, CC’ loop, C’ strand and FG loop of PD-1.
- the domain structure of PD-1 is described, e.g., in Cheng et al.,“Structure and Interactions of the Human Programmed Cell Death 1 Receptor” J. Biol. Chem.2013, 288:11771-11785. As described in Cheng et.
- an anti-PD-1 antibody as described herein binds to at least one residue in one or more of the ranges F43-M50, S51-N54, Q55-F62, and L108-I114 of PD- 1.
- an anti-PD-1 antibody as described herein binds to at least one residue in two, three, or all four of the ranges F43-M50, S51-N54, Q55-F62, and L108-I114 of PD-1. In some embodiments, the anti-PD-1 antibody binds to a residue in PD-1 that is also part of a binding site for one or both of PD-L1 and PD-L2.
- the invention provides an isolated nucleic acid molecule encoding any of the aforesaid antibody molecules, vectors and host cells thereof.
- An isolated nucleic acid encoding the antibody heavy chain variable region or light chain variable region, or both, of any the aforesaid antibody molecules is also provided.
- the isolated nucleic acid encodes heavy chain CDRs 1-3, wherein said nucleic acid comprises a nucleotide sequence of SEQ ID NO: 108-112, 223, 122-126, 133-137, or 144-146.
- the isolated nucleic acid encodes light chain CDRs 1-3, wherein said nucleic acid comprises a nucleotide sequence of SEQ ID NO: 113-120, 127-132, or 138-143.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable domain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 39, 51, 83, 87, 90, 95, or 101.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable domain, wherein said nucleotide sequence comprises any of SEQ ID NO: 39, 51, 83, 87, 90, 95, or 101.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 41, 53, 85, 89, 92, 96, or 103.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain, wherein said nucleotide sequence comprises any of SEQ ID NO: 41, 53, 85, 89, 92, 96, or 103.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain variable domain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 43, 47, 55, 59, 63, 67, 71, 75, 79, 93, 97, 99, 104, or 106.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain variable domain, wherein said nucleotide sequence comprises any of SEQ ID NO: 43, 47, 55, 59, 63, 67, 71, 75, 79, 93, 97, 99, 104, or 106.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 45, 49, 57, 61, 65, 69, 73, 77, 81, 94, 98, 100, 105 or 107.
- the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain, wherein said nucleotide sequence comprises any of SEQ ID NO: 45, 49, 57, 61, 65, 69, 73, 77, 81, 94, 98, 100, 105 or 107.
- one or more expression vectors and host cells comprising the aforesaid nucleic acids are provided.
- a method of producing an antibody molecule or fragment thereof, comprising culturing the host cell as described herein under conditions suitable for gene expression is also provided.
- the invention features a method of providing an antibody molecule described herein.
- the method includes: providing a PD-1 antigen (e.g., an antigen comprising at least a portion of a PD-1 epitope); obtaining an antibody molecule that specifically binds to the PD-1 polypeptide; and evaluating if the antibody molecule specifically binds to the PD-1 polypeptide, or evaluating efficacy of the antibody molecule in modulating, e.g., inhibiting, the activity of the PD-1.
- the method can further include administering the antibody molecule to a subject, e.g., a human or non- human animal.
- the invention provides, compositions, e.g., pharmaceutical compositions, which include a pharmaceutically acceptable carrier, excipient or stabilizer, and at least one of the therapeutic agents, e.g., anti-PD-1 antibody molecules described herein.
- the composition e.g., the pharmaceutical composition, includes a combination of the antibody molecule and one or more agents, e.g., a therapeutic agent or other antibody molecule, as described herein.
- the antibody molecule is conjugated to a label or a therapeutic agent. Additional Inhibitors of PD-1 and Other Immune Checkpoint Molecules
- the PD-1 inhibitor is an inhibitor, e.g., an anti-PD-1 antibody molecule, other than the anti-PD-1 antibody molecule of Table 1.
- the PD-1 inhibitor comprises an anti-PD-1 antibody molecule of Table 1 and an anti-PD-1 antibody molecule other than the antibody molecule of Table 1.
- the PD-1 inhibitor is an anti-PD- 1 antibody chosen from Nivolumab, Pembrolizumab or Pidilizumab.
- the anti-PD-1 antibody is Nivolumab. Alternative names for
- Nivolumab include MDX- 1106, MDX-1106-04, ONO-4538, or BMS-936558.
- the anti-PD- 1 antibody is Nivolumab (CAS Registry Number: 946414-94-4).
- Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PD-1.
- Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD-1 are disclosed in US 8,008,449 and WO2006/121168.
- the inhibitor of PD-1 is Nivolumab, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy and light chain amino acid sequences of Nivolumab are as follows:
- the anti-PD-1 antibody is Pembrolizumab.
- Pembrolizumab (also referred to as Lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA®; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1.
- Pembrolizumab and other humanized anti- PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134–44, US 8,354,509 and WO2009/114335.
- the heavy and light chain amino acid sequences of Pembrolizumab are as follows: Heavy chain (SEQ ID NO: 244)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2018007423A MX2018007423A (es) | 2015-12-17 | 2016-12-16 | Moleculas de anticuerpo que se unen a pd-1 y usos de las mismas. |
| AU2016369537A AU2016369537B2 (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to PD-1 and uses thereof |
| KR1020187019916A KR102833068B1 (ko) | 2015-12-17 | 2016-12-16 | Pd-1에 대한 항체 분자 및 그의 용도 |
| EP16831788.1A EP3389712B1 (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to pd-1 and uses thereof |
| CN201680079836.2A CN108495651A (zh) | 2015-12-17 | 2016-12-16 | 抗pd-1的抗体分子及其用途 |
| CA3007671A CA3007671C (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to pd-1 and uses thereof |
| EP24169342.3A EP4424322A3 (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to pd-1 and uses thereof |
| BR112018012138-0A BR112018012138A2 (pt) | 2015-12-17 | 2016-12-16 | moléculas de anticorpo para pd-1 e usos das mesmas |
| US16/062,427 US20180371093A1 (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to pd-1 and uses thereof |
| RU2018125773A RU2788092C2 (ru) | 2015-12-17 | 2016-12-16 | Молекулы антител к pd-1 и их применения |
| ES16831788T ES2986067T3 (es) | 2015-12-17 | 2016-12-16 | Moléculas de anticuerpos frente a PD-1 y usos de las mismas |
| JP2018531392A JP2019503349A (ja) | 2015-12-17 | 2016-12-16 | Pd−1に対する抗体分子およびその使用 |
| PH12018501206A PH12018501206A1 (en) | 2015-12-17 | 2018-06-07 | Antibody molecules to pd-1 and uses thereof |
| IL259987A IL259987A (en) | 2015-12-17 | 2018-06-12 | Antibody molecules to pd-1 and uses thereof |
Applications Claiming Priority (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562269044P | 2015-12-17 | 2015-12-17 | |
| US62/269,044 | 2015-12-17 | ||
| US201662331371P | 2016-05-03 | 2016-05-03 | |
| US62/331,371 | 2016-05-03 | ||
| US201662344784P | 2016-06-02 | 2016-06-02 | |
| US62/344,784 | 2016-06-02 | ||
| US201662347331P | 2016-06-08 | 2016-06-08 | |
| US62/347,331 | 2016-06-08 | ||
| US201662359781P | 2016-07-08 | 2016-07-08 | |
| US62/359,781 | 2016-07-08 | ||
| US201662381384P | 2016-08-30 | 2016-08-30 | |
| US62/381,384 | 2016-08-30 | ||
| US201662400787P | 2016-09-28 | 2016-09-28 | |
| US62/400,787 | 2016-09-28 | ||
| US201662414128P | 2016-10-28 | 2016-10-28 | |
| US62/414,128 | 2016-10-28 | ||
| US201662431846P | 2016-12-09 | 2016-12-09 | |
| US62/431,846 | 2016-12-09 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017106656A1 true WO2017106656A1 (en) | 2017-06-22 |
| WO2017106656A8 WO2017106656A8 (en) | 2018-06-28 |
Family
ID=57915060
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/067200 Ceased WO2017106656A1 (en) | 2015-12-17 | 2016-12-16 | Antibody molecules to pd-1 and uses thereof |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20180371093A1 (https=) |
| EP (2) | EP3389712B1 (https=) |
| JP (4) | JP2019503349A (https=) |
| KR (1) | KR102833068B1 (https=) |
| CN (1) | CN108495651A (https=) |
| AU (1) | AU2016369537B2 (https=) |
| BR (1) | BR112018012138A2 (https=) |
| CL (1) | CL2018001560A1 (https=) |
| ES (1) | ES2986067T3 (https=) |
| IL (1) | IL259987A (https=) |
| MX (1) | MX2018007423A (https=) |
| PH (1) | PH12018501206A1 (https=) |
| WO (1) | WO2017106656A1 (https=) |
Cited By (61)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9884913B2 (en) | 2014-01-31 | 2018-02-06 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US9908936B2 (en) | 2014-03-14 | 2018-03-06 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US9988452B2 (en) | 2014-10-14 | 2018-06-05 | Novartis Ag | Antibody molecules to PD-L1 and uses thereof |
| US20180177872A1 (en) * | 2015-07-29 | 2018-06-28 | Yong Jia | Combination of PD-1 antagonist with an EGFR inhibitor |
| WO2019018640A1 (en) * | 2017-07-21 | 2019-01-24 | Novartis Ag | POSOLOGICAL REGIMES FOR ANTI-GITREN ANTIBODIES AND USES THEREOF |
| WO2019018730A1 (en) * | 2017-07-20 | 2019-01-24 | Novartis Ag | DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF |
| WO2019027857A1 (en) * | 2017-08-04 | 2019-02-07 | Merck Sharp & Dohme Corp. | COMBINATIONS OF PD-1 ANTAGONISTS AND STING BENZO [B] THIOPHENIC AGONISTS FOR THE TREATMENT OF CANCER |
| US10287353B2 (en) | 2016-05-11 | 2019-05-14 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| WO2019105468A1 (en) * | 2017-12-01 | 2019-06-06 | Adagene Inc. | Methods for using cd137 ligand as a biomarker for treatment with anti-cd137 antibody |
| WO2019139581A1 (en) * | 2018-01-10 | 2019-07-18 | Lee Patrice A | Methods and combination therapy to treat cancer |
| US10385131B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| WO2019195658A1 (en) * | 2018-04-05 | 2019-10-10 | Dana-Farber Cancer Institute, Inc. | Sting levels as a biomarker for cancer immunotherapy |
| US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
| WO2019217457A1 (en) | 2018-05-07 | 2019-11-14 | Genmab A/S | Methods of treating cancer with a combination of an anti-pd-1 antibody and an anti-tissue factor antibody-drug conjugate |
| WO2019219658A1 (en) * | 2018-05-15 | 2019-11-21 | Medimmune Limited | Treatment of cancer |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| EP3419643A4 (en) * | 2016-02-24 | 2020-04-01 | Children's Hospital of Eastern Ontario Research Institute Inc. | SMC-BASED ANTI-CANCER THERAPY |
| WO2020081497A1 (en) * | 2018-10-15 | 2020-04-23 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| WO2020102387A1 (en) * | 2018-11-13 | 2020-05-22 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
| US10675358B2 (en) | 2016-07-07 | 2020-06-09 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| WO2020128636A1 (en) * | 2018-12-21 | 2020-06-25 | Novartis Ag | Use of il-1 beta antibodies in the treatment or prevention of myelodysplastic syndrome |
| US20200261573A1 (en) * | 2015-12-17 | 2020-08-20 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| US10752687B2 (en) | 2014-01-24 | 2020-08-25 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US10813958B2 (en) * | 2015-07-20 | 2020-10-27 | Virttu Biologics Limited | Use of oncolytic herpes simplex virus, alone or in combination with immune check-point inhibitor, in the treatment of cancer |
| CN111868088A (zh) * | 2018-03-20 | 2020-10-30 | 诺华股份有限公司 | 药物组合 |
| CN112118853A (zh) * | 2018-04-02 | 2020-12-22 | 杜克大学 | 新辅助癌症疗法 |
| EP3752180A2 (en) | 2018-02-13 | 2020-12-23 | Merck Sharp&Dohme Corp. | Methods for treating cancer with anti-pd-1 antibodies |
| WO2021006199A1 (ja) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Pd-1/cd3二重特異性タンパク質による血液がん治療 |
| WO2021025140A1 (ja) | 2019-08-08 | 2021-02-11 | 小野薬品工業株式会社 | 二重特異性タンパク質 |
| US20210093645A1 (en) * | 2017-12-21 | 2021-04-01 | Debiopharm International S.A. | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| WO2021262969A1 (en) * | 2020-06-24 | 2021-12-30 | The General Hospital Corporation | Materials and methods of treating cancer |
| US11242395B2 (en) | 2017-08-21 | 2022-02-08 | Adagene Inc. | Anti-CD137 molecules and use thereof |
| EP3752193A4 (en) * | 2018-02-13 | 2022-02-23 | Merck Sharp & Dohme Corp. | METHODS OF TREATMENT OF CANCER WITH ANTI-PD-1 ANTIBODIES AND ANTI-CTLA4 ANTIBODIES |
| US11285131B2 (en) | 2017-08-04 | 2022-03-29 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene STING agonists for cancer treatment |
| US11306144B2 (en) | 2017-08-25 | 2022-04-19 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods of use thereof |
| WO2022108931A2 (en) | 2020-11-17 | 2022-05-27 | Seagen Inc. | Methods of treating cancer with a combination of tucatinib and an anti-pd-1/anti-pd-l1 antibody |
| WO2022105817A1 (en) * | 2020-11-18 | 2022-05-27 | Suzhou Transcenta Therapeutics Co., Ltd. | Bi-functional molecules |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| US11400164B2 (en) | 2019-03-15 | 2022-08-02 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting HER2 |
| US11459394B2 (en) | 2017-02-24 | 2022-10-04 | Macrogenics, Inc. | Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof |
| WO2023285552A1 (en) | 2021-07-13 | 2023-01-19 | BioNTech SE | Multispecific binding agents against cd40 and cd137 in combination therapy for cancer |
| WO2023057534A1 (en) | 2021-10-06 | 2023-04-13 | Genmab A/S | Multispecific binding agents against pd-l1 and cd137 in combination |
| WO2023083868A1 (en) | 2021-11-09 | 2023-05-19 | BioNTech SE | Tlr7 agonist and combinations for cancer treatment |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| US11939383B2 (en) | 2018-03-02 | 2024-03-26 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods and use thereof |
| US11952681B2 (en) | 2018-02-02 | 2024-04-09 | Adagene Inc. | Masked activatable CD137 antibodies |
| WO2024115725A1 (en) | 2022-12-01 | 2024-06-06 | BioNTech SE | Multispecific antibody against cd40 and cd137 in combination therapy with anti-pd1 ab and chemotherapy |
| RU2825835C2 (ru) * | 2018-10-03 | 2024-09-02 | МЕРК ШАРП И ДОУМ ЭлЭлСи | Способы лечения рака с помощью анти-PD-1-антител и анти-CTLA4-антител |
| WO2024209072A1 (en) | 2023-04-06 | 2024-10-10 | Genmab A/S | Multispecific binding agents against pd-l1 and cd137 for treating cancer |
| US12246025B2 (en) | 2018-03-21 | 2025-03-11 | Genmab A/S | Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate |
| WO2025114541A1 (en) | 2023-11-30 | 2025-06-05 | Genmab A/S | Antibodies capable of binding to ox40 in combination therapy |
| US12324841B2 (en) | 2018-05-07 | 2025-06-10 | Genmab A/S | Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate |
| US12398209B2 (en) | 2018-01-22 | 2025-08-26 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-PD-1 antibodies |
| US12410258B2 (en) | 2023-05-12 | 2025-09-09 | Ganmab A/S | Antibodies capable of binding to OX40, variants thereof and uses thereof |
| US12435145B2 (en) | 2018-02-21 | 2025-10-07 | Five Prime Therapeutics, Inc. | B7-H4 antibody formulations |
| US12448448B2 (en) | 2018-06-20 | 2025-10-21 | Incyte Corporation | Anti-PD-1 antibodies and uses thereof |
| US12453781B2 (en) | 2018-10-30 | 2025-10-28 | Genmab A/S | Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate |
| US12570751B2 (en) | 2017-08-04 | 2026-03-10 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| US12600777B2 (en) | 2015-07-29 | 2026-04-14 | Novartis Ag | Combination therapies comprising antibody molecules to LAG-3 |
Families Citing this family (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11566077B2 (en) * | 2017-01-17 | 2023-01-31 | The University Of Chicago | Dysfunctional antigen-specific CD8+ T cells in the tumor microenvironment |
| WO2018209270A1 (en) | 2017-05-11 | 2018-11-15 | Northwestern University | Adoptive cell therapy using spherical nucleic acids (snas) |
| EP3746095A4 (en) | 2018-02-01 | 2021-04-21 | Nkmax Co., Ltd. | Method of producing natural killer cells and composition for treating cancer |
| US11331269B2 (en) * | 2018-09-06 | 2022-05-17 | Massachusetts Institute Of Technology | Methods and compositions targeting lung microbiota and its responding immune pathways for lung cancer treatment |
| EP3853251A1 (en) * | 2018-09-19 | 2021-07-28 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods and pharmaceutical composition for the treatment of cancers resistant to immune checkpoint therapy |
| HUE067601T2 (hu) | 2018-11-14 | 2024-10-28 | Regeneron Pharma | PD-1 inhibitorok intraléziós beadása a bõrrák kezelésére |
| KR102840400B1 (ko) | 2018-12-12 | 2025-08-04 | 카이트 파마 인코포레이티드 | 키메라 항원 수용체 및 car-t 세포 및 사용 방법 |
| CN111346225A (zh) * | 2018-12-21 | 2020-06-30 | 上海张江生物技术有限公司 | 含有蛋白质的药物制剂 |
| MA55084A (fr) | 2019-02-28 | 2022-01-05 | Regeneron Pharma | Administration d'inhibiteurs de pd-1 pour le traitement du cancer de la peau |
| JP2022527972A (ja) * | 2019-04-02 | 2022-06-07 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | 前悪性病変を有する患者において癌を予測及び予防する方法 |
| WO2020222109A1 (en) | 2019-05-02 | 2020-11-05 | Janssen Biotech, Inc. | Csf-1/csf-1r gene set |
| US20200384027A1 (en) | 2019-05-03 | 2020-12-10 | Kite Pharma, Inc. | Methods of administering chimeric antigen receptor immunotherapy |
| CN110179977A (zh) * | 2019-05-22 | 2019-08-30 | 华中科技大学同济医学院附属同济医院 | 用于治疗黑色素瘤、肺癌或结直肠癌的组合药物制剂 |
| BR112021024438A2 (pt) * | 2019-06-03 | 2022-02-15 | Univ Chicago | Métodos e composições para tratar câncer com carreadores de fármaco de ligação de colágeno |
| US20220378821A1 (en) * | 2019-07-02 | 2022-12-01 | Effector Therapeutics, Inc. | Methods of treating braf-mutated cancer cells |
| KR20220092578A (ko) * | 2019-11-05 | 2022-07-01 | 브리스톨-마이어스 스큅 컴퍼니 | M-단백질 검정 및 이의 용도 |
| IL292665B2 (en) | 2019-11-06 | 2026-02-01 | Kite Pharma Inc | Chimeric antigen receptor T cell therapy |
| MX2022007759A (es) * | 2019-12-20 | 2022-07-19 | Novartis Ag | Combinacion del anticuerpo anti tim-3 mbg453 y anticuerpo anti tgf-beta nis793, con o sin decitabina o el anticuerpo anti pd-1 spartalizumab, para el tratamiento de mielofibrosis y sindrome mielodisplasico. |
| JP2023510393A (ja) * | 2020-01-17 | 2023-03-13 | ノバルティス アーゲー | 骨髄異形成症候群または慢性骨髄単球性白血病の処置に使用するためのtim-3阻害剤と低メチル化剤とを含む組合せ |
| US12605370B2 (en) | 2020-03-12 | 2026-04-21 | University Of Cincinnati | Agents and compositions for the treatment of glioblastoma |
| MX2023004880A (es) * | 2020-10-26 | 2023-05-11 | Cytune Pharma | AGONISTA DE IL-2/IL-15RßY PARA EL TRATAMIENTO DE CÁNCER DE PIEL QUE NO ES MELANOMA. |
| EP4232069A1 (en) * | 2020-10-26 | 2023-08-30 | Cytune Pharma | Il-2/il-15rbetagamma agonist for treating squamous cell carcinoma |
| WO2022106579A1 (en) * | 2020-11-20 | 2022-05-27 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Compounds for treating a disease associated with macrophage senescence |
| CN116963773A (zh) * | 2021-01-21 | 2023-10-27 | 浙江养生堂天然药物研究所有限公司 | 治疗肿瘤的组合物及方法 |
| WO2022245692A1 (en) * | 2021-05-19 | 2022-11-24 | Merck Sharp & Dohme Llc | Treatment of cancer patients with setd2 biomarker alteration with a pd-1 antagonist |
| CN115607678A (zh) * | 2021-07-13 | 2023-01-17 | 杭州阿诺生物医药科技有限公司 | 用于治疗癌症的组合疗法 |
| CN115671289B (zh) * | 2021-07-27 | 2024-04-26 | 广州嘉越医药科技有限公司 | 药物组合及其应用 |
| KR20250097844A (ko) | 2022-10-28 | 2025-06-30 | 카이트 파마 인코포레이티드 | 면역요법의 효능 향상 및 지속적인 반응 |
| WO2024108058A2 (en) * | 2022-11-18 | 2024-05-23 | Nkmax Co., Ltd. | Methods of inducing pd-l1 expression |
| CN120752053A (zh) * | 2023-03-03 | 2025-10-03 | 正大天晴药业集团南京顺欣制药有限公司 | 含抗tim-3抗体的药物组合 |
Citations (302)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4433059A (en) | 1981-09-08 | 1984-02-21 | Ortho Diagnostic Systems Inc. | Double antibody conjugate |
| US4444878A (en) | 1981-12-21 | 1984-04-24 | Boston Biomedical Research Institute, Inc. | Bispecific antibody determinants |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| EP0296122A2 (en) | 1987-06-17 | 1988-12-21 | Sandoz Ag | Cyclosporins and their use as pharmaceuticals |
| EP0346087A2 (en) | 1988-06-09 | 1989-12-13 | Snow Brand Milk Products Co., Ltd. | Hybrid antibody and process for the production thereof |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| US4978672A (en) | 1986-03-07 | 1990-12-18 | Ciba-Geigy Corporation | Alpha-heterocyclc substituted tolunitriles |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| WO1991003493A1 (en) | 1989-08-29 | 1991-03-21 | The University Of Southampton | Bi-or trispecific (fab)3 or (fab)4 conjugates |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993023537A1 (en) | 1992-05-08 | 1993-11-25 | Creative Biomolecules | Chimeric multivalent protein analogues and methods of use thereof |
| US5273743A (en) | 1990-03-09 | 1993-12-28 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994009131A1 (en) | 1992-10-15 | 1994-04-28 | Scotgen Limited | Recombinant specific binding protein |
| WO1994010202A1 (en) | 1992-10-28 | 1994-05-11 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1994012625A2 (en) | 1992-11-23 | 1994-06-09 | Zeneca Limited | LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5534254A (en) | 1992-02-06 | 1996-07-09 | Chiron Corporation | Biosynthetic binding proteins for immuno-targeting |
| WO1996030046A1 (en) | 1995-03-30 | 1996-10-03 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1996037621A2 (en) | 1995-05-23 | 1996-11-28 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Multimeric proteins |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5591828A (en) | 1989-06-22 | 1997-01-07 | Behringwerke Aktiengesellschaft | Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5635602A (en) | 1993-08-13 | 1997-06-03 | The Regents Of The University Of California | Design and synthesis of bispecific DNA-antibody conjugates |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| WO1997049395A1 (en) | 1996-06-25 | 1997-12-31 | Novartis-Erfindungen Verwaltungsgesellschaft M.B.H. | Substituted 3,5-diphenyl-1,2,4-triazoles and their use as pharmaceutical metal chelators |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1998045332A2 (en) | 1997-04-07 | 1998-10-15 | Genentech, Inc. | Humanized antibodies and methods for forming humanized antibodies |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5844094A (en) | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
| US5864019A (en) | 1990-06-11 | 1999-01-26 | Celltech Limited | Multivalent antigen-binding proteins |
| WO1999003854A1 (en) | 1997-07-18 | 1999-01-28 | Novartis Ag | Crystal modification of a n-phenyl-2-pyrimidineamine derivative, processes for its manufacture and its use |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| US5910573A (en) | 1992-01-23 | 1999-06-08 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Monomeric and dimeric antibody-fragment fusion proteins |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| WO1999052552A1 (en) | 1998-04-15 | 1999-10-21 | Brigham & Women's Hospital, Inc. | T cell inhibitory receptor compositions and uses thereof |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| WO1999064460A1 (en) | 1998-06-10 | 1999-12-16 | Celltech Therapeutics Limited | Divalent antibody fragments |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO2000006605A2 (en) | 1998-07-28 | 2000-02-10 | Micromet Ag | Heterominibodies |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
| US6239259B1 (en) | 1996-04-04 | 2001-05-29 | Unilever Patent Holdings B.V. | Multivalent and multispecific antigen-binding protein |
| US6294353B1 (en) | 1994-10-20 | 2001-09-25 | Morphosys Ag | Targeted hetero-association of recombinant proteins to multi-functional complexes |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| US20020004587A1 (en) | 2000-04-11 | 2002-01-10 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| WO2002010192A2 (en) | 2000-08-01 | 2002-02-07 | Novartis Ag | Somatostatin analogues |
| WO2002016436A2 (en) | 2000-08-22 | 2002-02-28 | Novartis Ag | ANTIBODIES TO HUMAN IL-1$g(b) |
| US20020076406A1 (en) | 2000-07-25 | 2002-06-20 | Leung Shui-On | Multivalent target binding protein |
| US20020103345A1 (en) | 2000-05-24 | 2002-08-01 | Zhenping Zhu | Bispecific immunoglobulin-like antigen binding proteins and method of production |
| WO2002066470A1 (en) | 2001-01-12 | 2002-08-29 | Amgen Inc. | Substituted alkylamine derivatives and methods of use |
| WO2002072635A2 (en) | 2001-03-13 | 2002-09-19 | University College London | Specific binding members |
| US6476198B1 (en) | 1993-07-13 | 2002-11-05 | The Scripps Research Institute | Multispecific and multivalent antigen-binding polypeptide molecules |
| US6511663B1 (en) | 1991-06-11 | 2003-01-28 | Celltech R&D Limited | Tri- and tetra-valent monospecific antigen-binding proteins |
| WO2003037347A1 (en) | 2001-10-30 | 2003-05-08 | Novartis Ag | Staurosporine derivatives as inhibitors of flt3 receptor tyrosine kinase activity |
| US6582959B2 (en) | 1991-03-29 | 2003-06-24 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| WO2003064383A2 (en) | 2002-02-01 | 2003-08-07 | Ariad Gene Therapeutics, Inc. | Phosphorus-containing compounds & uses thereof |
| WO2003068809A2 (en) | 2002-02-12 | 2003-08-21 | Crusade Laboratories Limited | An herpes simplex virus complex |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US20030190317A1 (en) | 1997-04-07 | 2003-10-09 | Genentech, Inc. | Anti-VEGF antibodies |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| US20030206899A1 (en) | 1991-03-29 | 2003-11-06 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| US20030211078A1 (en) | 2001-12-07 | 2003-11-13 | Heavner George A. | Pseudo-antibody constructs |
| WO2003099340A1 (en) | 2002-05-23 | 2003-12-04 | The Regents Of The University Of California | Novel chimeric cd154 |
| US6670453B2 (en) | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
| WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| US6703020B1 (en) | 1999-04-28 | 2004-03-09 | Board Of Regents, The University Of Texas System | Antibody conjugate methods for selectively inhibiting VEGF |
| US20040047858A1 (en) | 2002-09-11 | 2004-03-11 | Blumberg Richard S. | Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof |
| US6743896B2 (en) | 1997-04-30 | 2004-06-01 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
| WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
| WO2004072051A1 (en) | 2003-02-11 | 2004-08-26 | Vernalis (Cambridge) Limited | Isoxazole compounds as inhibitors of heat shock proteins |
| WO2004081051A1 (en) | 2003-03-12 | 2004-09-23 | The University Of Birmingham | Bispecific antibodies |
| US6809185B1 (en) | 1998-01-23 | 2004-10-26 | Vlaams Interuniversitair Instituut Voor Biotechnologie | Multipurpose antibody derivatives |
| US20040220388A1 (en) | 2000-06-30 | 2004-11-04 | Nico Mertens | Novel heterodimeric fusion proteins |
| US20040219643A1 (en) | 2001-06-28 | 2004-11-04 | Greg Winter | Dual-specific ligand |
| US20040242847A1 (en) | 2000-10-20 | 2004-12-02 | Naoshi Fukushima | Degraded agonist antibody |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| US20050004352A1 (en) | 1998-04-09 | 2005-01-06 | Roland Kontermann | Single-chain multiple antigen-binding molecule, its preparation and use |
| US20050003403A1 (en) | 2003-04-22 | 2005-01-06 | Rossi Edmund A. | Polyvalent protein complex |
| WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
| WO2005012359A2 (en) | 2003-08-01 | 2005-02-10 | Genentech, Inc. | Anti-vegf antibodies |
| US20050069552A1 (en) | 2003-07-28 | 2005-03-31 | Bleck Gregory T. | Fusion antibodies |
| US20050079170A1 (en) | 2001-09-14 | 2005-04-14 | Fabrice Le Gall | Dimeric and multimeric antigen binding structure |
| US6884879B1 (en) | 1997-04-07 | 2005-04-26 | Genentech, Inc. | Anti-VEGF antibodies |
| WO2005039549A1 (en) | 2003-10-27 | 2005-05-06 | Novartis Ag | Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| US20050112126A1 (en) | 1997-04-07 | 2005-05-26 | Genentech, Inc. | Anti-VEGF antibodies |
| US20050136051A1 (en) | 2003-12-22 | 2005-06-23 | Bernard Scallon | Methods for generating multimeric molecules |
| US20050136049A1 (en) | 2001-01-17 | 2005-06-23 | Ledbetter Jeffrey A. | Binding constructs and methods for use thereof |
| WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
| US20050163782A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| WO2005068503A2 (en) | 2004-01-07 | 2005-07-28 | Chiron Corporation | M-csf-specific monoclonal antibody and uses thereof |
| WO2005073224A2 (en) | 2004-01-23 | 2005-08-11 | Amgen Inc | Quinoline quinazoline pyridine and pyrimidine counds and their use in the treatment of inflammation angiogenesis and cancer |
| US20050186208A1 (en) | 2003-05-30 | 2005-08-25 | Genentech, Inc. | Treatment with anti-VEGF antibodies |
| WO2005113556A1 (en) | 2004-05-13 | 2005-12-01 | Icos Corporation | Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta |
| US20050266425A1 (en) | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
| WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| US20060009360A1 (en) | 2004-06-25 | 2006-01-12 | Robert Pifer | New adjuvant composition |
| WO2006013107A1 (en) | 2004-08-05 | 2006-02-09 | Novartis Ag | Il-17 antagonistic antibodies |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| US20060083747A1 (en) | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
| US20060120960A1 (en) | 2004-01-30 | 2006-06-08 | Sergey Deyev | Multivalent complexes, their production and method of use |
| WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
| WO2006086469A2 (en) | 2005-02-08 | 2006-08-17 | Genzyme Corporation | Antibodies to tgfbeta |
| US20060204493A1 (en) | 2004-09-02 | 2006-09-14 | Genentech, Inc. | Heteromultimeric molecules |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US7129330B1 (en) | 1998-05-05 | 2006-10-31 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Multivalent antibody constructs |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006121810A2 (en) | 2005-05-06 | 2006-11-16 | Providence Health System | Trimeric ox40-immunoglobulin fusion protein and methods of use |
| US20060263367A1 (en) | 2005-05-23 | 2006-11-23 | Fey Georg H | Bispecific antibody devoid of Fc region and method of treatment using same |
| WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
| US20070004909A1 (en) | 2005-04-15 | 2007-01-04 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| WO2007024945A1 (en) | 2005-08-25 | 2007-03-01 | Novartis Ag | Condensed imidazolo derivatives for the inhibition of aldosterone synthase and aromatase |
| WO2007030377A1 (en) | 2005-08-30 | 2007-03-15 | Novartis Ag | Substituted benzimidazoles as kinase inhibitors |
| WO2007044887A2 (en) | 2005-10-11 | 2007-04-19 | Transtarget, Inc. | Method for producing a population of homogenous tetravalent bispecific antibodies |
| US20070087381A1 (en) | 2002-04-15 | 2007-04-19 | Tetsuo Kojima | Methods for constructing scdb libraries |
| WO2007046006A2 (en) | 2005-10-20 | 2007-04-26 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15rbeta/gamma, and hyperagonist (ilralpha sushi-il 15) fusion proteins |
| US20070128150A1 (en) | 2003-12-23 | 2007-06-07 | Norman Timothy J | Branched molecular scaffolds for linking polymer residues to biologically active moieties |
| WO2007070750A1 (en) | 2005-12-13 | 2007-06-21 | Eli Lilly And Company | Anti-il-17 antibodies |
| WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
| US20070141049A1 (en) | 2005-08-26 | 2007-06-21 | Reinhard Bredehorst | Bivalent IgY antibody constructs for diagnostic and therapeutic applications |
| WO2007070660A2 (en) | 2005-12-13 | 2007-06-21 | President And Fellows Of Harvard College | Scaffolds for cell transplantation |
| US20070154901A1 (en) | 1997-06-11 | 2007-07-05 | Protein Engineering Technology Aps | Trimerising module |
| WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
| WO2007095338A2 (en) | 2006-02-15 | 2007-08-23 | Imclone Systems Incorporated | Functional antibodies |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2007121484A2 (en) | 2006-04-19 | 2007-10-25 | Novartis Ag | 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling |
| WO2007131201A2 (en) | 2006-05-05 | 2007-11-15 | Irm Llc | Compounds and compositions as hedgehog pathway modulators |
| WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
| US20070274985A1 (en) | 2006-05-26 | 2007-11-29 | Stefan Dubel | Antibody |
| WO2007137760A2 (en) | 2006-05-25 | 2007-12-06 | Bayer Schering Pharma Aktiengesellschaft | Dimeric molecular complexes |
| EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
| US20080050370A1 (en) | 2006-03-17 | 2008-02-28 | Scott Glaser | Stabilized polypeptide compositions |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| WO2008051424A2 (en) | 2006-10-20 | 2008-05-02 | University Of Southampton | Human immune therapies using a cd27 agonist alone or in combination with other immune modulators |
| WO2008054603A2 (en) | 2006-10-02 | 2008-05-08 | Amgen Inc. | Il-17 receptor a antigen binding proteins |
| EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| WO2008070743A2 (en) | 2006-12-05 | 2008-06-12 | Memgen Llc | Methods of increasing cancer sensitivity to chemotherapeutic agents using chimeric isf35 |
| WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US20080152645A1 (en) | 2006-08-18 | 2008-06-26 | Armagen Technologies, Inc. | Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS |
| US20080241884A1 (en) | 2003-10-08 | 2008-10-02 | Kenya Shitara | Fused Protein Composition |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| US20080254512A1 (en) | 2006-11-02 | 2008-10-16 | Capon Daniel J | Hybrid immunoglobulins with moving parts |
| US20080260738A1 (en) | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
| WO2009002562A2 (en) | 2007-06-27 | 2008-12-31 | Marine Polymer Technologies, Inc. | Complexes of il-15 and il-15ralpha and uses thereof |
| WO2009021754A2 (en) | 2007-08-15 | 2009-02-19 | Bayer Schering Pharma Aktiengesellschaft | Monospecific and multispecific antibodies and method of use |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US20090130106A1 (en) | 2005-11-29 | 2009-05-21 | The University Of Sydney | Demibodies: dimerization-activated therapeutic agents |
| WO2009068630A1 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Immunoglobulin constructs |
| US20090148905A1 (en) | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
| US20090155275A1 (en) | 2007-07-31 | 2009-06-18 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162360A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090175867A1 (en) | 2006-06-12 | 2009-07-09 | Trubion Pharmaceuticals, Inc. | Single-Chain Multivalent Binding Proteins with Effector Function |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| US20090175851A1 (en) | 2007-12-21 | 2009-07-09 | Christian Klein | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009102465A2 (en) | 2008-02-13 | 2009-08-20 | President And Fellows Of Harvard College | Continuous cell programming devices |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| US20090232811A1 (en) | 2007-12-21 | 2009-09-17 | Christian Klein | Bivalent, bispecific antibodies |
| WO2009114870A2 (en) | 2008-03-14 | 2009-09-17 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US20090234105A1 (en) | 2006-03-24 | 2009-09-17 | The Regents Of The University Of California | Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition |
| WO2009115562A2 (en) | 2008-03-19 | 2009-09-24 | Novartis Ag | Crystalline forms and two solvated forms of 4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1h-benzimidazol-2-yl]quinolin-2(1h)-one lactic acid salts |
| US20090263392A1 (en) | 2006-03-31 | 2009-10-22 | Chugai Seiyaku Kabushiki Kaisha | Methods of modifying antibodies for purification of bispecific antibodies |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US20090274649A1 (en) | 2002-03-01 | 2009-11-05 | Immunomedics, Inc. | Bispecific Antibody Point Mutations for Enhancing Rate of Clearance |
| US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
| WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
| WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
| WO2010002655A2 (en) | 2008-06-25 | 2010-01-07 | Irm Llc | Compounds and compositions as kinase inhibitors |
| WO2010006086A2 (en) | 2008-07-08 | 2010-01-14 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| WO2010007120A1 (en) | 2008-07-18 | 2010-01-21 | Novartis Ag | Pyridazine derivatives as smo inhibitors |
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2010026124A1 (en) | 2008-09-02 | 2010-03-11 | Novartis Ag | Picolinamide derivatives as kinase inhibitors |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
| WO2010036380A1 (en) | 2008-09-26 | 2010-04-01 | Intellikine, Inc. | Heterocyclic kinase inhibitors |
| WO2010060937A2 (en) | 2008-11-28 | 2010-06-03 | Novartis Ag | Hsp90 inhibitor combinations |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20100178684A1 (en) | 2006-12-21 | 2010-07-15 | Woo Savio L C | Transgenic oncolytic viruses and uses thereof |
| US7767675B2 (en) | 2006-11-22 | 2010-08-03 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2010101849A1 (en) | 2009-03-02 | 2010-09-10 | Irm Llc | N- (hetero)aryl, 2- (hetero)aryl-substituted acetamides for use as wnt signaling modulators |
| WO2010125571A1 (en) | 2009-04-30 | 2010-11-04 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Anti ceacam1 antibodies and methods of using same |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010149755A1 (en) | 2009-06-26 | 2010-12-29 | Novartis Ag | 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17 |
| US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
| US20110020216A1 (en) | 2007-06-21 | 2011-01-27 | David James Mooney | Scaffolds for cell collection or elimination |
| WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
| WO2011101409A1 (en) | 2010-02-19 | 2011-08-25 | Novartis Ag | Pyrrolopyrimidine compounds as inhibitors of cdk4/6 |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011155607A1 (ja) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | 抗tim-3抗体 |
| WO2012004367A1 (en) | 2010-07-09 | 2012-01-12 | N.V. Organon | Agonistic antibody to cd27 |
| US8106163B2 (en) | 2008-07-17 | 2012-01-31 | Novartis Ag | Compositions and methods of use for therapeutic antibodies |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| WO2012022814A1 (en) | 2010-08-20 | 2012-02-23 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (her3) |
| WO2012027328A2 (en) | 2010-08-23 | 2012-03-01 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| WO2012040323A2 (en) | 2010-09-21 | 2012-03-29 | Altor Bioscien Corporation | Multimeric il-15 soluble fusion molecules and methods of making and using same |
| WO2012048165A2 (en) | 2010-10-06 | 2012-04-12 | President And Fellows Of Harvard College | Injectable, pore-forming hydrogels for materials-based cell therapies |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| US20120122185A1 (en) | 2005-12-02 | 2012-05-17 | Peter Palese | Chimeric viruses presenting non-native surface proteins and uses thereof |
| WO2012149358A1 (en) | 2011-04-28 | 2012-11-01 | President And Fellows Of Harvard College | Injectable preformed macroscopic 3-dimensional scaffolds for minimally invasive administration |
| WO2012167143A1 (en) | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2012167230A1 (en) | 2011-06-03 | 2012-12-06 | President And Fellows Of Harvard College | In situ antigen-generating cancer vaccine |
| WO2012177624A2 (en) | 2011-06-21 | 2012-12-27 | The Johns Hopkins University | Focused radiation for augmenting immune-based therapies against neoplasms |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US8420645B2 (en) | 2008-05-21 | 2013-04-16 | Incyte Corporation | Salts of 2-fluoro-N-methyl-4-[7-(quinolin-6-yl-methyl)-imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide and processes related to preparing the same |
| WO2013054331A1 (en) | 2011-10-11 | 2013-04-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
| WO2013082366A1 (en) | 2011-12-01 | 2013-06-06 | The Brigham And Women's Hospital, Inc. | Anti-ceacam1 recombinant antibodies for cancer therapy |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013106852A1 (en) | 2012-01-13 | 2013-07-18 | President And Fellows Of Harvard College | Controlled delivery of tlr agonists in structural polymeric devices |
| WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
| WO2013124826A1 (en) | 2012-02-24 | 2013-08-29 | Novartis Ag | Oxazolidin- 2 -one compounds and uses thereof as pi3ks inhibitors |
| WO2013148228A1 (en) | 2012-03-29 | 2013-10-03 | Advanced Cancer Therapeutics, Llc | Pfkfb3 inhibitor and methods of use as an anti-cancer therapeutic |
| US8552003B2 (en) | 2006-08-02 | 2013-10-08 | Novartis Ag | (S)-N-((S)-1-cyclohexyl-2-{(S)-2-[4-4-(4-fluorobenzoyl)-thiazol-2-yl]pyrrolidin-1-yl}-2-oxoethyl)-2-methylamino-propionamide, or pharmaceutically acceptable salts thereof and their uses |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| WO2013158673A1 (en) | 2012-04-16 | 2013-10-24 | President And Fellows Of Harvard College | Mesoporous silica compositions for modulating immune responses |
| US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
| WO2013171640A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171641A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171639A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171642A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| US8591881B2 (en) | 2009-02-05 | 2013-11-26 | Mount Sinai School Of Medicine | Chimeric Newcastle disease viruses and uses thereof |
| US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
| WO2014022332A1 (en) | 2012-07-31 | 2014-02-06 | The Brigham And Women's Hospital, Inc. | Modulation of the immune response |
| WO2014036412A2 (en) | 2012-08-30 | 2014-03-06 | Amgen Inc. | A method for treating melanoma using a herpes simplex virus and an immune checkpoint inhibitor |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| WO2014066527A2 (en) | 2012-10-24 | 2014-05-01 | Admune Therapeutics Llc | Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes |
| WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
| WO2014081937A2 (en) | 2012-11-21 | 2014-05-30 | Duke University | Oncolytic poliovirus for human tumors |
| WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
| WO2014122613A1 (en) | 2013-02-08 | 2014-08-14 | Novartis Ag | Anti-il-17a antibodies and their use in treating autoimmune and inflammatory disorders |
| WO2014141104A1 (en) | 2013-03-14 | 2014-09-18 | Novartis Ag | 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh |
| US20140271677A1 (en) | 2013-03-14 | 2014-09-18 | Memorial Sloan Kettering Cancer Center | Newcastle Disease Viruses and Uses Thereof |
| WO2014151616A1 (en) | 2013-03-14 | 2014-09-25 | Novartis Ag | Biaryl amide compounds as kinase inhibitors |
| WO2014160160A2 (en) | 2013-03-13 | 2014-10-02 | Novartis Ag | Antibody drug conjugates |
| WO2014189805A1 (en) | 2013-05-18 | 2014-11-27 | Auro Biotech, Inc. | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
| WO2014189806A1 (en) | 2013-05-18 | 2014-11-27 | Aduro Biotech, Inc. | Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
| US20150056225A1 (en) | 2012-04-17 | 2015-02-26 | University Of Washington Through Its Center For Commercialization | HLA Class II Deficient Cells, HLA Class I Deficient Cells Capable of Expressing HLA Class II Proteins, and Uses Thereof |
| WO2015036499A1 (en) | 2013-09-11 | 2015-03-19 | Medimmune Limited | Anti-b7-h1 antibodies for treating tumors |
| WO2015066188A1 (en) | 2013-11-01 | 2015-05-07 | Novartis Ag | Aminoheteroaryl benzamides as kinase inhibitors |
| WO2015079417A1 (en) | 2013-11-29 | 2015-06-04 | Novartis Ag | Novel amino pyrimidine derivatives |
| WO2015091853A2 (en) | 2013-12-19 | 2015-06-25 | Alligator Bioscience Ab | Antibodies |
| US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
| US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
| US20150290316A1 (en) * | 2012-10-02 | 2015-10-15 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| US20160108123A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK3579874T3 (da) * | 2017-02-10 | 2021-10-11 | Novartis Ag | 1-(4-amino-5-brom-6-(1h-pyrazol-1-yl)pyrimidin-2-yl)-1h-pyrazol-4-ol og anvendelse deraf til behandling af cancer |
| EP3582811B1 (en) * | 2017-02-14 | 2024-07-10 | Novartis AG | Dosing schedule of a wnt inhibitor and an anti-pd-1 antibody molecule in combination |
| AU2018277241B2 (en) * | 2017-05-31 | 2021-03-04 | Novartis Ag | Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts |
-
2016
- 2016-12-16 WO PCT/US2016/067200 patent/WO2017106656A1/en not_active Ceased
- 2016-12-16 JP JP2018531392A patent/JP2019503349A/ja active Pending
- 2016-12-16 ES ES16831788T patent/ES2986067T3/es active Active
- 2016-12-16 BR BR112018012138-0A patent/BR112018012138A2/pt active Search and Examination
- 2016-12-16 KR KR1020187019916A patent/KR102833068B1/ko active Active
- 2016-12-16 MX MX2018007423A patent/MX2018007423A/es unknown
- 2016-12-16 EP EP16831788.1A patent/EP3389712B1/en active Active
- 2016-12-16 AU AU2016369537A patent/AU2016369537B2/en active Active
- 2016-12-16 EP EP24169342.3A patent/EP4424322A3/en not_active Withdrawn
- 2016-12-16 US US16/062,427 patent/US20180371093A1/en active Pending
- 2016-12-16 CN CN201680079836.2A patent/CN108495651A/zh active Pending
-
2018
- 2018-06-07 PH PH12018501206A patent/PH12018501206A1/en unknown
- 2018-06-12 IL IL259987A patent/IL259987A/en unknown
- 2018-06-12 CL CL2018001560A patent/CL2018001560A1/es unknown
-
2020
- 2020-06-02 JP JP2020096122A patent/JP7569166B2/ja active Active
-
2022
- 2022-09-26 JP JP2022152739A patent/JP2022180567A/ja active Pending
-
2024
- 2024-08-30 JP JP2024150345A patent/JP2024174916A/ja active Pending
Patent Citations (355)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4433059A (en) | 1981-09-08 | 1984-02-21 | Ortho Diagnostic Systems Inc. | Double antibody conjugate |
| US4444878A (en) | 1981-12-21 | 1984-04-24 | Boston Biomedical Research Institute, Inc. | Bispecific antibody determinants |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| US4978672A (en) | 1986-03-07 | 1990-12-18 | Ciba-Geigy Corporation | Alpha-heterocyclc substituted tolunitriles |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| EP0296122A2 (en) | 1987-06-17 | 1988-12-21 | Sandoz Ag | Cyclosporins and their use as pharmaceuticals |
| EP0346087A2 (en) | 1988-06-09 | 1989-12-13 | Snow Brand Milk Products Co., Ltd. | Hybrid antibody and process for the production thereof |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| US5591828A (en) | 1989-06-22 | 1997-01-07 | Behringwerke Aktiengesellschaft | Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| WO1991003493A1 (en) | 1989-08-29 | 1991-03-21 | The University Of Southampton | Bi-or trispecific (fab)3 or (fab)4 conjugates |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5273743A (en) | 1990-03-09 | 1993-12-28 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5864019A (en) | 1990-06-11 | 1999-01-26 | Celltech Limited | Multivalent antigen-binding proteins |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| US6582959B2 (en) | 1991-03-29 | 2003-06-24 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| US20030203409A1 (en) | 1991-03-29 | 2003-10-30 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| US20030206899A1 (en) | 1991-03-29 | 2003-11-06 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US6511663B1 (en) | 1991-06-11 | 2003-01-28 | Celltech R&D Limited | Tri- and tetra-valent monospecific antigen-binding proteins |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5910573A (en) | 1992-01-23 | 1999-06-08 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Monomeric and dimeric antibody-fragment fusion proteins |
| US5534254A (en) | 1992-02-06 | 1996-07-09 | Chiron Corporation | Biosynthetic binding proteins for immuno-targeting |
| US5585499A (en) | 1992-03-25 | 1996-12-17 | Immunogen Inc. | Cyclopropylbenzindole-containing cytotoxic drugs |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5846545A (en) | 1992-03-25 | 1998-12-08 | Immunogen, Inc. | Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs |
| WO1993023537A1 (en) | 1992-05-08 | 1993-11-25 | Creative Biomolecules | Chimeric multivalent protein analogues and methods of use thereof |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| US5844094A (en) | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
| WO1994009131A1 (en) | 1992-10-15 | 1994-04-28 | Scotgen Limited | Recombinant specific binding protein |
| EP0666868B1 (en) | 1992-10-28 | 2002-04-03 | Genentech, Inc. | Use of anti-VEGF antibodies for the treatment of cancer |
| WO1994010202A1 (en) | 1992-10-28 | 1994-05-11 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| WO1994012625A2 (en) | 1992-11-23 | 1994-06-09 | Zeneca Limited | LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US6476198B1 (en) | 1993-07-13 | 2002-11-05 | The Scripps Research Institute | Multispecific and multivalent antigen-binding polypeptide molecules |
| US5635602A (en) | 1993-08-13 | 1997-06-03 | The Regents Of The University Of California | Design and synthesis of bispecific DNA-antibody conjugates |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| US6294353B1 (en) | 1994-10-20 | 2001-09-25 | Morphosys Ag | Targeted hetero-association of recombinant proteins to multi-functional complexes |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO1996030046A1 (en) | 1995-03-30 | 1996-10-03 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1996037621A2 (en) | 1995-05-23 | 1996-11-28 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Multimeric proteins |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| US6239259B1 (en) | 1996-04-04 | 2001-05-29 | Unilever Patent Holdings B.V. | Multivalent and multispecific antigen-binding protein |
| WO1997049395A1 (en) | 1996-06-25 | 1997-12-31 | Novartis-Erfindungen Verwaltungsgesellschaft M.B.H. | Substituted 3,5-diphenyl-1,2,4-triazoles and their use as pharmaceutical metal chelators |
| US7025962B1 (en) | 1996-08-16 | 2006-04-11 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| EP1947183B1 (en) | 1996-08-16 | 2013-07-17 | Merck Sharp & Dohme Corp. | Mammalian cell surface antigens; related reagents |
| US20030190317A1 (en) | 1997-04-07 | 2003-10-09 | Genentech, Inc. | Anti-VEGF antibodies |
| US7060269B1 (en) | 1997-04-07 | 2006-06-13 | Genentech, Inc. | Anti-VEGF antibodies |
| US6884879B1 (en) | 1997-04-07 | 2005-04-26 | Genentech, Inc. | Anti-VEGF antibodies |
| WO1998045332A2 (en) | 1997-04-07 | 1998-10-15 | Genentech, Inc. | Humanized antibodies and methods for forming humanized antibodies |
| US20050112126A1 (en) | 1997-04-07 | 2005-05-26 | Genentech, Inc. | Anti-VEGF antibodies |
| US6743896B2 (en) | 1997-04-30 | 2004-06-01 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| US20070154901A1 (en) | 1997-06-11 | 2007-07-05 | Protein Engineering Technology Aps | Trimerising module |
| WO1999003854A1 (en) | 1997-07-18 | 1999-01-28 | Novartis Ag | Crystal modification of a n-phenyl-2-pyrimidineamine derivative, processes for its manufacture and its use |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| US6670453B2 (en) | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
| US6809185B1 (en) | 1998-01-23 | 2004-10-26 | Vlaams Interuniversitair Instituut Voor Biotechnologie | Multipurpose antibody derivatives |
| WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| US20050004352A1 (en) | 1998-04-09 | 2005-01-06 | Roland Kontermann | Single-chain multiple antigen-binding molecule, its preparation and use |
| US7132255B2 (en) | 1998-04-15 | 2006-11-07 | The Brigham And Women's Hospital, Inc. | Identification of compounds that bind biliary glycoprotein and affect cytotoxic T lymphocyte activity |
| WO1999052552A1 (en) | 1998-04-15 | 1999-10-21 | Brigham & Women's Hospital, Inc. | T cell inhibitory receptor compositions and uses thereof |
| US7129330B1 (en) | 1998-05-05 | 2006-10-31 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Multivalent antibody constructs |
| WO1999064460A1 (en) | 1998-06-10 | 1999-12-16 | Celltech Therapeutics Limited | Divalent antibody fragments |
| WO2000006605A2 (en) | 1998-07-28 | 2000-02-10 | Micromet Ag | Heterominibodies |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| US6703020B1 (en) | 1999-04-28 | 2004-03-09 | Board Of Regents, The University Of Texas System | Antibody conjugate methods for selectively inhibiting VEGF |
| WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
| US20020004587A1 (en) | 2000-04-11 | 2002-01-10 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US20020103345A1 (en) | 2000-05-24 | 2002-08-01 | Zhenping Zhu | Bispecific immunoglobulin-like antigen binding proteins and method of production |
| US20040220388A1 (en) | 2000-06-30 | 2004-11-04 | Nico Mertens | Novel heterodimeric fusion proteins |
| US20020076406A1 (en) | 2000-07-25 | 2002-06-20 | Leung Shui-On | Multivalent target binding protein |
| WO2002010192A2 (en) | 2000-08-01 | 2002-02-07 | Novartis Ag | Somatostatin analogues |
| US7473761B2 (en) | 2000-08-01 | 2009-01-06 | Novartis Ag | Somatostatin analogues |
| WO2002016436A2 (en) | 2000-08-22 | 2002-02-28 | Novartis Ag | ANTIBODIES TO HUMAN IL-1$g(b) |
| EP1313769A2 (en) | 2000-08-22 | 2003-05-28 | Novartis AG | Antibodies to human il-1 beta |
| US7446175B2 (en) | 2000-08-22 | 2008-11-04 | Novartis Ag | Antibodies to human IL-1β |
| US20040242847A1 (en) | 2000-10-20 | 2004-12-02 | Naoshi Fukushima | Degraded agonist antibody |
| WO2002066470A1 (en) | 2001-01-12 | 2002-08-29 | Amgen Inc. | Substituted alkylamine derivatives and methods of use |
| US20050136049A1 (en) | 2001-01-17 | 2005-06-23 | Ledbetter Jeffrey A. | Binding constructs and methods for use thereof |
| WO2002072635A2 (en) | 2001-03-13 | 2002-09-19 | University College London | Specific binding members |
| US20040219643A1 (en) | 2001-06-28 | 2004-11-04 | Greg Winter | Dual-specific ligand |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| US20050079170A1 (en) | 2001-09-14 | 2005-04-14 | Fabrice Le Gall | Dimeric and multimeric antigen binding structure |
| WO2003037347A1 (en) | 2001-10-30 | 2003-05-08 | Novartis Ag | Staurosporine derivatives as inhibitors of flt3 receptor tyrosine kinase activity |
| US20030211078A1 (en) | 2001-12-07 | 2003-11-13 | Heavner George A. | Pseudo-antibody constructs |
| WO2003064383A2 (en) | 2002-02-01 | 2003-08-07 | Ariad Gene Therapeutics, Inc. | Phosphorus-containing compounds & uses thereof |
| WO2003068809A2 (en) | 2002-02-12 | 2003-08-21 | Crusade Laboratories Limited | An herpes simplex virus complex |
| US20090274649A1 (en) | 2002-03-01 | 2009-11-05 | Immunomedics, Inc. | Bispecific Antibody Point Mutations for Enhancing Rate of Clearance |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US20070087381A1 (en) | 2002-04-15 | 2007-04-19 | Tetsuo Kojima | Methods for constructing scdb libraries |
| WO2003099340A1 (en) | 2002-05-23 | 2003-12-04 | The Regents Of The University Of California | Novel chimeric cd154 |
| WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
| US20040047858A1 (en) | 2002-09-11 | 2004-03-11 | Blumberg Richard S. | Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof |
| WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| US20060083747A1 (en) | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
| WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
| WO2004072051A1 (en) | 2003-02-11 | 2004-08-26 | Vernalis (Cambridge) Limited | Isoxazole compounds as inhibitors of heat shock proteins |
| WO2004081051A1 (en) | 2003-03-12 | 2004-09-23 | The University Of Birmingham | Bispecific antibodies |
| US20080171855A1 (en) | 2003-04-22 | 2008-07-17 | Ibc Pharmaceuticals, Inc. | Polyvalent protein complex |
| US20050003403A1 (en) | 2003-04-22 | 2005-01-06 | Rossi Edmund A. | Polyvalent protein complex |
| US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
| US20050186208A1 (en) | 2003-05-30 | 2005-08-25 | Genentech, Inc. | Treatment with anti-VEGF antibodies |
| US20050163782A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
| US20050069552A1 (en) | 2003-07-28 | 2005-03-31 | Bleck Gregory T. | Fusion antibodies |
| WO2005012359A2 (en) | 2003-08-01 | 2005-02-10 | Genentech, Inc. | Anti-vegf antibodies |
| US20080241884A1 (en) | 2003-10-08 | 2008-10-02 | Kenya Shitara | Fused Protein Composition |
| WO2005039549A1 (en) | 2003-10-27 | 2005-05-06 | Novartis Ag | Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
| US20050136051A1 (en) | 2003-12-22 | 2005-06-23 | Bernard Scallon | Methods for generating multimeric molecules |
| US20070128150A1 (en) | 2003-12-23 | 2007-06-07 | Norman Timothy J | Branched molecular scaffolds for linking polymer residues to biologically active moieties |
| US20050266425A1 (en) | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
| WO2005068503A2 (en) | 2004-01-07 | 2005-07-28 | Chiron Corporation | M-csf-specific monoclonal antibody and uses thereof |
| WO2005073224A2 (en) | 2004-01-23 | 2005-08-11 | Amgen Inc | Quinoline quinazoline pyridine and pyrimidine counds and their use in the treatment of inflammation angiogenesis and cancer |
| US20060120960A1 (en) | 2004-01-30 | 2006-06-08 | Sergey Deyev | Multivalent complexes, their production and method of use |
| WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
| WO2005113556A1 (en) | 2004-05-13 | 2005-12-01 | Icos Corporation | Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta |
| WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| US20060009360A1 (en) | 2004-06-25 | 2006-01-12 | Robert Pifer | New adjuvant composition |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| EP1776142A1 (en) | 2004-08-05 | 2007-04-25 | Novartis AG | Il-17 antagonistic antibodies |
| US8617552B2 (en) | 2004-08-05 | 2013-12-31 | Novarts Ag | IL-17 antibodies |
| US7807155B2 (en) | 2004-08-05 | 2010-10-05 | Novartis Ag | IL-17 antagonistic antibodies |
| WO2006013107A1 (en) | 2004-08-05 | 2006-02-09 | Novartis Ag | Il-17 antagonistic antibodies |
| US8119131B2 (en) | 2004-08-05 | 2012-02-21 | Novartis Ag | IL-17 antagonistic antibodies |
| US20060204493A1 (en) | 2004-09-02 | 2006-09-14 | Genentech, Inc. | Heteromultimeric molecules |
| WO2006086469A2 (en) | 2005-02-08 | 2006-08-17 | Genzyme Corporation | Antibodies to tgfbeta |
| US8591901B2 (en) | 2005-02-08 | 2013-11-26 | Genzyme Corporation | Antibodies to TGF-β |
| US8383780B2 (en) | 2005-02-08 | 2013-02-26 | Genzyme Corporation | Antibodies to TGFβ |
| US8388967B2 (en) | 2005-03-25 | 2013-03-05 | Gitr, Inc. | Methods for inducing or enhancing an immune response by administering agonistic GITR-binding antibodies |
| EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
| US7812135B2 (en) | 2005-03-25 | 2010-10-12 | Tolerrx, Inc. | GITR-binding antibodies |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US20070004909A1 (en) | 2005-04-15 | 2007-01-04 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2006121810A2 (en) | 2005-05-06 | 2006-11-16 | Providence Health System | Trimeric ox40-immunoglobulin fusion protein and methods of use |
| US7959925B2 (en) | 2005-05-06 | 2011-06-14 | Providence Health System | Trimeric OX40-immunoglobulin fusion protein and methods of use |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
| US20060263367A1 (en) | 2005-05-23 | 2006-11-23 | Fey Georg H | Bispecific antibody devoid of Fc region and method of treatment using same |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2007024945A1 (en) | 2005-08-25 | 2007-03-01 | Novartis Ag | Condensed imidazolo derivatives for the inhibition of aldosterone synthase and aromatase |
| US20070141049A1 (en) | 2005-08-26 | 2007-06-21 | Reinhard Bredehorst | Bivalent IgY antibody constructs for diagnostic and therapeutic applications |
| WO2007030377A1 (en) | 2005-08-30 | 2007-03-15 | Novartis Ag | Substituted benzimidazoles as kinase inhibitors |
| WO2007044887A2 (en) | 2005-10-11 | 2007-04-19 | Transtarget, Inc. | Method for producing a population of homogenous tetravalent bispecific antibodies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| WO2007046006A2 (en) | 2005-10-20 | 2007-04-26 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15rbeta/gamma, and hyperagonist (ilralpha sushi-il 15) fusion proteins |
| US20090130106A1 (en) | 2005-11-29 | 2009-05-21 | The University Of Sydney | Demibodies: dimerization-activated therapeutic agents |
| US20120122185A1 (en) | 2005-12-02 | 2012-05-17 | Peter Palese | Chimeric viruses presenting non-native surface proteins and uses thereof |
| EP1960009B1 (en) | 2005-12-13 | 2011-11-23 | The President and Fellows of Harvard College | Scaffolds for cell transplantation |
| US7838638B2 (en) | 2005-12-13 | 2010-11-23 | Eli Lilly And Company | Anti-IL-17 antibodies |
| US8067237B2 (en) | 2005-12-13 | 2011-11-29 | President And Fellows Of Harvard College | Scaffolds for cell transplantation |
| WO2007070750A1 (en) | 2005-12-13 | 2007-06-21 | Eli Lilly And Company | Anti-il-17 antibodies |
| US8110191B2 (en) | 2005-12-13 | 2012-02-07 | Eli Lilly And Company | Anti-IL-17 antibodies |
| WO2007070660A2 (en) | 2005-12-13 | 2007-06-21 | President And Fellows Of Harvard College | Scaffolds for cell transplantation |
| US8932583B2 (en) | 2005-12-13 | 2015-01-13 | President And Fellows Of Harvard College | Scaffolds for cell transplantation |
| WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
| WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
| WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
| WO2007095338A2 (en) | 2006-02-15 | 2007-08-23 | Imclone Systems Incorporated | Functional antibodies |
| US20080050370A1 (en) | 2006-03-17 | 2008-02-28 | Scott Glaser | Stabilized polypeptide compositions |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| US20090234105A1 (en) | 2006-03-24 | 2009-09-17 | The Regents Of The University Of California | Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition |
| US20090263392A1 (en) | 2006-03-31 | 2009-10-22 | Chugai Seiyaku Kabushiki Kaisha | Methods of modifying antibodies for purification of bispecific antibodies |
| WO2007121484A2 (en) | 2006-04-19 | 2007-10-25 | Novartis Ag | 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling |
| WO2007131201A2 (en) | 2006-05-05 | 2007-11-15 | Irm Llc | Compounds and compositions as hedgehog pathway modulators |
| WO2007137760A2 (en) | 2006-05-25 | 2007-12-06 | Bayer Schering Pharma Aktiengesellschaft | Dimeric molecular complexes |
| US20070274985A1 (en) | 2006-05-26 | 2007-11-29 | Stefan Dubel | Antibody |
| US20090175867A1 (en) | 2006-06-12 | 2009-07-09 | Trubion Pharmaceuticals, Inc. | Single-Chain Multivalent Binding Proteins with Effector Function |
| US8552003B2 (en) | 2006-08-02 | 2013-10-08 | Novartis Ag | (S)-N-((S)-1-cyclohexyl-2-{(S)-2-[4-4-(4-fluorobenzoyl)-thiazol-2-yl]pyrrolidin-1-yl}-2-oxoethyl)-2-methylamino-propionamide, or pharmaceutically acceptable salts thereof and their uses |
| US20080152645A1 (en) | 2006-08-18 | 2008-06-26 | Armagen Technologies, Inc. | Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS |
| US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| US8545842B2 (en) | 2006-10-02 | 2013-10-01 | Kirin-Amgen, Inc. | Polynucleotides encoding IL-17 receptor A antigen binding proteins |
| US7833527B2 (en) | 2006-10-02 | 2010-11-16 | Amgen Inc. | Methods of treating psoriasis using IL-17 Receptor A antibodies |
| WO2008054603A2 (en) | 2006-10-02 | 2008-05-08 | Amgen Inc. | Il-17 receptor a antigen binding proteins |
| US8435518B2 (en) | 2006-10-02 | 2013-05-07 | Kirin-Amgen, Inc. | Methods of using IL-17 receptor a antibodies |
| US7786284B2 (en) | 2006-10-02 | 2010-08-31 | Amgen Inc. | Polynucleotides encoding IL-17 receptor A antigen binding proteins |
| US7767206B2 (en) | 2006-10-02 | 2010-08-03 | Amgen Inc. | Neutralizing determinants of IL-17 Receptor A and antibodies that bind thereto |
| US8790648B2 (en) | 2006-10-02 | 2014-07-29 | Amgen Inc. | Methods of treating psoriasis using IL-17 receptor A antibodies |
| US9073999B2 (en) | 2006-10-02 | 2015-07-07 | Kirin-Amgen, Inc. | Anti-IL-17 receptor A neutralizing antibodies |
| US7939070B2 (en) | 2006-10-02 | 2011-05-10 | Amgen Inc. | IL-17 receptor A antigen binding proteins |
| US8481029B2 (en) | 2006-10-20 | 2013-07-09 | University Of Southampton | Human immune therapies using a CD27 agonist alone or in combination with other immune modulators |
| WO2008051424A2 (en) | 2006-10-20 | 2008-05-02 | University Of Southampton | Human immune therapies using a cd27 agonist alone or in combination with other immune modulators |
| US20080254512A1 (en) | 2006-11-02 | 2008-10-16 | Capon Daniel J | Hybrid immunoglobulins with moving parts |
| US7767675B2 (en) | 2006-11-22 | 2010-08-03 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2008070743A2 (en) | 2006-12-05 | 2008-06-12 | Memgen Llc | Methods of increasing cancer sensitivity to chemotherapeutic agents using chimeric isf35 |
| WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US20100178684A1 (en) | 2006-12-21 | 2010-07-15 | Woo Savio L C | Transgenic oncolytic viruses and uses thereof |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| US20080260738A1 (en) | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US20110020216A1 (en) | 2007-06-21 | 2011-01-27 | David James Mooney | Scaffolds for cell collection or elimination |
| WO2009002562A2 (en) | 2007-06-27 | 2008-12-31 | Marine Polymer Technologies, Inc. | Complexes of il-15 and il-15ralpha and uses thereof |
| US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
| US20090155275A1 (en) | 2007-07-31 | 2009-06-18 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| WO2009021754A2 (en) | 2007-08-15 | 2009-02-19 | Bayer Schering Pharma Aktiengesellschaft | Monospecific and multispecific antibodies and method of use |
| WO2009068630A1 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Immunoglobulin constructs |
| US20090148905A1 (en) | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| US20090232811A1 (en) | 2007-12-21 | 2009-09-17 | Christian Klein | Bivalent, bispecific antibodies |
| US20090175851A1 (en) | 2007-12-21 | 2009-07-09 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162360A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| WO2009102465A2 (en) | 2008-02-13 | 2009-08-20 | President And Fellows Of Harvard College | Continuous cell programming devices |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009114870A2 (en) | 2008-03-14 | 2009-09-17 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| WO2009115562A2 (en) | 2008-03-19 | 2009-09-24 | Novartis Ag | Crystalline forms and two solvated forms of 4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1h-benzimidazol-2-yl]quinolin-2(1h)-one lactic acid salts |
| US8420645B2 (en) | 2008-05-21 | 2013-04-16 | Incyte Corporation | Salts of 2-fluoro-N-methyl-4-[7-(quinolin-6-yl-methyl)-imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide and processes related to preparing the same |
| WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
| WO2010002655A2 (en) | 2008-06-25 | 2010-01-07 | Irm Llc | Compounds and compositions as kinase inhibitors |
| WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
| WO2010006086A2 (en) | 2008-07-08 | 2010-01-14 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| US8106163B2 (en) | 2008-07-17 | 2012-01-31 | Novartis Ag | Compositions and methods of use for therapeutic antibodies |
| WO2010007120A1 (en) | 2008-07-18 | 2010-01-21 | Novartis Ag | Pyridazine derivatives as smo inhibitors |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
| US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US8685980B2 (en) | 2008-08-22 | 2014-04-01 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| US8609089B2 (en) | 2008-08-25 | 2013-12-17 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010026124A1 (en) | 2008-09-02 | 2010-03-11 | Novartis Ag | Picolinamide derivatives as kinase inhibitors |
| WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
| US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
| WO2010036380A1 (en) | 2008-09-26 | 2010-04-01 | Intellikine, Inc. | Heterocyclic kinase inhibitors |
| WO2010060937A2 (en) | 2008-11-28 | 2010-06-03 | Novartis Ag | Hsp90 inhibitor combinations |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US8591881B2 (en) | 2009-02-05 | 2013-11-26 | Mount Sinai School Of Medicine | Chimeric Newcastle disease viruses and uses thereof |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| WO2010101849A1 (en) | 2009-03-02 | 2010-09-10 | Irm Llc | N- (hetero)aryl, 2- (hetero)aryl-substituted acetamides for use as wnt signaling modulators |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010125571A1 (en) | 2009-04-30 | 2010-11-04 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Anti ceacam1 antibodies and methods of using same |
| WO2010149755A1 (en) | 2009-06-26 | 2010-12-29 | Novartis Ag | 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17 |
| WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US8709424B2 (en) | 2009-09-03 | 2014-04-29 | Merck Sharp & Dohme Corp. | Anti-GITR antibodies |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
| WO2011101409A1 (en) | 2010-02-19 | 2011-08-25 | Novartis Ag | Pyrrolopyrimidine compounds as inhibitors of cdk4/6 |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| EP2581113A1 (en) | 2010-06-11 | 2013-04-17 | Kyowa Hakko Kirin Co., Ltd. | Anti-tim-3 antibody |
| WO2011155607A1 (ja) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | 抗tim-3抗体 |
| US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
| US20140044728A1 (en) | 2010-06-11 | 2014-02-13 | Kyushu University, National University Corporation | Anti-tim-3 antibody |
| WO2012004367A1 (en) | 2010-07-09 | 2012-01-12 | N.V. Organon | Agonistic antibody to cd27 |
| WO2012022814A1 (en) | 2010-08-20 | 2012-02-23 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (her3) |
| WO2012027328A2 (en) | 2010-08-23 | 2012-03-01 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| US9006399B2 (en) | 2010-08-23 | 2015-04-14 | Board Of Regents, The University Of Texas System | Anti-OX40 antibodies and methods of using the same |
| US8507222B2 (en) | 2010-09-21 | 2013-08-13 | Altor Bioscience Corporation | Multimeric IL-15 soluble fusion molecules and methods of making and using same |
| WO2012040323A2 (en) | 2010-09-21 | 2012-03-29 | Altor Bioscien Corporation | Multimeric il-15 soluble fusion molecules and methods of making and using same |
| WO2012048165A2 (en) | 2010-10-06 | 2012-04-12 | President And Fellows Of Harvard College | Injectable, pore-forming hydrogels for materials-based cell therapies |
| WO2012149358A1 (en) | 2011-04-28 | 2012-11-01 | President And Fellows Of Harvard College | Injectable preformed macroscopic 3-dimensional scaffolds for minimally invasive administration |
| WO2012167143A1 (en) | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2012167230A1 (en) | 2011-06-03 | 2012-12-06 | President And Fellows Of Harvard College | In situ antigen-generating cancer vaccine |
| WO2012177624A2 (en) | 2011-06-21 | 2012-12-27 | The Johns Hopkins University | Focused radiation for augmenting immune-based therapies against neoplasms |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| WO2013054331A1 (en) | 2011-10-11 | 2013-04-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| US20140271618A1 (en) | 2011-10-11 | 2014-09-18 | Ramot At Tel-Aviv University Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013082366A1 (en) | 2011-12-01 | 2013-06-06 | The Brigham And Women's Hospital, Inc. | Anti-ceacam1 recombinant antibodies for cancer therapy |
| WO2013106852A1 (en) | 2012-01-13 | 2013-07-18 | President And Fellows Of Harvard College | Controlled delivery of tlr agonists in structural polymeric devices |
| WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
| WO2013124826A1 (en) | 2012-02-24 | 2013-08-29 | Novartis Ag | Oxazolidin- 2 -one compounds and uses thereof as pi3ks inhibitors |
| WO2013148228A1 (en) | 2012-03-29 | 2013-10-03 | Advanced Cancer Therapeutics, Llc | Pfkfb3 inhibitor and methods of use as an anti-cancer therapeutic |
| WO2013158673A1 (en) | 2012-04-16 | 2013-10-24 | President And Fellows Of Harvard College | Mesoporous silica compositions for modulating immune responses |
| US20150056225A1 (en) | 2012-04-17 | 2015-02-26 | University Of Washington Through Its Center For Commercialization | HLA Class II Deficient Cells, HLA Class I Deficient Cells Capable of Expressing HLA Class II Proteins, and Uses Thereof |
| WO2013171641A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171640A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171642A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013171639A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
| WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
| WO2014022332A1 (en) | 2012-07-31 | 2014-02-06 | The Brigham And Women's Hospital, Inc. | Modulation of the immune response |
| WO2014036412A2 (en) | 2012-08-30 | 2014-03-06 | Amgen Inc. | A method for treating melanoma using a herpes simplex virus and an immune checkpoint inhibitor |
| US20150290316A1 (en) * | 2012-10-02 | 2015-10-15 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
| WO2014066527A2 (en) | 2012-10-24 | 2014-05-01 | Admune Therapeutics Llc | Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes |
| WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
| WO2014081937A2 (en) | 2012-11-21 | 2014-05-30 | Duke University | Oncolytic poliovirus for human tumors |
| WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
| WO2014122613A1 (en) | 2013-02-08 | 2014-08-14 | Novartis Ag | Anti-il-17a antibodies and their use in treating autoimmune and inflammatory disorders |
| WO2014160160A2 (en) | 2013-03-13 | 2014-10-02 | Novartis Ag | Antibody drug conjugates |
| WO2014141104A1 (en) | 2013-03-14 | 2014-09-18 | Novartis Ag | 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh |
| WO2014151616A1 (en) | 2013-03-14 | 2014-09-25 | Novartis Ag | Biaryl amide compounds as kinase inhibitors |
| US20140271677A1 (en) | 2013-03-14 | 2014-09-18 | Memorial Sloan Kettering Cancer Center | Newcastle Disease Viruses and Uses Thereof |
| WO2014189805A1 (en) | 2013-05-18 | 2014-11-27 | Auro Biotech, Inc. | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
| US20150056224A1 (en) | 2013-05-18 | 2015-02-26 | Aduro Biotech, Inc. | Compositions and methods for activating stimulator of interferon gene-dependent signalling |
| WO2014189806A1 (en) | 2013-05-18 | 2014-11-27 | Aduro Biotech, Inc. | Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
| WO2015036499A1 (en) | 2013-09-11 | 2015-03-19 | Medimmune Limited | Anti-b7-h1 antibodies for treating tumors |
| WO2015066188A1 (en) | 2013-11-01 | 2015-05-07 | Novartis Ag | Aminoheteroaryl benzamides as kinase inhibitors |
| WO2015079417A1 (en) | 2013-11-29 | 2015-06-04 | Novartis Ag | Novel amino pyrimidine derivatives |
| WO2015091853A2 (en) | 2013-12-19 | 2015-06-25 | Alligator Bioscience Ab | Antibodies |
| WO2015112900A1 (en) * | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
| US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
| US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| US20160108123A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
Non-Patent Citations (286)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS, N.Y., pages: 6.3.1 - 6.3.6 |
| ACHYUT ET AL., GASTROENTEROLOGY, vol. 141, no. 4, 2011, pages 1167 - 78 |
| ADVANI ET AL., J CLIN ONCOL., vol. 27, no. 26, 2009, pages 4371 - 7 |
| AGATA ET AL., INT IMMUNOL., vol. 8, 1996, pages 765 - 72 |
| ALEMANY ET AL., NATURE BIOTECHNOL., vol. 18, 2000, pages 723 - 27 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ALSHAKER; MATALKA, CANCER CELL INT., 2011, pages 11 - 33 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| AMANN ET AL., J IMMUNOTHER, vol. 32, no. 5, 2009, pages 452 - 64 |
| ANDERSON ET AL., CANCER IMMUNOL RES., vol. 2, no. 5, 2014, pages 393 - 8 |
| APTE ET AL., ADV. EXP. MED. BIOL., 2000, pages 277 - 88 |
| APTE ET AL., CANCER METASTASIS REV., 2006, pages 387 - 408 |
| BALCH ET AL., J CLIN ONCOL., vol. 19, no. 16, 2001, pages 3622 - 34 |
| BARBAS ET AL., PNAS, vol. 88, 1991, pages 7978 - 7982 |
| BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060 |
| BENNETT ET AL., J. IMMUNOL., vol. 170, 2003, pages 711 - 8 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BIANCHINI ET AL., J CLIN ONCOL., vol. 28, no. 28, 2010, pages 4316 - 23 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 54, 2005, pages 307 - 314 |
| BLANK, C. ET AL., IMMUNOL. IMMUNOTHER., vol. 56, no. 5, 29 December 2006 (2006-12-29), pages 739 - 745 |
| BLOBE ET AL., N ENGL J MED., vol. 342, no. 18, 2000, pages 1350 - 8 |
| BONI ET AL., CANCER RES., vol. 70, no. 13, 2010, pages 5213 - 9 |
| BORGHAEI ET AL., N. ENGL. J. MED., 2015, pages 1627 - 39 |
| BOTTON ET AL., PIGMENT CELL MELANOMA RES., vol. 26, no. 6, 2013, pages 845 - 51 |
| BRAHMER ET AL., N. ENGL. J. MED., 2012, pages 123 - 35 |
| BRIAN D. LEHMANN ET AL.: "Identification of human triple-negative breast cancer subtypes and preclinical models for selection of targeted therapies", J CLIN INVEST., vol. 121, no. 7, 1 July 2011 (2011-07-01), pages 2750 - 2767, XP002690196, DOI: doi:10.1172/JCI45014 |
| BROWN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1257 - 66 |
| BRUGGEMAN ET AL., EUR J IMMUNOL, vol. 21, 1991, pages 1323 - 1326 |
| BRUGGEMAN ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 33 - 40 |
| BUTTE ET AL., IMMUNITY, vol. 27, no. 1, 2007, pages 111 - 22 |
| CALLAHAN ET AL., CANCER IMMUNOL RES., vol. 2, no. 1, 2014, pages 70 - 9 |
| CARNAHAN ET AL., MOL CANCER THER., vol. 9, no. 8, 2010, pages 2399 - 410 |
| CARTER ET AL., EUR. J. IMMUNOL., vol. 32, 2002, pages 634 - 43 |
| CHAPMAN ET AL., EXPERT OPIN INVESTIG DRUGS., vol. 20, no. 2, 2011, pages 209 - 20 |
| CHENG ET AL.: "Structure and Interactions of the Human Programmed Cell Death 1 Receptor", J. BIOL. CHEM., vol. 288, 2013, pages 11771 - 11785, XP055321065, DOI: doi:10.1074/jbc.M112.448126 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 227, 1992, pages 799 - 817 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOU ET AL., J IMMUNOL., vol. 189, no. 8, 2012, pages 3936 - 46 |
| CHUNG ET AL., NAT MED., vol. 19, no. 9, 2013, pages 1114 - 23 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| COFFELT ET AL., NATURE, 2015, pages 345 - 8 |
| COLCHER, D. ET AL., ANN N Y ACAD SCI, vol. 880, 1999, pages 263 - 80 |
| COLLINS, M. ET AL., GENOME BIOL., vol. 6, 2005, pages 223.1 - 223.7 |
| COOK, R., JMANAG CARE PHARM., vol. 14, no. 7, 2008, pages 19 - 25 |
| CORCORAN ET AL., SCI SIGNAL., vol. 3, no. 149, 2010 |
| COYLE, A. J. ET AL., NATURE IMMUNOL., vol. 2, no. 3, 2001, pages 203 - 209 |
| CURIEL ET AL., NAT MED., vol. 10, no. 9, 2004, pages 942 - 9 |
| DEMARIA ET AL., CLIN CANCER RES., vol. 7, no. 10, 2001, pages 3025 - 30 |
| DENARDO ET AL., CANCER DISCOV., vol. 1, 2011, pages 54 - 67 |
| DENKERT ET AL., J CLIN ONCOL., vol. 28, no. 1, 2010, pages 105 - 13 |
| DESAI ET AL., CLIN CANCER RES., vol. 12, no. 4, 2006, pages 1317 - 24 |
| DESMEDT ET AL., J CLIN ONCOL., vol. 34, no. 16, 2016, pages 1872 - 81 |
| DEVITA, V. ET AL.: "Cancer: Principles and Practice of Oncology. Fifth Edition", 1997, article RESTIFO, N.; SZNOL, M.: "Cancer Vaccines (ch. 61)", pages: 3023 - 3043 |
| DIECI ET AL., CANCER TREAT REV., vol. 46, 2016, pages 9 - 19 |
| DIENER ET AL., LAB INVEST., vol. 89, no. 2, 2009, pages 142 - 51 |
| DINARELLO, EUR. J. IMMUNOL., 2010, pages 599 - 606 |
| DOEDENS ET AL., CANCER RES, vol. 70, no. 19, 2010, pages 7465 - 75 |
| DONG ET AL., J MOL MED, vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., J. MOL. MED., vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., NAT MED, vol. 8, 2002, pages 787 - 9 |
| DONG ET AL., NAT MED., vol. 8, no. 8, 2002, pages 793 - 800 |
| DONG ET AL., NAT. MED., vol. 8, 2002, pages 787 - 9 |
| DONG, C. ET AL., IMMUNOLOG. RES., vol. 28, no. 1, 2003, pages 39 - 48 |
| DONKOR ET AL., IMMUNITY, vol. 35, no. 1, 2011, pages 123 - 34 |
| DOUGAN ET AL., J. EXP. MED., 2010, pages 2195 - 206 |
| DOWNWARD, NAT. REV. CANCER., 2003, pages 11 - 22 |
| DRANOFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 3539 - 43 |
| DUEBEL, S. AND KONTERMANN, R.: "Antibody Engineering Lab Manual", SPRINGER-VERLAG, HEIDELBERG, article "Protein Sequence and Structure Analysis of Antibody Variable Domains" |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| EMERY ET AL., PROC NATL ACAD SCI USA., vol. 106, no. 48, 2009, pages 20411 - 6 |
| ERRATUM, CLIN CANCER RES., vol. 12, no. 12, 2006, pages 3869 |
| ERRATUM, J CLIN ONCOL., vol. 28, no. 32, 2010, pages 4868 |
| ERRATUM, J CLIN ONCOL., vol. 29, no. 19, 2011, pages 2739 |
| ETON ET AL., J CLIN ONCOL., vol. 16, no. 3, 1998, pages 1103 - 11 |
| FERRI FF: "Ferri's Clinical Advisor", 2014, PHILADELPHIA: PA: ELSEVIER MOSBY |
| FINGER LR ET AL., GENE, vol. 197, no. 1-2, 1997, pages 177 - 87 |
| FLAHERTY ET AL., CURR OPIN ONCOL., vol. 22, no. 3, 2010, pages 178 - 83 |
| FOON, K.: "DEVELOPMENT OF CANCER VACCINES", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 730 - 738 |
| FOULKES ET AL., N. ENGL. J. MED., 2010, pages 1938 - 48 |
| FREDERICK ET AL., CLIN CANCER RES., vol. 19, no. 5, 2013, pages 1225 - 31 |
| FREEMAN ET AL., J. EXP. MED., vol. 192, 2000, pages 1027 - 34 |
| FRIDMAN ET AL., CANCER RES., 2011, pages 5601 - 5 |
| FUCHS ET AL., BIOLTECHNOLOGY, vol. 9, 1991, pages 1370 - 1372 |
| GARCFA-TEIJIDO ET AL., CLIN MED INSIGHTS ONCOL., vol. 10, no. 1, 2016, pages 31 - 9 |
| GARRAD ET AL., BIOLTECHNOLOGY, vol. 9, 1991, pages 1373 - 1377 |
| GETTINGER; HERBST, CANCER J., 2014, pages 281 - 9 |
| GHEBEH ET AL., NEOPLASIA, vol. 8, no. 3, 2006, pages 190 - 8 |
| GIANNI ET AL., J CLIN ONCOL., vol. 13, no. 1, 1995, pages 180 - 90 |
| GRADISHAR ET AL., CLIN BREAST CANCER, vol. 12, no. 5, 2012, pages 313 - 21 |
| GRADISHAR ET AL., J CLIN ONCOL., vol. 23, no. 31, 2005, pages 7794 - 803 |
| GRADISHAR ET AL., J CLIN ONCOL., vol. 27, no. 22, 2009, pages 3611 - 9 |
| GRAM ET AL., PNAS, vol. 89, 1992, pages 3576 - 3580 |
| GREEN, L.L. ET AL., NATURE GENET., vol. 7, 1994, pages 13 - 21 |
| GREENBERG ET AL., J NATL COMPR CANE NETW., vol. 11, no. 7, 2013, pages 838 - 74 |
| GREENWALD, R. J. ET AL., ANN. REV. IMMUNOL., vol. 23, 2005, pages 515 - 548 |
| GRIFFTHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GRIVENNIKOV ET AL., NATURE, vol. 491, no. 7423, 2012, pages 254 - 8 |
| GROSS, J. ET AL., J. IMMUNOL., vol. 149, 1992, pages 380 - 388 |
| GYRD-HANSEN M, MEIER P, NAT. REV. CANCER, 2010, pages 561 - 74 |
| GYRD-HANSEN M; MEIER P, NAT. REV. CANCER, 2010, pages 561 - 74 |
| HAHNE, M. ET AL., SCIENCE, vol. 274, 1996, pages 1363 - 1365 |
| HALLETT, WHD ET AL., J OF AMERICAN SOCIETY FOR BLOOD AND MARROW TRANSPLANTATION, vol. 17, no. 8, 2011, pages 1133 - 145 |
| HAMID, O. ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 369, no. 2, 2013, pages 134 - 44 |
| HAWKINS ET AL., JMOL BIOL, vol. 226, 1992, pages 889 - 896 |
| HAY ET AL., HUM ANTIBODY HYBRIDOMAS, vol. 3, 1992, pages 81 - 85 |
| HERBST ET AL., LANCET, vol. 387, no. 10027, 2016, pages 1540 - 50 |
| HERBST ET AL., NATURE, 2014, pages 563 - 7 |
| HODGE ET AL., INT J CANCER., vol. 133, no. 3, 2013, pages 624 - 36 |
| HOLLIGER, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL., NUC ACID RES, vol. 19, 1991, pages 4133 - 4137 |
| HOWARD, M.; O'GARRA, A., IMMUNOLOGY TODAY, vol. 13, 1992, pages 198 - 200 |
| HUDES, G. ET AL., N. ENGL. J. MED., vol. 356, no. 22, 2007, pages 2271 - 2281 |
| HUGO ET AL., CELL, vol. 165, no. 1, 2016, pages 35 - 44 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUTCHINSON ET AL., CLIN CANCER RES., vol. 19, no. 24, 2013, pages 6696 - 702 |
| HUTLOFF, A. ET AL., NATURE, vol. 397, 1999, pages 262 - 266 |
| IBRAHIM ET AL., CLIN CANCER RES., vol. 8, no. 5, 2002, pages 1038 - 44 |
| INFANTE ET AL., J. CLIN. ONCOL., 2014, pages 3103 - 10 |
| INFANTE ET AL., LANCET ONCOL., 2012, pages 773 - 81 |
| INGLEFIELD ET AL., J INTERFERON CYTOKINE RES., vol. 28, no. 4, 2008, pages 253 - 63 |
| ISAILOVIC ET AL., J. AUTOIMMUN., 2015, pages 1 - 11 |
| ISHIDA, Y. ET AL., EMBO J., vol. 11, 1992, pages 3887 - 3895 |
| ITO, N. ET AL., IMMUNOBIOLOGY, vol. 201, no. 5, 2000, pages 527 - 40 |
| IWAI ET AL., INT. IMMUNOL., vol. 17, 2005, pages 133 - 144 |
| IWAI ET AL., PNAS, vol. 99, 2002, pages 12293 - 7 |
| IWAI ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 12293 - 7 |
| J CLIN ONCOL., vol. 30, no. 6, 2012, pages 679 |
| J. R. ROBINSON, ANNALS OF ONCOLOGY, vol. 26, no. SUPPL., - 2015, pages 6 - 9 |
| J. R. ROBINSON: "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC., NEW YORK |
| JONES ET AL., NATURE, vol. 321, 1986, pages 552 - 525 |
| JUERGENS ET AL., CANCER DISCOV., 2011, pages 598 - 607 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH, BETHESDA, MD |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES |
| KAKAVAND ET AL., CLIN CANCER RES., vol. 21, no. 14, 2015, pages 3140 - 8 |
| KEHRL, J. ET AL., J. EXP. MED., vol. 163, 1986, pages 1037 - 1050 |
| KEIR ET AL., ANNU. REV. IMMUNOL., vol. 26, 2008, pages 677 - 704 |
| KHAYAT, D.: "DEVELOPMENT OF CANCER VACCINES", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 414 - 428 |
| KHUBCHANDANI ET AL., CURR OPIN INVESTIG DRUGS., vol. 10, no. 6, 2009, pages 579 - 87 |
| KIKUSHIGE ET AL., CELL STEM CELL, vol. 7, no. 6, 2010, pages 708 - 17 |
| KIM ET AL., PROC. NATL. ACAD. SCI. U.S.A., 2014, pages 11774 - 9 |
| KIM, N ET AL., SCIENCE, vol. 266, 1994, pages 2011 - 2013 |
| KNIGHTS ET AL., CANCER IMMUNOL. IMMUNOTHER, 2013, pages 321 - 35 |
| KNIGHTS ET AL., CANCER IMMUNOL. IMMUNOTHER., 2013, pages 321 - 35 |
| KONISHI ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 5094 - 100 |
| KONO ET AL., MOL CANCER RES., vol. 4, no. 10, 2006, pages 779 - 92 |
| KORMAN, A. J. ET AL., ADV. IMMUNOL., vol. 90, 2007, pages 297 - 339 |
| KROEMER ET AL., ONCOLMMUNOLOGY, vol. 4, no. 7, 2015, pages E1058597 - 1,3 |
| KRYCZEK ET AL., J EXP MED, vol. 203, no. 4, 2006, pages 871 - 81 |
| KUANG ET AL., J EXP MED, vol. 206, no. 6, 2009, pages 1327 - 37 |
| KUGLER, A. ET AL., NATURE MEDICINE, vol. 6, 2000, pages 332 - 336 |
| LAGES ET AL., AGING CELL, vol. 9, 2010, pages 785 - 798 |
| LEPENIES, B. ET AL., ENDOCRINE, METABOLIC & IMMUNE DISORDERS--DRUG TARGETS, vol. 8, 2008, pages 279 - 288 |
| LEWITT ET AL., ANNALS OF NEUROLOGY, vol. 63, no. 3, - 2008, pages 295 - 302 |
| LINDLEY, P. S. ET AL., IMMUNOL. REV., vol. 229, 2009, pages 307 - 321 |
| LINSLEY, P. ET AL., IMMUNITY, vol. 4, 1996, pages 535 - 543 |
| LIU ET AL., CANCER RES., vol. 21, no. 7, 2015, pages 1639 - 51 |
| LIU ET AL., CLIN CANCER RES., vol. 21, no. 7, 1 December 2014 (2014-12-01), pages 1639 - 51 |
| LIU ET AL., CLIN. CANCER RES., 2014, pages 462 - 8 |
| LIU ET AL., CLIN. CANCER RES., 2015, pages 1639 - 51 |
| LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526 |
| LIU ET AL., PNAS, vol. 84, 1987, pages 3439 - 3443 |
| LOBUGLIO ET AL., HYBRIDOMA, vol. 5, 1986, pages 5117 - 5123 |
| LOGOTHETIS, C.: "DEVELOPMENT OF CANCER VACCINES", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 300 - 302 |
| LOI ET AL., ONCOIMMUNOLOGY, vol. 2, no. 7, 2013, pages E24720 |
| LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LUBBERT ET AL., J CLIN ONCOL., vol. 29, no. 15, 2011, pages 1987 - 96 |
| MALIK; CASHEN, CANCER MANAG RES., vol. 6, 2014, pages 53 - 61 |
| MANNICK ET AL., SCI. TRANSL. MED., vol. 6, no. 268, 2014, pages 268RA179 |
| MANNICK ET AL., SCI. TRANSL. MED., vol. 6, no. 268, 2014, pages 268RAL79 |
| MAO ET AL., CLIN CANCER RES., 8 March 2016 (2016-03-08) |
| MARKEL ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 59, no. 2, February 2010 (2010-02-01), pages 215 - 30 |
| MARKEL ET AL., IMMUNOLOGY, vol. 126, no. 2, February 2009 (2009-02-01), pages 186 - 200 |
| MARKEL ET AL., J IMMUNOL., vol. 168, no. 6, 15 March 2002 (2002-03-15), pages 2803 - 10 |
| MARKEL ET AL., J IMMUNOL., vol. 177, no. 9, 1 November 2006 (2006-11-01), pages 6062 - 71 |
| MARONE R; CMILJANOVIC V; GIESE B; WYMANN MP: "Targeting phosphoinositide 3-kinase: moving towards therapy", BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1784, no. 1, January 2008 (2008-01-01), pages 159 - 85, XP022425232, DOI: doi:10.1016/j.bbapap.2007.10.003 |
| MELERO, I. ET AL., NATURE MEDICINE, vol. 3, 1997, pages 682 - 685 |
| MILLER ET AL., BMC PHARMACOLOGY AND TOXICOLOGY, vol. 16, 2015, pages 18 |
| MILLER ET AL., EUR J DRUG METAB PHARMACOKINET, vol. 39, 2014, pages 173 - 181 |
| MILLER ET AL., J. IMMUNOL., 2007, pages 6933 - 42 |
| MIOSSEC; KOLLS, NAT. REV. DRUG DISCOV., 2012, pages 763 - 76 |
| MITCHEM ET AL., CANCER RES, vol. 73, no. 3, 2013, pages 1128 - 41 |
| MITTENDORF ET AL., CANCER IMMUNOL RES., vol. 2, no. 4, 2014, pages 361 - 70 |
| MOKYR, M. ET AL., CANCER RESEARCH, vol. 58, 1998, pages 5301 - 5304 |
| MORRISON, S. L., SCIENCE, vol. 229, 1985, pages 1202 - 1207 |
| MORRISON, S.L. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1994, pages 6851 - 6855 |
| MOTZER, R.J. ET AL., LANCET, vol. 372, 2008, pages 449 - 456 |
| MOVAHEDI ET AL., CANCER RES, vol. 70, no. 14, 2010, pages 5728 - 39 |
| MURDOCH ET AL., NAT REV CANCER, vol. 8, no. 8, 2008, pages 618 - 31 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NESTLE, F. ET AL., NATURE MEDICINE, vol. 4, 1998, pages 328 - 332 |
| NGIOW ET AL., CANCER RES., vol. 71, no. 10, 2011, pages 3540 - 51 |
| NING ET AL., MOL CANCER THER., vol. 11, no. 6, 2012, pages 1353 - 64 |
| NISHIMURA ET AL., CANC. RES., vol. 47, 1987, pages 999 - 1005 |
| NOY; POLLARD, IMMUNITY, vol. 41, no. 1, 2014, pages 49 - 61 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| OKAZAKI ET AL., CURR OPIN IMMUNOL, vol. 14, 2002, pages 391779 - 82 |
| OKEN ET AL., AM J CLIN ONCOL., vol. 5, 1982, pages 649 - 655 |
| ORTENBERG ET AL., MOL CANCER THER., vol. L 1, no. 6, June 2012 (2012-06-01), pages 1300 - 10 |
| PAL. S.K. ET AL., CLIN. ADVANCES IN HEMATOLOGY & ONCOLOGY, vol. 12, no. 2, 2014, pages 90 - 99 |
| PARDOLL ET AL., NAT REV CANCER, vol. 12, no. 4, 2012, pages 252 - 64 |
| PATNAIK ET AL., CLIN CANCER RES., vol. 21, no. 19, 2015, pages 4286 - 93 |
| PERKINS, NAT. REV. CANCER, 2012, pages 121 - 32 |
| PFANNENSTIEL ET AL., CELL IMMUNOL, vol. 263, no. 1, 2010, pages 79 - 87 |
| POLJAK, STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| POPKOV ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 288, 2004, pages 149 - 164 |
| POWLES ET AL., NATURE, 2014, pages 558 - 62 |
| PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599 |
| PYONTECH ET AL., NAT MED, vol. 19, no. 10, 2013, pages 1264 - 72 |
| PYONTECK ET AL., NAT MED, vol. 19, no. 10, 2013, pages 1264 - 72 |
| REITER, Y., CLIN CANCER RES, vol. 2, 1996, pages 245 - 52 |
| RIDGE, J. ET AL., NATURE, vol. 393, 1998, pages 474 - 478 |
| RIELLA ET AL., AM J TRANSPLANT, vol. 12, no. 10, 2012, pages 2575 - 87 |
| RIES ET AL., CANCER CELL, vol. 25, no. 6, 2014, pages 846 - 59 |
| RINI, B.I. ET AL., J. CLIN. ONCOL., vol. 28, no. 13, 2010, pages 2137 - 2143 |
| ROBERT ET AL., CURR OPIN ONCOL., vol. 23, no. 2, 2011, pages 177 - 82 |
| ROSENBERG, S.: "Development of Cancer Vaccines", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 60 - 62 |
| RUFFELL ET AL., CANCER CELL, vol. 26, 2014, pages 623 - 637 |
| RUFFELL ET AL., PROC NATL ACAD SCI U S A., vol. 109, no. 8, 2012, pages 2796 - 801 |
| RUFFELL ET AL., TRENDS IMMUNOL, vol. 33, no. 3, 2012, pages 119 - 26 |
| SAGIV-BARFI ET AL., BLOOD, 2015, pages 2079 - 86 |
| SAKUISHI ET AL., J EXP MED., vol. 207, no. 10, 2010, pages 2187 - 94 |
| SALEH ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 32, 1990, pages 180 - 190 |
| SALGADO ET AL., JAMA ONCOL., vol. 1, no. 4, 2015, pages 448 - 54 |
| SANDHAM ET AL., BIOORG MED CHEM., vol. 21, no. 21, 2013, pages 6582 - 91 |
| SATO ET AL., PROC NATL ACAD SCI U S A., vol. 102, no. 51, 2005, pages 18538 - 43 |
| SCHILLING ET AL., ANN ONCOL., vol. 25, no. 3, 2014, pages 747 - 53 |
| SCHWARTZBERG ET AL., NAT. REV. IMMUNOL., 2005, pages 284 - 95 |
| SHARPE, A. H. ET AL., NATURE REV. IMMUNOL., vol. 2, 2002, pages 116 - 126 |
| SHAW ET AL., J. NATL CANCER INST., vol. 80, 1988, pages 1553 - 1559 |
| SHINOHARA T ET AL., GENOMICS, vol. 23, no. 3, 1994, pages 704 - 6 |
| SIROTT ET AL., CANCER, vol. 72, no. 10, 1993, pages 3091 - 8 |
| SPARREBOOM ET AL., CANCER RES., vol. 59, no. 7, 1999, pages 1454 - 7 |
| STEIN RC: "Prospects for phosphoinositide 3-kinase inhibition as a cancer treatment", ENDOCRINE-RELATED CANCER, vol. 8, no. 3, September 2001 (2001-09-01), pages 237 - 48, XP002964533, DOI: doi:10.1677/erc.0.0080237 |
| STERN ET AL., J IMMUNOL., vol. 174, no. 11, 1 June 2005 (2005-06-01), pages 6692 - 701 |
| SUMIMOTO ET AL., J EXP MED., vol. 203, no. 7, 2006, pages 1651 - 6 |
| SUN ET AL., PNAS, vol. 84, 1987, pages 214 - 218 |
| SUOT, R; SRIVASTAVA, P, SCIENCE, vol. 269, 1995, pages 1585 - 1588 |
| SYKES ET AL., EUROPEAN RESPIRATORY JOURNAL, vol. 44, no. 58, 1 September 2014 (2014-09-01), pages 4074 |
| TAI ET AL., CANCER RES., vol. 65, no. 13, 2005, pages 5898 - 906 |
| TAMURA, Y. ET AL., SCIENCE, vol. 278, 1997, pages 117 - 120 |
| TANAKA, J. CLIN. ONCOL., 2008, pages 1596 - 602 |
| TAUBE ET AL., SCI TRANSL MED., vol. 4, no. 127, 2012, pages 127RA37 |
| TEN TIJE ET AL., CLIN PHARMACOKINET., vol. 42, no. 7, 2003, pages 665 - 85 |
| TIAN ET AL., CELL SIGNAL, vol. 23, no. 6, 2011, pages 951 - 62 |
| TOMLINSON ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TOPALIAN ET AL., N. ENGL. J. MED., 2012, pages 2443 - 54 |
| TRUTY; URRUTIA, PANCREATOLOGY, vol. 7, no. 5-6, 2007, pages 423 - 35 |
| TUAILLON ET AL., PNAS, vol. 90, 1993, pages 3720 - 3724 |
| TUMEH ET AL., NATURE, 2014, pages 568 - 71 |
| VAN TELLINGEN ET AL., BR J CANCER, vol. 81, no. 2, 1999, pages 330 - 5 |
| VELLA ET AL., CANCER IMMUNOL RES., vol. 2, no. 4, 2014, pages 351 - 60 |
| VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VIGLIETTA, V. ET AL., NEURO THERAPEUTICS, vol. 4, 2007, pages 666 - 675 |
| VITALE ET AL., CLIN CANCER RES., vol. 18, no. 14, 2012, pages 3812 - 21 |
| VORONOV ET AL., FRONT PHYSIOL., 2014, pages 114 |
| VORONOV ET AL., PROC. NATL. ACAD. SCI. U.S.A., 2003, pages 2645 - 50 |
| WAKEFIELD; HILL, NAT REV CANCER, vol. 13, no. 5, 2013, pages 328 - 41 |
| WANG ET AL., ANN ONCOL., vol. 26, no. 3, 2015, pages 523 - 8 |
| WANG, L. ET AL., J. EXP. MED., vol. 208, no. 3, 7 March 2011 (2011-03-07), pages 577 - 92 |
| WEINBERG, A. ET AL., IMMUNOL, vol. 164, 2000, pages 2160 - 2169 |
| WILMOTT ET AL., CLIN CANCER RES., vol. 18, no. 5, 2012, pages 1386 - 94 |
| WINNAKER: "From Genes to Clones", 1987, VERLAGSGESELLSCHAFT, WEINHEIM, GERMANY |
| WITOWSKI ET AL., CELL MOL. LIFE SCI., 2004, pages 567 - 79 |
| WOJTOWICZ-PRAGA, INVEST NEW DRUGS, vol. 21, no. 1, 2003, pages 21 - 32 |
| WOO ET AL., CANCER RES., vol. 72, no. 4, 2012, pages 917 - 27 |
| WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449 |
| WOODS ET AL., CANCER IMMUNOL. RES., 2015, pages 1375 - 85 |
| WU ET AL., JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 6, 2013, pages 36 |
| YAMAZAKI ET AL., J IMMUNOL., vol. 169, no. 10, 2002, pages 5538 - 45 |
| YANG ET AL., MEDIATORS INFLAMM., 2014 |
| YANG ET AL., TRENDS IMMUNOL., vol. 31, no. 6, 2010, pages 220 - 7 |
| YATIM ET AL., SCIENCE, 2015, pages 328 - 34 |
| YI, Q., CANCER J., vol. 15, no. 6, 2009, pages 502 - 10 |
| ZAMARIN ET AL., FUTURE MICROBIOL. 7.3, 2012, pages 347 - 67 |
| ZARBOCK ET AL., BRITISH JOURNAL OF PHARMACOLOGY, 2008, pages 1 - 8 |
| ZELENAY ET AL., TRENDS IMMUNOL, vol. 34, no. 7, 2013, pages 329 - 35 |
| ZENG ET AL., INT. J. CLIN. EXP. MED., 2015, pages 10515 - 36 |
| ZHANG ET AL., N ENGL J MED., vol. 348, no. 3, 2003, pages 203 - 13 |
| ZHANG: "IASLC | International Association for the Study of Lung Cancer", 9 August 2015 (2015-08-09), XP055356821, Retrieved from the Internet <URL:https://library.iaslc.org/search-speaker?search_speaker=30076> [retrieved on 20170321] * |
| ZHENG ET AL., PLOS ONE., vol. 5, no. 9, 2 September 2010 (2010-09-02), pages E12529 |
| ZHU ET AL., J IMMUNOL., vol. 183, 2009, pages 3598 |
| ZOU; RESTIFO, NAT REV IMMUNOL., vol. 10, no. 4, 2010, pages 248 - 56 |
| ZOU; RESTIFO, NAT. REV. IMMUNOL., 2010, pages 246 - 56 |
Cited By (108)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| US11708412B2 (en) | 2013-09-26 | 2023-07-25 | Novartis Ag | Methods for treating hematologic cancers |
| US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
| US10752687B2 (en) | 2014-01-24 | 2020-08-25 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US11827704B2 (en) | 2014-01-24 | 2023-11-28 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US11155620B2 (en) | 2014-01-31 | 2021-10-26 | Novartis Ag | Method of detecting TIM-3 using antibody molecules to TIM-3 |
| US10981990B2 (en) | 2014-01-31 | 2021-04-20 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US10472419B2 (en) | 2014-01-31 | 2019-11-12 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US9884913B2 (en) | 2014-01-31 | 2018-02-06 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US10711060B2 (en) | 2014-03-14 | 2020-07-14 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US9908936B2 (en) | 2014-03-14 | 2018-03-06 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| US10851165B2 (en) | 2014-10-14 | 2020-12-01 | Novartis Ag | Antibody molecules to PD-L1 and methods of treating cancer |
| US9988452B2 (en) | 2014-10-14 | 2018-06-05 | Novartis Ag | Antibody molecules to PD-L1 and uses thereof |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| US10813958B2 (en) * | 2015-07-20 | 2020-10-27 | Virttu Biologics Limited | Use of oncolytic herpes simplex virus, alone or in combination with immune check-point inhibitor, in the treatment of cancer |
| US12600777B2 (en) | 2015-07-29 | 2026-04-14 | Novartis Ag | Combination therapies comprising antibody molecules to LAG-3 |
| US20180177872A1 (en) * | 2015-07-29 | 2018-06-28 | Yong Jia | Combination of PD-1 antagonist with an EGFR inhibitor |
| US11168136B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US11168135B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US12351630B2 (en) | 2015-11-18 | 2025-07-08 | Merck Sharp & Dohme Llc | PD1 and/or LAG3 binders |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US20210121563A1 (en) * | 2015-12-17 | 2021-04-29 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| US20200261573A1 (en) * | 2015-12-17 | 2020-08-20 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| EP3419643A4 (en) * | 2016-02-24 | 2020-04-01 | Children's Hospital of Eastern Ontario Research Institute Inc. | SMC-BASED ANTI-CANCER THERAPY |
| US10385131B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US12122833B2 (en) | 2016-05-11 | 2024-10-22 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US11535670B2 (en) | 2016-05-11 | 2022-12-27 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US10287353B2 (en) | 2016-05-11 | 2019-05-14 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US10385130B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US11547761B1 (en) | 2016-07-07 | 2023-01-10 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| US10675358B2 (en) | 2016-07-07 | 2020-06-09 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| US11110178B2 (en) | 2016-07-07 | 2021-09-07 | The Board Of Trustees Of The Leland Standford Junior University | Antibody adjuvant conjugates |
| US11459394B2 (en) | 2017-02-24 | 2022-10-04 | Macrogenics, Inc. | Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof |
| EP4389226A2 (en) | 2017-02-24 | 2024-06-26 | MacroGenics, Inc. | Bispecific binding molecules that are capable of binding cd137 and tumor antigens, and uses thereof |
| US11942149B2 (en) | 2017-02-24 | 2024-03-26 | Macrogenics, Inc. | Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof |
| WO2019018730A1 (en) * | 2017-07-20 | 2019-01-24 | Novartis Ag | DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF |
| CN111163798A (zh) * | 2017-07-20 | 2020-05-15 | 诺华股份有限公司 | 用于抗lag-3抗体的给药方案及其用途 |
| WO2019018640A1 (en) * | 2017-07-21 | 2019-01-24 | Novartis Ag | POSOLOGICAL REGIMES FOR ANTI-GITREN ANTIBODIES AND USES THEREOF |
| US11312772B2 (en) | 2017-08-04 | 2022-04-26 | Merck Sharp & Dohme Corp. | Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment |
| US11285131B2 (en) | 2017-08-04 | 2022-03-29 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene STING agonists for cancer treatment |
| WO2019027857A1 (en) * | 2017-08-04 | 2019-02-07 | Merck Sharp & Dohme Corp. | COMBINATIONS OF PD-1 ANTAGONISTS AND STING BENZO [B] THIOPHENIC AGONISTS FOR THE TREATMENT OF CANCER |
| US12570751B2 (en) | 2017-08-04 | 2026-03-10 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| US11859003B2 (en) | 2017-08-21 | 2024-01-02 | Adagene Inc. | Method for treating cancer using anti-CD137 antibody |
| US12378319B2 (en) | 2017-08-21 | 2025-08-05 | Adagene Inc. | Anti-CD137 molecules and use thereof |
| US11242395B2 (en) | 2017-08-21 | 2022-02-08 | Adagene Inc. | Anti-CD137 molecules and use thereof |
| US11814431B2 (en) | 2017-08-25 | 2023-11-14 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods of use thereof |
| US11306144B2 (en) | 2017-08-25 | 2022-04-19 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods of use thereof |
| CN111344014A (zh) * | 2017-12-01 | 2020-06-26 | 天演药业公司 | 使用cd137配体作为抗cd137抗体治疗的生物标志物的方法 |
| WO2019105468A1 (en) * | 2017-12-01 | 2019-06-06 | Adagene Inc. | Methods for using cd137 ligand as a biomarker for treatment with anti-cd137 antibody |
| US20210093645A1 (en) * | 2017-12-21 | 2021-04-01 | Debiopharm International S.A. | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| WO2019139581A1 (en) * | 2018-01-10 | 2019-07-18 | Lee Patrice A | Methods and combination therapy to treat cancer |
| US12398209B2 (en) | 2018-01-22 | 2025-08-26 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-PD-1 antibodies |
| US11952681B2 (en) | 2018-02-02 | 2024-04-09 | Adagene Inc. | Masked activatable CD137 antibodies |
| EP3752180A4 (en) * | 2018-02-13 | 2021-12-15 | Merck Sharp & Dohme Corp. | METHOD OF TREATMENT OF CANCER WITH ANTI-PD-1 ANTIBODIES |
| EP3752193A4 (en) * | 2018-02-13 | 2022-02-23 | Merck Sharp & Dohme Corp. | METHODS OF TREATMENT OF CANCER WITH ANTI-PD-1 ANTIBODIES AND ANTI-CTLA4 ANTIBODIES |
| US12358984B2 (en) | 2018-02-13 | 2025-07-15 | Merck Sharp & Dohme Llc | Methods for treating cancer with anti-PD-1 antibodies |
| EP3752180A2 (en) | 2018-02-13 | 2020-12-23 | Merck Sharp&Dohme Corp. | Methods for treating cancer with anti-pd-1 antibodies |
| AU2019220495B2 (en) * | 2018-02-13 | 2025-11-13 | Merck Sharp & Dohme Llc | Methods for treating cancer with anti-PD-1 antibodies |
| US12435145B2 (en) | 2018-02-21 | 2025-10-07 | Five Prime Therapeutics, Inc. | B7-H4 antibody formulations |
| US11939383B2 (en) | 2018-03-02 | 2024-03-26 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods and use thereof |
| CN111868088A (zh) * | 2018-03-20 | 2020-10-30 | 诺华股份有限公司 | 药物组合 |
| US12246025B2 (en) | 2018-03-21 | 2025-03-11 | Genmab A/S | Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate |
| CN112118853A (zh) * | 2018-04-02 | 2020-12-22 | 杜克大学 | 新辅助癌症疗法 |
| WO2019195658A1 (en) * | 2018-04-05 | 2019-10-10 | Dana-Farber Cancer Institute, Inc. | Sting levels as a biomarker for cancer immunotherapy |
| US11874276B2 (en) | 2018-04-05 | 2024-01-16 | Dana-Farber Cancer Institute, Inc. | STING levels as a biomarker for cancer immunotherapy |
| US12324841B2 (en) | 2018-05-07 | 2025-06-10 | Genmab A/S | Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate |
| WO2019217457A1 (en) | 2018-05-07 | 2019-11-14 | Genmab A/S | Methods of treating cancer with a combination of an anti-pd-1 antibody and an anti-tissue factor antibody-drug conjugate |
| AU2019270277B2 (en) * | 2018-05-15 | 2024-11-21 | Innate Pharma | Treatment of cancer |
| CN112203691A (zh) * | 2018-05-15 | 2021-01-08 | 免疫医疗有限公司 | 癌症的治疗 |
| IL278618B1 (en) * | 2018-05-15 | 2025-07-01 | Medimmune Ltd | Cancer treatment |
| US12209126B2 (en) | 2018-05-15 | 2025-01-28 | Medimmune Limited | Treatment of cancer |
| WO2019219658A1 (en) * | 2018-05-15 | 2019-11-21 | Medimmune Limited | Treatment of cancer |
| JP7531404B2 (ja) | 2018-05-15 | 2024-08-09 | メディミューン リミテッド | 癌の処置 |
| KR20210010486A (ko) * | 2018-05-15 | 2021-01-27 | 메디뮨 리미티드 | 암의 치료 |
| IL278618B2 (en) * | 2018-05-15 | 2025-11-01 | Medimmune Ltd | Treatment of cancer |
| KR102885515B1 (ko) * | 2018-05-15 | 2025-11-12 | 메디뮨 리미티드 | 암의 치료 |
| JP2021523170A (ja) * | 2018-05-15 | 2021-09-02 | メディミューン リミテッド | 癌の処置 |
| JP2024102055A (ja) * | 2018-05-15 | 2024-07-30 | メディミューン リミテッド | 癌の処置 |
| US12448448B2 (en) | 2018-06-20 | 2025-10-21 | Incyte Corporation | Anti-PD-1 antibodies and uses thereof |
| RU2825835C2 (ru) * | 2018-10-03 | 2024-09-02 | МЕРК ШАРП И ДОУМ ЭлЭлСи | Способы лечения рака с помощью анти-PD-1-антител и анти-CTLA4-антител |
| EP3867274A1 (en) * | 2018-10-15 | 2021-08-25 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| WO2020081497A1 (en) * | 2018-10-15 | 2020-04-23 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| US12453781B2 (en) | 2018-10-30 | 2025-10-28 | Genmab A/S | Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate |
| KR102929153B1 (ko) | 2018-11-13 | 2026-02-23 | 콤파스 테라퓨틱스 엘엘씨 | 체크포인트 분자에 대한 다중특이적 결합 작제물 및 이의 용도 |
| TWI840442B (zh) * | 2018-11-13 | 2024-05-01 | 美商坎伯斯治療有限責任公司 | 對抗檢查點分子之多特異性結合構築體及其用途 |
| WO2020102387A1 (en) * | 2018-11-13 | 2020-05-22 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
| TWI903448B (zh) * | 2018-11-13 | 2025-11-01 | 美商坎伯斯治療有限責任公司 | 對抗檢查點分子之多特異性結合構築體及其用途 |
| US12503511B2 (en) | 2018-11-13 | 2025-12-23 | Compass Therapeutics, LLC | Multispecific binding constructs against checkpoint molecules and uses thereof |
| US11970538B2 (en) | 2018-11-13 | 2024-04-30 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
| JP2022516850A (ja) * | 2018-12-21 | 2022-03-03 | ノバルティス アーゲー | 骨髄異形成症候群の治療又は予防におけるIL-1β抗体の使用 |
| WO2020128636A1 (en) * | 2018-12-21 | 2020-06-25 | Novartis Ag | Use of il-1 beta antibodies in the treatment or prevention of myelodysplastic syndrome |
| US11400164B2 (en) | 2019-03-15 | 2022-08-02 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting HER2 |
| WO2021006199A1 (ja) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Pd-1/cd3二重特異性タンパク質による血液がん治療 |
| WO2021025140A1 (ja) | 2019-08-08 | 2021-02-11 | 小野薬品工業株式会社 | 二重特異性タンパク質 |
| WO2021262969A1 (en) * | 2020-06-24 | 2021-12-30 | The General Hospital Corporation | Materials and methods of treating cancer |
| WO2022108931A2 (en) | 2020-11-17 | 2022-05-27 | Seagen Inc. | Methods of treating cancer with a combination of tucatinib and an anti-pd-1/anti-pd-l1 antibody |
| WO2022105817A1 (en) * | 2020-11-18 | 2022-05-27 | Suzhou Transcenta Therapeutics Co., Ltd. | Bi-functional molecules |
| WO2023285552A1 (en) | 2021-07-13 | 2023-01-19 | BioNTech SE | Multispecific binding agents against cd40 and cd137 in combination therapy for cancer |
| WO2023057534A1 (en) | 2021-10-06 | 2023-04-13 | Genmab A/S | Multispecific binding agents against pd-l1 and cd137 in combination |
| WO2023083868A1 (en) | 2021-11-09 | 2023-05-19 | BioNTech SE | Tlr7 agonist and combinations for cancer treatment |
| WO2023083439A1 (en) | 2021-11-09 | 2023-05-19 | BioNTech SE | Tlr7 agonist and combinations for cancer treatment |
| WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
| WO2024115725A1 (en) | 2022-12-01 | 2024-06-06 | BioNTech SE | Multispecific antibody against cd40 and cd137 in combination therapy with anti-pd1 ab and chemotherapy |
| WO2024209072A1 (en) | 2023-04-06 | 2024-10-10 | Genmab A/S | Multispecific binding agents against pd-l1 and cd137 for treating cancer |
| US12410258B2 (en) | 2023-05-12 | 2025-09-09 | Ganmab A/S | Antibodies capable of binding to OX40, variants thereof and uses thereof |
| WO2025114541A1 (en) | 2023-11-30 | 2025-06-05 | Genmab A/S | Antibodies capable of binding to ox40 in combination therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2018007423A (es) | 2018-11-09 |
| AU2016369537B2 (en) | 2024-03-14 |
| RU2018125773A3 (https=) | 2020-05-15 |
| JP2024174916A (ja) | 2024-12-17 |
| JP2019503349A (ja) | 2019-02-07 |
| WO2017106656A8 (en) | 2018-06-28 |
| JP2020143149A (ja) | 2020-09-10 |
| IL259987A (en) | 2018-07-31 |
| ES2986067T3 (es) | 2024-11-08 |
| KR20180088907A (ko) | 2018-08-07 |
| EP3389712A1 (en) | 2018-10-24 |
| KR102833068B1 (ko) | 2025-07-14 |
| EP3389712B1 (en) | 2024-04-10 |
| EP4424322A2 (en) | 2024-09-04 |
| BR112018012138A2 (pt) | 2018-12-04 |
| AU2016369537A1 (en) | 2018-06-28 |
| US20180371093A1 (en) | 2018-12-27 |
| CL2018001560A1 (es) | 2018-07-27 |
| CA3007671A1 (en) | 2017-06-22 |
| PH12018501206A1 (en) | 2019-02-11 |
| JP2022180567A (ja) | 2022-12-06 |
| EP4424322A3 (en) | 2025-04-16 |
| CN108495651A (zh) | 2018-09-04 |
| RU2018125773A (ru) | 2020-01-21 |
| JP7569166B2 (ja) | 2024-10-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7569166B2 (ja) | Pd-1に対する抗体分子およびその使用 | |
| US12600777B2 (en) | Combination therapies comprising antibody molecules to LAG-3 | |
| US20230013364A1 (en) | Combination therapies comprising antibody molecules to pd-1 | |
| US20210284737A1 (en) | Antibody molecules to pd-l1 and uses thereof | |
| EP3878465A1 (en) | Combination therapies comprising antibody molecules to tim-3 | |
| CA3007671C (en) | Antibody molecules to pd-1 and uses thereof | |
| RU2788092C2 (ru) | Молекулы антител к pd-1 и их применения | |
| HK40102321A (en) | Antibody molecules to pd-l1 and uses thereof | |
| HK1234676A1 (en) | Antibody molecules to pd-l1 and uses thereof | |
| HK1234676B (en) | Antibody molecules to pd-l1 and uses thereof | |
| BR112017007379B1 (pt) | Molécula de anticorpo isolada capaz de se ligar ao 1 (pd-l1), e composição farmacêutica |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16831788 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3007671 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12018501206 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 259987 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 112018011901 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018531392 Country of ref document: JP Ref document number: MX/A/2018/007423 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018011901 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018012138 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2016369537 Country of ref document: AU Date of ref document: 20161216 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187019916 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020187019916 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016831788 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016831788 Country of ref document: EP Effective date: 20180717 |
|
| ENP | Entry into the national phase |
Ref document number: 112018012138 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180614 |
|
| ENPW | Started to enter national phase and was withdrawn or failed for other reasons |
Ref document number: 112018011901 Country of ref document: BR Free format text: PEDIDO CONSIDERADO RETIRADO EM RELACAO AO BRASIL POR NAO TER SIDO APRESENTADO O QUADRO REIVINDICATORIO COMPLETO TRADUZIDO PARA O PORTUGUES NO ATO DA ENTRADA NA FASE NACIONAL, CONFORME O ART.6O DA RESOLUCAO 77/2013. |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 259987 Country of ref document: IL |