WO2016054555A2 - Combination therapies - Google Patents
Combination therapies Download PDFInfo
- Publication number
- WO2016054555A2 WO2016054555A2 PCT/US2015/053799 US2015053799W WO2016054555A2 WO 2016054555 A2 WO2016054555 A2 WO 2016054555A2 US 2015053799 W US2015053799 W US 2015053799W WO 2016054555 A2 WO2016054555 A2 WO 2016054555A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- inhibitor
- alkyl
- combination
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*(CC1)CC(***)N1C(C(*)NC(C(*)N(*)*)=O)=O Chemical compound C*(CC1)CC(***)N1C(C(*)NC(C(*)N(*)*)=O)=O 0.000 description 3
- CLRSLRWKONPSRQ-IIPSPAQQSA-N CC(C)Oc(cc([C@H](c(cc1)ccc1Cl)N(C(C1)=O)c(cc2)ccc2N(C)C[C@H](CC2)CC[C@@H]2N(CCN2C)CC2=O)c1c1)c1OC Chemical compound CC(C)Oc(cc([C@H](c(cc1)ccc1Cl)N(C(C1)=O)c(cc2)ccc2N(C)C[C@H](CC2)CC[C@@H]2N(CCN2C)CC2=O)c1c1)c1OC CLRSLRWKONPSRQ-IIPSPAQQSA-N 0.000 description 1
- ACWZRVQXLIRSDF-UHFFFAOYSA-N C[n]1c(cc(C(NOCCO)=O)c(Nc(c(F)c2)ccc2Br)c2F)c2nc1 Chemical compound C[n]1c(cc(C(NOCCO)=O)c(Nc(c(F)c2)ccc2Br)c2F)c2nc1 ACWZRVQXLIRSDF-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
- A61K31/404—Indoles, e.g. pindolol
- A61K31/4045—Indole-alkylamines; Amides thereof, e.g. serotonin, melatonin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/427—Thiazoles not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
- A61K31/436—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/444—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring heteroatom, e.g. amrinone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/496—Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3015—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3038—Kidney, bladder
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3046—Stomach, Intestines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- T cells The ability of T cells to mediate an immune response against an antigen requires two distinct signaling interactions (Viglietta, V. et al. (2007) Neurotherapeutics 4:666-675; Korman, A. J. et al. (2007) Adv. Immunol. 90:297-339).
- APC antigen-presenting cells
- TCR T cell receptor
- the immune system is tightly controlled by a network of costimulatory and co-inhibitory ligands and receptors. These molecules provide the second signal for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection, while limiting immunity to self (Wang, L. et al. (Epub Mar. 7, 2011) J. Exp. Med. 208(3):577-92; Lepenies, B. et al. (2008) Endocrine, Metabolic & Immune Disorders- Drug Targets 8:279-288).
- costimulatory signals include the binding between the B7.1 (CD80) and B7.2 (CD86) ligands of the APC and the CD28 and CTLA-4 receptors of the CD4 + T-lymphocyte (Sharpe, A. H. et al. (2002) Nature Rev. Immunol. 2:116-126; Lindley, P. S. et al. (2009) Immunol. Rev. 229:307-321). Binding of B7.1 or B7.2 to CD28 stimulates T cell activation, whereas binding of B7.1 or B7.2 to CTLA-4 inhibits such activation (Dong, C. et al. (2003) Immunolog. Res.28(1):39-48; Greenwald, R. J. et al. (2005) Ann. Rev. Immunol.23:515- 548). CD28 is constitutively expressed on the surface of T cells (Gross, J., et al. (1992) J.
- B7 Superfamily a group of related B7 molecules, also known as the "B7 Superfamily" (Coyle, A. J. et al. (2001) Nature Immunol.2(3):203-209; Sharpe, A. H. et al. (2002) Nature Rev. Immunol.2:116-126; Collins, M. et al. (2005) Genome Biol.6:223.1- 223.7; Korman, A. J. et al. (2007) Adv. Immunol.90:297-339).
- B7 Superfamily Several members of the B7 Superfamily are known, including B7.1 (CD80), B7.2 (CD86), the inducible co-stimulator ligand (ICOS-L), the programmed death-1 ligand (PD-L1; B7-H1), the programmed death-2 ligand (PD-L2; B7-DC), B7-H3, B7-H4 and B7-H6 (Collins, M. et al. (2005) Genome Biol.6:223.1- 223.7).
- B7.1 CD80
- B7.2 the inducible co-stimulator ligand
- PD-L1 programmed death-1 ligand
- PD-L2 programmed death-2 ligand
- B7-DC B7-H3, B7-H4 and B7-H6
- the Programmed Death 1 (PD-1) protein is an inhibitory member of the extended CD28/CTLA-4 family of T cell regulators (Okazaki et al. (2002) Curr Opin Immunol 14:
- CD28 CD28
- CTLA-4 CTLA-4
- ICOS BTLA
- PD-1 is suggested to exist as a monomer, lacking the unpaired cysteine residue characteristic of other CD28 family members. PD-1 is expressed on activated B cells, T cells, and monocytes.
- the PD-1 gene encodes a 55 kDa type I transmembrane protein (Agata et al. (1996) Int Immunol.8:765-72). Although structurally similar to CTLA-4, PD-1 lacks the MYPPY motif (SEQ ID NO: 1) that is important for B7-1 and B7-2 binding.
- SEQ ID NO: 1 Two ligands for PD-1 have been identified, PD-L1 (B7-H1) and PD-L2 (B7-DC), that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) J. Exp. Med.192:1027-34; Carter et al. (2002) Eur. J. Immunol.32:634-43).
- Both PD-L1 and PD-L2 are B7 homologs that bind to PD- 1, but do not bind to other CD28 family members.
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med.8:787-9).
- PD-1 is known as an immunoinhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J.11:3887-3895; Blank, C. et al. (Epub 2006 Dec.29) Immunol. Immunother.56(5):739-745).
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to, e.g., a decrease in tumor infiltrating lymphocytes, a decrease in T- cell receptor mediated proliferation, and/or immune evasion by cancerous cells (Dong et al. (2003) J. Mol. Med.81:281-7; Blank et al. (2005) Cancer Immunol.
- the present invention provides, at least in part, methods and compositions comprising an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) in combination with a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule
- an inhibitor of an immune checkpoint molecule e.g., one or more inhibitors of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3, and/or -5) or CTLA-4) can be combined with a second therapeutic agent chosen from one or more agents listed in Table 1 (e.g., one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor; 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15)
- the combinations described herein can provide a beneficial effect, e.g., in the treatment of a cancer, such as an enhanced anti-cancer effect, reduced toxicity and/or reduced side effects.
- the immunomodulator, the second therapeutic agent, or both can be administered at a lower dosage than would be required to achieve the same therapeutic effect compared to a monotherapy dose.
- compositions and methods for treating proliferative disorders, including cancer, using the aforesaid combination therapies are disclosed.
- the invention features a method of treating (e.g., inhibiting, reducing, ameliorating, or preventing) a proliferative condition or disorder (e.g., a cancer) in a subject.
- the method includes administering to the subject an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) and a second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1, thereby treating the proliferative condition or disorder (e.g., the cancer).
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3, and/or -5) or CTLA-4, or any combination thereof).
- the second therapeutic agent is chosen from one or more of the agents listed in Table 1, e.g., one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor); 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15) a CAR T cell (e.g., a CAR T cell targeting CD19); 16) a MEK inhibitor, or 17) a BCR-ABL inhibitor).
- HDAC Histone Deacetylase
- the combination of the immunomodulator and the second agent can be administered together in a single composition or administered separately in two or more different compositions, e.g., one or more compositions or dosage forms as described herein.
- the administration of the immunomodulator and the second agent can be in any order.
- the immunomodulator can be administered concurrently with, prior to, or subsequent to, the second agent.
- the invention features a method of reducing an activity (e.g., growth, survival, or viability, or all), of a proliferative (e.g., a cancer) cell.
- the method includes contacting the cell with an immunomodulator (e.g., one or more of: an activator of a
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3, and/or -5) or CTLA-4, or any combination thereof).
- an immune checkpoint molecule e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3, and/or -5) or CTLA-4, or any combination thereof.
- the second therapeutic agent is chosen from one or more of the agents listed in Table 1, e.g., one or more: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor); 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15) a CAR T cell (e.g., a CAR T cell targeting CD19); 16) a MEK inhibitor, or 17) a BCR-ABL inhibitor).
- HDAC Histone Deacetylase
- the methods described herein can be used in vitro.
- in vitro hPBMC-based assays can be used to screen for combination signals of
- the methods described herein can be used in vivo, e.g., in an animal subject or model or as part of a therapeutic protocol.
- the contacting of the cell with the immunomodulator and the second agent can be in any order.
- the cell is contacted with the immunomodulator concurrently, prior to, or subsequent to, the second agent.
- the method described herein is used to measure tumor lymphocyte infiltration (TLI) in vitro or in vivo, as disclosed, e.g., in Frederick, D.T. et al. (2013) Clinical Cancer Research 19:1225-31.
- TLI tumor lymphocyte infiltration
- the method includes contacting the cell with an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) and/or a second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1, in an animal model.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule
- a second therapeutic agent e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1
- the animal model has a mutation that inhibits or activates IAP, EGF receptor, cMET, ALK, CDK4/6, PI3K, BRAF, FGF receptor, MEK, and/or BCR-ABL.
- an animal model is a mouse model implanted with MC38 murine colon carcinoma.
- an animal model is a mouse model with an inactivated p110 ⁇ isoform of PI3 kinase (e.g., p110 ⁇ D910A ) as disclosed, e.g., in Ali, K., et al., (2014) Nature 510:407-411.
- PI3 kinase e.g., p110 ⁇ D910A
- an immune phenotype is determined by measuring one or more of expression, activation, signalling, flow cytometry, mRNA analysis, cytokine levels and/or immunohistochemisty. In some embodiments, the immune phenotype is determined
- the immune phenotype is determined in situ, e.g, in tumor cells.
- one or more of the following parameters is characterized to determine an immune phenotype: checkpoint induction; level of M1
- the invention features a composition (e.g., one or more compositions, formulations or dosage formulations) or a pharmaceutical combination, comprising an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) and a second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule
- a second therapeutic agent e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4, or any combination thereof).
- an immune checkpoint molecule e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4, or any combination thereof.
- the second therapeutic agent is chosen from one or more of the agents listed in Table 1, e.g., one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor); 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15) a CAR T cell (e.g., a CAR T cell targeting CD19); 16) a MEK inhibitor, or 17) a BCR-ABL inhibitor).
- the composition comprises a pharmaceutically acceptable carrier.
- the immunomodulator and the second agent can be present
- compositions comprising the immunomodulator and the second agent can be administered via the same administration route or via different administration routes.
- the immunomodulator and the second agent can be administered via the same administration route or via different administration routes.
- pharmaceutical combination comprises the immunomodulator and the second agent separately or together.
- the composition, formulation or pharmaceutical combination is for use as a medicine, e.g., for the treatment of a proliferative disease (e.g., a cancer as described herein).
- a proliferative disease e.g., a cancer as described herein.
- the immunomodulator and the second agent are administered concurrently, e.g., independently at the same time or within an overlapping time interval, or separately within time intervals. In certain embodiment, the time interval allows the
- the immunomodulator and the second agent to be jointly active.
- the second agent to be jointly active.
- composition, formulation or pharmaceutical combination includes an amount which is jointly therapeutically effective for the treatment of a proliferative disease, e.g., a cancer as described herein.
- the invention features a use of a composition (e.g., one or more compositions, formulations or dosage formulations) or a pharmaceutical combination, comprising an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) and a second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1, for the manufacture of a medicament for treating a proliferative disease, e.g., a cancer.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule
- a second therapeutic agent e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1, for the manufacture of a medicament for treating
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4, or any combination thereof).
- an immune checkpoint molecule e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4, or any combination thereof.
- the second therapeutic agent is chosen from one or more of the agents listed in Table 1, e.g., one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor); 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15) a CAR T cell (e.g., a CAR T cell targeting CD19); 16) a MEK inhibitor, or 17) a BCR-ABL inhibitor).
- HDAC Histone Deacetylase
- Kits e.g., therapeutic kits, that include the immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule as described herein) and the second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1, and instructions for use, are also disclosed. Additional features or embodiments of the methods, compositions, dosage formulations, and kits described herein include one or more of the following: In certain embodiments, the immunomodulator is an activator of a costimulatory molecule.
- the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7- H3 or CD83 ligand, or any combination thereof.
- an agonist e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
- OX40 e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
- CD2 e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
- ICAM-1 e.g., I
- the immunomodulator is an inhibitor of an immune checkpoint molecule.
- the immunomodulator is an inhibitor of PD-1, PD-L1, PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGFR beta.
- the inhibitor of an immune checkpoint molecule inhibits PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4, or any combination thereof.
- Inhibition of an inhibitory molecule can be performed at the DNA, RNA or protein level.
- an inhibitory nucleic acid e.g., a dsRNA, siRNA or shRNA
- the inhibitor of an inhibitory signal is, a polypeptide e.g., a soluble ligand (e.g., PD-1-Ig or CTLA-4 Ig).
- the inhibitor of the inhibitory signal is an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule; e.g., an antibody or fragment thereof (also referred to herein as“an antibody molecule”) that binds to PD-1, PD-L1, PD-L2, CTLA-4, TIM-3, LAG- 3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGFR beta, or a combination thereof.
- an antibody or fragment thereof also referred to herein as“an antibody molecule”
- CEACAM e.g., CEACAM-1, -3 and/or -5
- VISTA e.g., CEACAM-1, -3 and/or -5
- BTLA TIGIT
- LAIR1 CD160
- 2B4 and/or TGFR beta
- the antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
- the antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgG1 or IgG4 (e.g., human IgG1 or IgG4).
- Fc heavy chain constant region
- the heavy chain constant region is human IgG1 or human IgG4.
- the constant region is altered, e.g., mutated, to modify the properties of the antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- the antibody molecule is in the form of a bispecific or multispecific antibody molecule.
- the bispecific antibody molecule has a first binding specificity to PD-1 or PD-L1 and a second binding specifity, e.g., a second binding specificity to TIM-3, LAG-3, or PD-L2.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and TIM-3.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and LAG-3.
- the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM (e.g., CEACAM-1, -3 and/or -5).
- CEACAM e.g., CEACAM-1, -3 and/or -5
- the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM-1. In still another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM-3. In yet another embodiment, the bispecific antibody molecule binds to PD-1 or PD-L1 and CEACAM-1. In another embodiment, the bispecific antibody molecule binds to PD-1 or PD- L1. In yet another embodiment, the bispecific antibody molecule binds to PD-1 and PD-L2. In another embodiment, the bispecific antibody molecule binds to TIM-3 and LAG-3.
- the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or - 5) and LAG-3. In another embodiment, the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or -5) and TIM-3. Any combination of the aforesaid molecules can be made in a multispecific antibody molecule, e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specifities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, or PD-L2.
- a multispecific antibody molecule e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specifities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1,
- the immunomodulator is an inhibitor of PD-1, e.g., human PD-1.
- the immunomodulator is an inhibitor of PD-L1, e.g., human PD-L1.
- the inhibitor of PD-1 or PD-L1 is an antibody molecule to PD-1 or PD-L1.
- the PD-1 or PD-L1 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody molecule, and a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM (e.g., CEACAM-1, -3 and/or -5) inhibitor, e.g., an anti-CEACAM antibody molecule.
- a CEACAM e.g., CEACAM-1, -3 and/or -5 inhibitor
- the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti-CEACAM-1 antibody molecule.
- the inhibitor of PD-1 or PD- L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-3 inhibitor, e.g., an anti-CEACAM-3 antibody molecule.
- the inhibitor of PD-1 or PD-L1 is administered in combination with a CEACAM-5 inhibitor, e.g., an anti-CEACAM-5 antibody molecule.
- a CEACAM-5 inhibitor e.g., an anti-CEACAM-5 antibody molecule.
- Other combinations of immunomodulators with a PD-1 inhibitor e.g., one or more of PD-L2, CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGFR
- Any of the antibody molecules known in the art or disclosed herein can be used in the aforesaid combinations of inhibitors of checkpoint molecule.
- the PD-1 inhibitor is an anti-PD-1 antibody chosen from Nivolumab, Pembrolizumab or Pidilizumab.
- the anti-PD-1 antibody is Nivolumab.
- Alternative names for Nivolumab include MDX- 1106, MDX-1106-04, ONO-4538, or BMS-936558.
- the anti-PD-1 antibody is Nivolumab (CAS Registry Number: 946414-94-4).
- Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PD- 1.
- Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD- 1 are disclosed in US 8,008,449 and WO2006/121168.
- the anti-PD-1 antibody is Pembrolizumab.
- Pembrolizumab (Trade name KEYTRUDA formerly Lambrolizumab, also known as Merck 3745, MK-3475 or SCH- 900475) is a humanized IgG4 monoclonal antibody that binds to PD-1.
- Pembrolizumab is disclosed, e.g., in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134–44, WO2009/114335, and US 8,354,509.
- the anti-PD-1 antibody is Pidilizumab.
- Pidilizumab CT-011; Cure Tech
- CT-011 Cure Tech
- IgG1k monoclonal antibody that binds to PD-1.
- Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are disclosed in WO2009/101611.
- Other anti- PD-1 antibodies are disclosed in US 8,609,089, US 2010028330, and/or US
- anti-PD-1 antibodies include AMP 514 (Amplimmune).
- the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-Ll or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence)).
- the PD-1 inhibitor is AMP-224.
- the PD-Ll inhibitor is anti-PD-Ll antibody.
- the anti-PD-Ll inhibitor is chosen from YW243.55.S70, MPDL3280A, MEDI-4736, MSB- 0010718C, or MDX-1105.
- the PD-L1 inhibitor is MDX-1105.
- MDX-1105 also known as BMS-936559, is an anti-PD-Ll antibody described in WO2007/005874.
- the PD-L1 inhibitor is YW243.55.S70.
- the YW243.55.S70 antibody is an anti-PD-Ll described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID Nos.20 and 21, respectively, of WO 2010/077634).
- the PD-L1 inhibitor is MDPL3280A (Genentech / Roche).
- MDPL3280A is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1.
- MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Patent No.: 7,943,743 and U.S Publication No.: 20120039906.
- the PD-L2 inhibitor is AMP-224.
- AMP-224 is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342).
- the LAG-3 inhibitor is an anti-LAG-3 antibody molecule. In one embodiment, the LAG-3 inhibitor is BMS-986016, disclosed in more detail herein below.
- the TIM-3 inhibitor is an anti-TIM-3 antibody molecule, e.g., an anti-TIM-3 antibody molecule as described herein.
- One or more of the aforesaid inhibitors of immune checkpoint molecules can be used in combination with one or more of the second agents disclosed in Table 1, as more specifically exemplified below.
- the second agent is chosen from one or more of:
- anti-HER3 monoclonal antibody or antigen binding fragment thereof that comprises a VH of SEQ ID NO: 141 and VL of SEQ ID NO: 140, as described in U.S.8,735,551;
- the inhibitor of PD-1 is Nivolumab (CAS Registry No: 946414-94-4) disclosed in e.g., US 8,008,449, and having a sequence disclosed herein, e.g., a heavy chain sequence of SEQ ID NO: 2 and a light chain sequence of SEQ ID NO: 3 (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the inhibitor of PD-1 is Pembrolizumab disclosed in, e.g., US 8,354,509 and WO 2009/114335, and having a sequence disclosed herein, e.g., a heavy cahin sequence of SEQ ID NO: 4 and a light chain sequence of SEQ ID NO: 5 (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the inhibitor of PD-L1 is MSB0010718C (also referred to as A09-246-2) disclosed in, e.g., WO 2013/0179174, and having a sequence disclosed herein, e.g., a heavy cahin sequence of SEQ ID NO: 6 and a light chain sequence of SEQ ID NO: 7 (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., the anti-PD-1 antibody (e.g., the anti-PD-1 antibody).
- Nivolumab is used in a method or composition described herein.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C) (alone or in combination with other immunomodulators) is used in combination with one or more of the agents described herein, e.g., listed in Table 1, or disclosed in a publication listed in Table 1, e.g., one or more of: 1) an Inhibitor of Apoptosis (IAP) inhibitor; 2) an inhibitor of a Target of Rapamycin (TOR) kinase; 3) an inhibitor of a human homolog of mouse double minute 2 E3 ubiquitin ligase (HDM2); 4) a PIM kinase inhibitor; 5) an inhibitor of Human epidermal growth factor 3 (HER3) kinase;
- one or more of the aforesaid combinations is used to treat a disorder, e.g., a disorder described herein (e.g., a disorder disclosed in Table 1).
- one or more of the aforesaid combinations is used to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the inhibitor of the immune checkpoint molecule is used in combination with an IAP inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- an IAP inhibitor is used in combination with an IAP inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer described herein e.g., a cancer disclosed in Table 1
- the IAP inhibitor is disclosed herein, e.g., in Table 1.
- the IAP inhibitor is LCL161 as disclosed herein, or in a publication recited in Table 1.
- the IAP inhibitor is disclosed, e.g., in U.S. Patent No.8,546,336.
- LCL161 has the structure provided in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with LCL161 to treat a cancer or disorder described herein, e.g., in Table 1, e.g., a solid tumor, e.g., a breast cancer, colon cancer, or a pancreatic cancer; or a hematological malignancy, e.g., multiple myeloma or a hematopoeisis disorder.
- a cancer or disorder described herein e.g., in Table 1, e.g., a solid tumor, e.g., a breast cancer, colon cancer, or a pancreatic cancer; or a hematological malignancy, e.g., multiple myeloma or a hematopoeisis disorder.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with LCL161, wherein LCL161 is (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2- oxoethyl)-2-(methylamino)propanamide.
- LCL161 is administered at a dose (e.g., oral dose) of about 10-3000 mg, e.g., about 20-2400 mg, about 50-1800 mg, about 100-1500 mg, about 200-1200 mg, about 300-900 mg, e.g., about 600 mg, about 900 mg, about 1200 mg, about 1500 mg, about 1800 mg, about 2100 mg, or about 2400 mg.
- LCL161 is administered once a week or once every two weeks.
- LCL161 is administered prior to administration of the immune checkpoint inhibitor (e.g., the anti-PD-1 antibody).
- the immune checkpoint inhibitor e.g., the anti-PD-1 antibody
- LCL161 can be administered one, two, three, four or five days or more before the anti-PD-1 antibody is administered.
- LCL161 is administred concurrently or substantially concurrently (e.g., on the same day) with the anti-PD-1 antibody.
- LCL161 is administered after administration of the immune checkpoint inhibitor (e.g., the anti- PD-1 antibody).
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a TOR kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the TOR kinase inhibitor is disclosed herein, e.g., in Table 1.
- the TOR kinase inhibitor is Rad-001 as disclosed herein, or in a publication recited in Table 1. In certain embodiments, the TOR kinase inhibitor is disclosed, e.g., in International Patent Publication No.2014/085318. In one embodiment, Rad-001 has the structure provided in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with Rad-001 to treat a cancer or disorder described herein, e.g., in Table 1, e.g., a solid tumor, e.g., a sarcoma, a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology)), a melanoma (e.g., an advanced melanoma), a digestive/gastrointestinal cancer, a gastric cancer, a neurologic cancer, a prostate cancer, a bladder cancer, a breast cancer; or a hematological malignancy, e.g., a lymphoma or leukemia.
- a solid tumor e.g., a sarcoma
- a lung cancer e
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with Rad-001, wherein Rad- 001 is ((1R, 9S, 12S, 15R, 16E, 18R, 19R, 21R, 23S, 24E, 26E, 28E, 30S, 32S, 35R)-1,18- dihydroxy-12- ⁇ (1R)-2-[(1S, 3R, 4R)-4-(2-hydroxyethoxy)-3-methoxycyclohexyl]-1- methylethyl ⁇ -19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-aza- tricyclo[30.3.1.04,9] hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentaone).
- the inhibitor of the immune checkpoint molecule is used in combination with a HDM2 ligase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the HDM2 ligase inhibitor is disclosed herein, e.g., in Table 1.
- the HDM2 ligase inhibitor is CGM097 as disclosed herein, or in a publication recited in Table 1.
- the HDM2 ligase inhibitor is disclosed, e.g., in International Patent Publication No.2011/076786.
- CGM097 has the structure provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab, Pembrolizumab or MSB0010718C
- CGM097 is used in combination with CGM097 to treat a cancer or disorder described herein, e.g., in Table 1, e.g., a solid tumor.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with CGM097, wherein CGM097 is (S)-1-(4-chlorophenyl)-7-isopropoxy-6-methoxy-2-(4- ⁇ methyl-[4-(4-methyl-3-oxo- piperazin-1-yl)-trans-cyclohexylmethyl]-amino ⁇ phenyl)-1,4-dihydro-2H-isoquinolin-3one.
- the inhibitor of the immune checkpoint molecule is used in combination with a PIM kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the PIM kinase inhibitor is LGH447 (also known as PIM447) disclosed herein, e.g., in Table 1.
- the PIM kinase inhibitor is disclosed in a publication recited in Table 1.
- the PIM kinase inhibitor is disclosed, e.g., in International Patent Publication No.2010/026124, European Patent Application No. EP2344474, and U.S.
- the PIM kinase inhibitor has the structure provided in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab,
- Pembrolizumab or MSB0010718C is used in combination with the PIM kinase inhibitor to treat a cancer or disorder described herein, e.g., in Table 1, e.g., hematological malignancy, e.g., multiple myeloma, myelodysplastic syndrome, myeloid leukemia, or non-Hodgkin's lymphoma.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with LGH447, wherein LGH447 is N-(4-((1R,3S,5S)-3-amino-5-methylcyclohexyl)pyridin-3-yl)-6-(2,6-difluorophenyl)- 5-fluoropicolinamide.
- the inhibitor of the immune checkpoint molecule is used in combination with a HER3 kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the HER3 kinase inhibitor is disclosed herein, e.g., in Table 1.
- the HER3 kinase inhibitor is LJM716 as disclosed herein, or in a publication recited in Table 1.
- the HER3 kinase inhibitor is disclosed, e.g., in International Patent Publication No.2012/022814 and U.S. Patent No.8,735,551.
- LJM716 has the structure provided in Table 1, or as disclosed in the publication recited in Table 1.
- the anti-HER3 monoclonal antibody or antigen binding fragment thereof comprises a VH of SEQ ID NO: 141 and VL of SEQ ID NO: 140, as described in U.S.
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with LJM716 to treat a cancer or disorder described herein, e.g., in Table 1, e.g., a solid tumor, e.g. a gastric cancer, an esophageal cancer, a breast cancer, a head and neck cancer, a stomach cancer, or a
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a HDAC inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the HDAC inhibitor is disclosed herein, e.g., in Table 1.
- the HDAC inhibitor is LBH589 as disclosed herein, or in a publication recited in Table 1.
- the HDAC inhibitor is disclosed, e.g., in International Patent Publication Nos. 2014/072493 and 2002/022577 and European Patent Application No. EP1870399.
- LBH589 has the structure provided in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab, Pembrolizumab or MSB0010718C
- a cancer or disorder described herein e.g., in Table 1, e.g., a solid tumor,e.g., a bone cancer, a small cell lung cancer, a respiratory/thoracic cancer a prostate cancer, a non-small cell lung cancer (NSCLC), a nerologic cancer, a gastric cancer, a melanoma, a breast cancer, a pancreatic cancer, a colorectal cancer, a renal cancer, or a head and neck cancer, or a liver cancer; or a hematological malignancy, e.g., multiple myeloma, a hematopoeisis disorder, myelodysplastic syndrome
- NSCLC non-small cell lung cancer
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with LBH589, wherein LBH589 is (E)-N-hydroxy-3-(4-(((2-(2-methyl-1H-indol-3-yl)ethyl)amino)methyl)phenyl) acrylamide.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a Janus kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the Janus kinase inhibitor is disclosed herein, e.g., in Table 1.
- the Janus kinase inhibitor is INC424 as disclosed herein, or in a publication recited in Table 1.
- the Janus kinase inhibitor is disclosed, e.g., in International Patent Publication Nos.2007/070514 and 2014/018632, European Patent Application No. EP2474545, and U.S. Patent No.7,598,257.
- INC424 has the structure provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with INC424 to treat a cancer or disorder described herein, e.g., in Table 1, e.g., a solid tumor,e.g., a prostate cancer, a lung cancer, a breast cancer, a pancreatic cancer, a colorectal cancer; or a hematological malignancy, e.g., multiple myeloma, lymphoma (e.g., non-Hodgkin lymphoma), or leukemia (e.g., myeloid leukemia, lymphocytic leukemia).
- the cancer has, or is identified as having, a JAK mutation.
- the JAK mutation is a JAK2 V617F mutation.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with INC424, wherein INC424 is (3R)-3-cyclopentyl-3-[4-(7H-pyrrolo-[2,3-d]pyrimidin-4-yl)-1H-pyrazol-1- yl]propanenitrile.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with an FGF receptor inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the FGF receptor inhibitor is disclosed herein, e.g., in Table 1.
- the FGF receptor inhibitor is BUW078 or BGJ398 as disclosed herein, or in a publication recited in Table 1.
- the FGF receptor inhibitor e.g., BUW078 or BGJ398, has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- Pembrolizumab or MSB0010718C is used in combination with BUW078 or BGJ398 to treat a cancer described herein, e.g., in Table 1, e.g., a solid tumor, e.g., a digestive/gastrointestinal cancer; or a hematological cancer.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with BUW078, wherein BUW078 is 8-(2,6-difluoro-3,5-dimethoxy-phenyl)-quinoxaline-5-carboxylic acid (4- dimethylaminomethyl-1H-imidazol-2-yl)-amide.
- any of the aforesaid combinations can further include one or more of the second agents described herein below, e.g., one or more of the additional compounds shown in Table 1 (e.g., one or more of: an EGF receptor inhibitor, a c-MET inhibitor, an ALK inhibitor, a CDK4/6 inhibitor, a PI3K inhibitor, a BRAF inhibitor, a CAR T cell inhibitor, a MEK inhibitor or a BCR-ABL inhibitor as described herein).
- the additional compounds shown in Table 1 e.g., one or more of: an EGF receptor inhibitor, a c-MET inhibitor, an ALK inhibitor, a CDK4/6 inhibitor, a PI3K inhibitor, a BRAF inhibitor, a CAR T cell inhibitor, a MEK inhibitor or a BCR-ABL inhibitor as described herein.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with an EGF receptor inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the EGF receptor inhibitor is disclosed herein, e.g., in Table 1.
- the EGF receptor inhibitor is EGF816, or as provided herein (e.g., a publication recited in Table 1).
- the EGF receptor inhibitor e.g., EGF816, has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- Pembrolizumab or MSB0010718C is used in combination with EGF816 to treat a cancer described herein, e.g., in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a lymphoma, or a neuroblastoma.
- a cancer described herein e.g., in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a lymphoma, or a neuroblastoma.
- NSCLC non-small cell lung cancer
- the cancer is NSCLC and is characterized by one or more of:
- the cancer is NSCLC wherein the NSCLC is characterized by harbouring an EGFR exon 20 insertion, an EGFR exon 19 deletion, EGFR L858R mutation, EGFR T790M, or any combination thereof.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring an EGFR exon 20 insertion, an EGFR exon 19 deletion, EGFR L858R mutation, EGFR T790M, or any combination thereof.
- the NSCLC is characterized by harboring L858R and T790M mutations of EGFR.
- the NSCLC is characterized by harboring an EGFR exon 20 insertion and T790M mutations of EGFR.
- the NSCLC is
- the NSCLC is characterized by harboring an EGFR exon 19 deletion and T790M mutations of EGFR.
- the NSCLC is characterized by harboring EGFR mutation selected from the group consisting of an exon 20 insertion, an exon 19 deletion, L858R mutation, T790M mutation, and any combination thereof.
- the lymphoma e.g., an anaplastic large-cell lymphoma or non- Hodgkin lymphoma
- the lymphoma has, or is identified as having, an ALK translocation, e.g., an EML4-ALK fusion.
- EGF816 is administered at an oral dose of about 50 to 500 mg, e.g., about 100 mg to 400 mg, about 150 mg to 350 mg, or about 200 mg to 300 mg, e.g., about 100 mg, 150 mg or 200 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- EGF816 is administered at an oral dose from about 100 to 200 mg, e.g., about 150 mg, once a day.
- EGF816 isadministered at a dose of 75, 100, 150, 225, 150, 200, 225, 300 or 350 mg. These doses may be administered once daily.
- EGF816 may be administered at a dose of 100 or 150 mg once daily.
- Nivolumab is administered in an amount from about 1 mg/kg to 5 mg/kg, e.g., 3 mg/kg, and may be administered over a period of 60 minutes, ca. once a week to once every 2, 3 or 4 weeks.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a c-MET inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the c-MET inhibitor is disclosed herein, e.g., in Table 1.
- the c-MET inhibitor is INC280 (formerly known as INCB28060) as disclosed herein, or in a publication recited in Table 1.
- the c-MET inhibitor e.g., INC280, has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with INC280 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), glioblastoma multiforme (GBM), a renal cancer, a liver cancer (e.g., a hepatocellular carcinoma) or a gastric cancer.
- the cancer has, or is identified as having, a c-MET mutation (e.g., a c-MET mutation or a c-MET amplification).
- INC280 is administered at an oral dose of about 100 to 1000 mg, e.g., about 200 mg to 900 mg, about 300 mg to 800 mg, or about 400 mg to 700 mg, e.g., about 400 mg, 500 mg or 600 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- INC280 is administered at an oral dose from about 400 to 600 mg twice a day.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with an Alk inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the Alk inhibitor is disclosed herein, e.g., in Table 1.
- the Alk inhibitor is LDK378 (also known as ceritinib (Zykadia®), e.g., as described herein or in a publication recited in Table 1.
- the Alk inhibitor e.g., LDK378, has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with LDK378 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a lymphoma (e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma), an inflammatory myofibroblastic tumor (IMT), or a neuroblastoma.
- the NSCLC is a stage IIIB or IV NSCLC, or a relapsed locally advanced or metastic NSCLC.
- the cancer e.g., the lung cancer, lymphoma, inflammatory myofibroblastic tumor, or neuroblastoma
- the ALK fusion has, or is identified as having, an ALK rearrangement or translocation, e.g., an ALK fusion.
- the ALK fusion is an EML4-ALK fusion, e.g., an EML4-ALK fusion described herein.
- the ALK fusion is an ALK-ROS1 fusion.
- the cancer has progressed on, or is resistant or tolerant to, a ROS1 inhibitor, or an ALK inhibitor, e.g., an ALK inhibitor other than LDK378.
- the cancer has progressed on, or is resistant or tolerant to, crizotinib.
- the subject is an ALK-na ⁇ ve patient, e.g., a human patient.
- the subject is a patient, e.g., a human patient, that has been pre- treated with an ALK inhibitor.
- the subject is a patient, e.g., a human patient, that has been pretreated with LDK378.
- LDK378 and Nivolumab are administered to an ALK-na ⁇ ve patient. In another embodiment, LDK378 and Nivolumab are administered to a patient that has been pretreated with an ALK inhibitor. In yet another embodiment, LDK378 and Nivolumab are administered to a patient that has been pretreated with LDK378.
- LDK378 is administered at an oral dose of about 100 to 1000 mg, e.g., about 150 mg to 900 mg, about 200 mg to 800 mg, about 300 mg to 700 mg, or about 400 mg to 600 mg, e.g., about 150 mg, 300 mg, 450 mg, 600 mg or 750 mg. In certain embodiment, LDK378 is administered at an oral dose of about 750 mg or lower, e.g., about 600 mg or lower, e.g., about 450 mg or lower. In certain embodiments, LDK378 is administered with food. In other embodiments, the dose is under fasting condition. The dosing schedule can vary from e.g., every other day to daily, twice or three times a day. In one embodiment,
- LDK378 is administered daily. In one embodiment, LDK378 is administered at an oral dose from about 150 mg to 750 mg daily, either with food or in a fasting condition. In one embodiment, LDK378 is administered at an oral dose of about 750 mg daily, in a fasting condition. In one embodiment, LDK378 is administered at an oral dose of about 750 mg daily, via capsule or tablet. In another embodiment, LDK378 is administered at an oral dose of about 600 mg daily, via capsule or tablet. In one embodiment, LDK378 is administered at an oral dose of about 450 mg daily, via capsule or tablet.
- LDK378 is administered at a dose of about 450 mg and nivolumab is administered at a dose of about 3 mg/kg. In another embodiment, the LDK378 dose is 600 mg and the nivolumab dose is 3 mg/kg. In one embodiment, LDK378 is administered with a low fat meal.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a CDK4/6 inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the CDK4/6 inhibitor is disclosed herein, e.g., in Table 1.
- LEE011 also knows as Ribociclib®, e.g., as described herein or in a publication recited in Table 1.
- the CDK4/6 inhibitor e.g., LEE011
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with LEE011 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a neurologic cancer, melanoma or a breast cancer, or a hematological malignancy, e.g., lymphoma.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a neurologic cancer, melanoma or a breast cancer, or a hematological malignancy, e.g., lymphoma.
- NSCLC non-small cell lung cancer
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a PI3K- inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the PI3K inhibitor is disclosed herein, e.g., in Table 1.
- the PI3K inhibitor is BKM120 or BYL719, e.g., disclosed herein or in a publication recited in Table 1.
- the PI3K-inhibitor e.g., BKM120 or BYL719, has the structure
- Nivolumab compound or generic structure provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with BKM120 or BYL719 to treat a cancer or disorder described herein, e.g., in Table 1.
- the cancer or disorder is chosen from, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a prostate cancer, an endocrine cancer, an ovarian cancer, a melanoma, a bladder cancer, a female reproductive system cancer, a digestive/gastrointestinal cancer, a colorectal cancer, glioblastoma multiforme (GBM), a head and neck cancer, a gastric cancer, a pancreatic cancer or a breast cancer; or a hematological malignancy, e.g., leukemia, non-Hodgkin lymphoma; or a hematopoiesis disorder.
- a solid tumor e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a prostate cancer, an endocrine cancer, an ovarian cancer, a melanoma, a bladder cancer, a female reproductive system cancer
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a BRAF inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the BRAF inhibitor is disclosed herein, e.g., in Table 1.
- the BRAF inhibitor is LGX818, e.g., as described herein or in a publication recited in Table 1.
- the BRAF inhibitor e.g., LGX818, has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with LGX818 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a melanoma, e.g., advanced melanoma, a thyroid cancer, e.g, papillary thyroid cancer, or a colorectal cancer.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a melanoma, e.g., advanced melanoma, a thyroid cancer, e.g,
- the cancer has, or is identified as having, a BRAF mutation (e.g., a BRAF V600E mutation), a BRAF wildtype, a KRAS wildtype or an activating KRAS mutation.
- a BRAF mutation e.g., a BRAF V600E mutation
- BRAF wildtype e.g., a BRAF V600E mutation
- KRAS wildtype e.g., a KRAS wildtype
- an activating KRAS mutation e.g., a BRAF V600E mutation
- the cancer may be at an early, intermediate or late stage.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a CAR T cell targeting CD19 to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the CAR T cell targeting CD19 is disclosed in Table 1, e.g., CTL019, or in a publication recited in Table 1.
- the CAR T cell targeting CD19 e.g., CTL019
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with CTL019 to treat a cancer described in Table 1, e.g., a solid tumor, or a hematological malignancy, e.g., a lymphocytic leukemia or a non-Hodgkin lymphoma.
- the CAR T cell targeting CD19 has the USAN designation
- CTL019 is made by a gene modification of T cells is mediated by stable insertion via transduction with a self-inactivating, replicationdeficient Lentiviral (LV) vector containing the CTL019 transgene under the control of the EF-1 alpha promoter.
- LV Lentiviral
- CTL019 is a mixture of transgene positive and negative T cells that are delivered to the subject on the basis of percent transgene positive T cells.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a MEK inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the MEK inhibitor is disclosed herein, e.g., in Table 1.
- the MEK inhibitor is MEK162, e.g., disclosed herein or in a publication recited in Table 1.
- the MEK inhibitor e.g., MEK162
- the structure e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in
- the cancer or disorder treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma, a multisystem genetic disorder, a digestive/gastrointestinal cancer, a gastric cancer, or a colorectal cancer; or rheumatoid arthritis.
- the cancer has, or is identified as having, a KRAS mutation.
- the PD-1 inhibitor e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C), (alone or in combination with other immunomodulators) is used in combination with a BCR- ABL inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the BCR-ABL inhibitor is disclosed herein, e.g., in Table 1.
- the BCR-ABL inhibitor is AMN-107 (also known as Nilotinib, trade name
- AMN- 107 has the structure (compound or generic structure) provided herein, e.g., in Table 1, or as disclosed in the publication recited in Table 1.
- Pembrolizumab or MSB0010718C is used in combination with AMN-107 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a neurologic cancer, a melanoma, a digestive/gastrointestinal cancer, a colorectal cancer, a head and neck cancer; or a hematological malignancy, e.g., chronic myelogenous leukemia (CML), a lymphocytic leukemia, a myeloid leukemia; Parkinson's disease; or pulmonary hypertension.
- CML chronic myelogenous leukemia
- a lymphocytic leukemia a myeloid leukemia
- Parkinson's disease or pulmonary hypertension.
- the proliferative disorder or condition includes but is not limited to, a solid tumor, a soft tissue tumor (e.g., a hematological cancer, leukemia, lymphoma, or myeloma), and a metastatic lesion of any of the aforesaid cancers.
- the cancer is a solid tumor.
- solid tumors include malignancies, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include
- malignancies such as colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell lung cancer, cancer of the small intestine and cancer of the esophagus.
- the cancer may be at an early, intermediate, late stage or metastatic cancer.
- the cancer is chosen from a cancer disclosed in Table 1.
- the cancer can be chosen from a solid tumor, e.g., a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology)), a colorectal cancer, a melanoma (e.g., an advanced melanoma), a head and neck cancer (e.g., head and neck squamous cell carcinoma (HNSCC), a digestive/gastrointestinal cancer, a gastric cancer, a neurologic cancer, a glioblastoma (e.g., glioblastoma multiforme), an ovarian cancer, a renal cancer, a liver cancer, a pancreatic cancer, a prostate cancer, a liver cancer; a breast cancer, an anal cancer, a gastro-esophageal cancer, a thyroid cancer, a cervical cancer;
- hematological cancer e.g., chosen from a Hogdkin lymphoma, a non-Hodgkin lymphoma, a lymphocytic leukemia, or a myeloid leukemia.
- the cancer is a colon cancer, e.g., a colon cancer that expresses an IAP, e.g., a human IAP.
- the human IAP family includes, e.g., NAIP, XIAP, cIAP1, cIAP2, ILP2, BRUCE, surviving, and livin.
- the cancer is a non-small cell lung cancer (NSCLC), e.g., an ALK+ NSCLC.
- NSCLC non-small cell lung cancer
- the term“ALK+ non-small cell lung cancer” or“ALK+ NSCLC” refers to an NSCLC that has an activated (e.g., constitutively activated) anaplastic lymphoma kinase activity or has a rearrangement or translocation of an Anaplastic Lymphoma Kinase (ALK) gene.
- ALK Anaplastic Lymphoma Kinase
- patients with ALK+ NSCLC are generally younger, have light (e.g., ⁇ 10 pack years) or no smoking history, present with lower Eastern Cooperative Oncology Group performance status, or may have more aggressive disease and, therefore, experience earlier disease progression (Shaw et al. J Clin Oncol.2009; 27(26):4247-4253; Sasaki et al. Eur J Cancer.2010; 46(10):1773-1780; Shaw et al. N Engl J Med.2013;368(25):2385-2394; Socinski et al. J Clin Oncol.2012; 30(17):2055- 2062 ; Yang et al. J Thorac Oncol.2012;7(1):90–97).
- the cancer e.g., an NSCLC
- the rearrangement or translocation of the ALK gene leads to a fusion (e.g., fusion upstream of the ALK promoter region).
- the fusion results in constitutive activation of the kinase activity.
- the fusion is an EML4-ALK fusion.
- EML4-ALK fusion proteins include, but are not limited to, E13;A20 (V1), E20;A20 (V2), E6a/b;A20 (V3a/b), E14;A20 (V4), E2a/b;A20 (V5a/b), E13b;A20 (V6), E14;A20(V7), E15;A20(“V4”), or E18;A20 (V5) (Choi et al. Cancer Res.2008; 68(13):4971-6; Horn et al. J Clin Oncol.2009; 27(26):4232- 5; Koivunen et al. Clin Cancer Res.2008; 14(13):4275-83; Soda et al. Nature.2007;
- the ALK gene is fused to a non-EML4 partner.
- the fusion is a KIF5B-ALK fusion.
- the fusion is a TFG- ALK fusion. Exemplary KIF5B-ALK and TFG-ALK fusions are described, e.g., in Takeuchi et al. Clin Cancer Res.2009; 15(9):3143-9, Rikova et al. Cell.2007; 131(6):1190-203.
- ALK gene rearrangements or translocations, or cancer cells that has an ALK gene rearrangement or translocation can be detected, e.g., using fluorescence in situ hybridization (FISH), e.g., with an ALK break apart probe.
- FISH fluorescence in situ hybridization
- the subject is a mammal, e.g., a primate, preferably a higher primate, e.g., a human (e.g., a patient having, or at risk of having, a disorder described herein).
- the subject is in need of enhancing an immune response.
- the subject has, or is at risk of, having a disorder described herein, e.g., a cancer as described herein.
- the subject is, or is at risk of being,
- the subject is undergoing or has undergone a
- chemotherapeutic treatment and/or radiation therapy Alternatively, or in combination, the subject is, or is at risk of being, immunocompromised as a result of an infection.
- the subject e.g., a subject having a lung cancer (e.g., a non-small cell lung cancer), a lymphoma (e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma), an inflammatory myofibroblastic tumor, or a neuroblastoma) is being treated, or has been treated, with another ALK inhibitor and/or a ROS1 inhibitor, e.g., crizotinib.
- crizotinib can be administered at a daily oral dose of 750 mg or lower, e.g., 600 mg or lower, e.g., 450 mg or lower.
- the subject or cancer e.g., a lung cancer (e.g., a non-small cell lung cancer), a lymphoma (e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma), an inflammatory myofibroblastic tumor, or a neuroblastoma) has progressed on, or is resistant or tolerant to, another ALK inhibitor and/or a ROS1 inhibitor, e.g., crizotinib.
- a lung cancer e.g., a non-small cell lung cancer
- a lymphoma e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma
- an inflammatory myofibroblastic tumor e.g., a neuroblastoma
- a neuroblastoma e.g., crizotinib.
- the subject or cancer e.g., a lung cancer (e.g., a non-small cell lung cancer), a lymphoma (e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma), an inflammatory myofibroblastic tumor, or a neuroblastoma) is at risk of progression on, or developing resistance or tolerance to, another ALK inhibitor and/or a ROS1 inhibitor, e.g., crizotinib.
- a lung cancer e.g., a non-small cell lung cancer
- a lymphoma e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma
- an inflammatory myofibroblastic tumor e.g., a neuroblastoma
- a neuroblastoma e.g., crizotinib.
- the subject or cancer is resistant or tolerant, or is at risk of developing resistance or tolerance, to a tyrosine kinase inhibitor (TKI), e.g., an EGFR tyrosine kinase inhibitor.
- TKI tyrosine kinase inhibitor
- the subject or cancer has no detectable EGFR mutation, KRAS mutation, or both.
- the subject has previously been treated with PD-1.
- the subject has or is identified as having a tumor that has one or more of high PD-L1 level or expression and/or Tumor Infiltrating Lymphocyte (TIL)+.
- TIL Tumor Infiltrating Lymphocyte
- the subject has or is identified as having a tumor that has high PD-L1 level or expression and TIL+.
- the methods described herein further describe identifying a subject based on having a tumor that has one or more of high PD-L1 level or expression and/or TIL+.
- the methods described herein further describe identifying a subject based on having a tumor that has high PD-L1 level or expression and TIL+.
- tumors that are TIL+ are positive for CD8 and IFN ⁇ .
- the subject has or is identified as having a high percentage of cells that are positive for one or more of PD-L1, CD8, and/or IFN ⁇ . In certain embodiments, the subject has or is identified as having a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ .
- the methods described herein further describe identifying a subject based on having a high percentage of cells that are positive for one or more of PD-L1, CD8, and/or IFN ⁇ . In certain embodiments, the methods described herein further describe identifying a subject based on having a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ .
- the subject has or is identified as having one or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a lung cancer, e.g., squamous cell lung cancer or lung adenocarcinoma; a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer; and/or a melanoma.
- a lung cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell cervical cancer or lung adenocarcinoma
- a stomach cancer e.g., a squamous cell cervical cancer
- a thyroid cancer
- the methods described herein further describe identifying a subject based on having one or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a lung cancer, e.g., squamous cell lung cancer or lung adenocarcinoma; a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer;
- a lung cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell lung cancer or lung adenocarcinoma
- a head and neck cancer e.g., squamous cell cervical cancer or adenocarcinoma
- Dosages and therapeutic regimens of the agents described herein can be determined by a skilled artisan.
- the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
- the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 10 to 20 mg/kg every other week.
- the anti-PD-1 antibody molecule e.g., Nivolumab
- the anti-PD-1 antibody molecule e.g., Nivolumab
- Nivolumab is administered in an amount from about 1 mg/kg to 5 mg/kg, e.g., 3 mg/kg, and may be administered over a period of 60 minutes, ca. once a week to once every 2, 3 or 4 weeks.
- the combination therapies described herein can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
- the anti-PD-1 antibody molecule is administered intravenously.
- one or more of the agents listed in Table 1, e.g., an IAP inhibitor or LCL161 is administered orally.
- the anti-PD-1 antibody molecule is administered, e.g., intravenously, at least one, two, three, four, five, six, or seven days, e.g., three days, after an agent listed in Table 1, e.g., an IAP inhibitor or LCL161, is administered, e.g., orally.
- the anti-PD-1 antibody molecule is administered, e.g., intravenously, at least one, two, three, four, five, six, or seven days, e.g., three days, before an agent listed in Table 1, e.g., an IAP inhibitor or LCL161, is administered, e.g., orally.
- the anti-PD-1 antibody molecule is administered, e.g., intravenously, on the same day, as the one or more agents listed in Table 1, e.g., an IAP inhibitor or LCL161, is administered, e.g., orally.
- the administration of the anti-PD-1 antibody molecule and one or more of the agents listed in Table 1, e.g., an IAP inhibitor or LCL161 results in an enhanced reduction of a solid tumor, e.g., colon cancer, , relative to administration of each of these agents as a monotherapy.
- the concentration of an agent listed in Table 1, e.g., an IAP inhibitor or LCL161, that is required to achieve inhibition, e.g., growth inhibition is lower than the therapeutic dose of the agent as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- the concentration of the anti-PD-1 antibody molecule that is required to achieve inhibition, e.g., growth inhibition, is lower than the therapeutic dose of the anti-PD-1 antibody molecule as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- the methods and compositions described herein can be used in combination with further agents or therapeutic modalities.
- the combination therapies can be administered simultaneously or sequentially in any order. Any combination and sequence of the anti-PD-1 or PD-L1 antibody molecules and other therapeutic agents, procedures or modalities (e.g., as described herein) can be used.
- the combination therapies can be administered during periods of active disorder, or during a period of remission or less active disease.
- the combination therapies can be administered before the other treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
- the methods and compositions described herein are administered in combination with one or more of other antibody molecules, chemotherapy, other anti-cancer therapy (e.g., targeted anti-cancer therapies, gene therapy, viral therapy, RNA therapy bone marrow transplantation, nanotherapy, or oncolytic drugs), cytotoxic agents, immune-based therapies (e.g., cytokines or cell-based immune therapies), surgical procedures (e.g., lumpectomy or mastectomy) or radiation procedures, or a combination of any of the foregoing.
- the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
- the additional therapy is an enzymatic inhibitor (e.g., a small molecule enzymatic inhibitor) or a metastatic inhibitor.
- exemplary cytotoxic agents that can be administered in combination with include antimicrotubule agents, topoisomerase inhibitors, anti-metabolites, mitotic inhibitors, alkylating agents, anthracyclines, vinca alkaloids, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis, proteosome inhibitors, and radiation (e.g., local or whole body irradiation (e.g., gamma irradiation).
- the additional therapy is surgery or radiation, or a combination thereof.
- the additional therapy is a therapy targeting an mTOR pathway, an HSP90 inhibitor, or a tubulin inhibitor.
- the methods and compositions described herein can be administered in combination with one or more of: a vaccine, e.g., a therapeutic cancer vaccine; or other forms of cellular immunotherapy.
- the combination therapy is used in combination with one, two or all of oxaliplatin, leucovorin or 5-FU (e.g., a FOLFOX co-treatment).
- combination further includes a VEGF inhibitor (e.g., a VEGF inhibitor as disclosed herein).
- the cancer treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma.
- the cancer may be at an early, intermediate or late stage.
- the combination therapy is administered with a tyrosine kinase inhibitor (e.g., axitinib) to treat renal cell carcinoma and other solid tumors.
- a tyrosine kinase inhibitor e.g., axitinib
- the combination therapy is administered with a 4-1BB receptor targeting agent (e.g., an antibody that stimulates signaling through 4-1BB (CD-137), e.g., PF- 2566).
- a 4-1BB receptor targeting agent e.g., an antibody that stimulates signaling through 4-1BB (CD-137), e.g., PF- 2566.
- the combination therapy is administered in combination with a tyrosine kinase inhibitor (e.g., axitinib) and a 4-1BB receptor targeting agent.
- FIG. 1 shows a graphical representation of flow cytometry of PD-L1 surface expression in EBC-1 cells in vitro with or without INC280 treatment.
- EBC-1 cells are non-small cell lung cancer cells with a cMET amplification.
- Figure 2 shows a graphical representation of PD-L1 mRNA expression in Hs.746.T cells in a tumor xenograft model with or without INC280 treatment.
- Hs.746.T cells are gastric cancer cells with a c-MET amplification and a c-MET mutation.
- FIG. 3 shows a graphical representation of PD-L1 mRNA expression in H3122 cells in vitro with or without LDK378.
- H3122 cells are non-small cell lung cancer (NSCLC) cells with an ALK translocation.
- NSCLC non-small cell lung cancer
- Figure 4 shows a graphical representation of PD-L1 mRNA expression in LOXIMV1 cells (BRAF mutant melanoma cells) in a tumor xenograft model with or without LGX818 treatment.
- Figure 5 shows a graphical representation of PD-L1 mRNA expression in HEYA8 cells (KRAS mutant ovarian cancer cells) in a tumor xenograft model with or without MEK162 treatment.
- Figure 6 shows a graphical representation of PD-L1 mRNA expression in UKE-1 cells (JAK2 V617F mutant myeloproliferative neoplasm cells) in a tumor xenograft model with or without INC424 treatment.
- Figure 7A shows a graphical representation of IFN- ⁇ production in unstimulated PBMCs or stimulated PBMCs treated with different concentrations of LCL161 or DMSO control.
- Figure 7B shows a graphical representation of IL-10 production in unstimulated PBMCs or stimulated PBMCs treated with different concentrations of LCL161 or DMSO control.
- Figure 8A shows a graphical representation of FACS analysis of CD4+ T cells from unstimulated PBMCs or PMBCs stimulated in the presence of different concentrations of LCL161 or DMSO control.
- Figure 8B shows a graphical representation of FACS analysis of CD8+ T cells from unstimulated PBMCs or PMBCs stimulated in the presence of different concentrations of LCL161 or DMSO control.
- Figure 9 shows a graphical representation of CyTOF mass cytometry of unstimulated PBMCs or stimulated PBMCs treated with LCL161 or DMSO control.
- Figure 10A shows a graphical representation of expression signatures related to T cells from mice implanted with MC38 cells. The mice were treated with LCL161, anti-mouse PD-1, or both. In the control group, mice were dosed with vehicle and isotype (mIgG1).
- Figure 10B shows a graphical representation of expression signatures related to dendritic cells from mice implanted with MC38 cells. The mice were treated with LCL161, anti-mouse PD-1, or both. In the control group, mice were dosed with vehicle and isotype (mIgG1).
- Figure 10C shows a graphical representation of expression signatures related to macrophages from mice implanted with MC38 cells.
- the mice were treated with LCL161, anti- mouse PD-1, or both.
- mice were dosed with vehicle and isotype (mIgG1).
- Figure 10D shows a graphical representation of chemokine expression signatures from mice implanted with MC38 cells.
- the mice were treated with LCL161, anti-mouse PD-1, or both.
- mice were dosed with vehicle and isotype (mIgG1).
- Figure 11A shows an exemplary treatment schedule and a graphical representation of tumor volumes in mice implanted with MC38 cells.
- the mice were treated with LCL161, anti- mouse PD-1, or both.
- anti-mouse PD-1 was administered three days after LCL161 was administered.
- mice were dosed with vehicle and isotype (mIgG1).
- Figure 11B shows another exemplary treatment schedule and a graphical representation of tumor volumes in mice implanted with MC38 cells.
- the mice were treated with LCL161, anti-mouse PD-1, or both.
- LCL161 and anti-mouse PD-1 were administered concurrently.
- mice were dosed with vehicle and isotype (mIgG1).
- Figure 12 is a representation of the sequence of drug administration for patients enrolled in the Phase II trial that will be treated with EGF816 and Nivolumab. BRIEF DESCRIPTION OF THE TABLE
- Table 1 is a summary of selected therapeutic agents that can be administered in combination with the immunomodulators (e.g., one or more of: an activator of a costimulatory molecule and/or an inhibitor of an immune checkpoint molecule) described herein.
- Table 1 provides from left to right the following: the Name and/or Designation of the second therapeutic agent, the Compound structure, a Patent publication disclosing the Compound, Exemplary Indications/Uses, and Generic structure.
- Table 2 shows the trial objectives and related endpoints in a phase II, multicenter, open- label study of EGF816 in combination with nivolumab in adult patients with EGFR mutated non- small cell lung cancer.
- Table 3 shows the dose and treatment schedule in a phase II, multicenter, open-label study of EGF816 in combination with nivolumab in adult patients with EGFR mutated non-small cell lung cancer.
- compositions which comprise an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule and/or an inhibitor of an immune checkpoint molecule) in combination with a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule and/or an inhibitor of an immune checkpoint molecule
- a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- Immune therapy alone can be effective in a number of indications (e.g., melanoma). However, for most patients, it is not a cure.
- an inhibitor of an immune checkpoint molecule e.g., one or more of inhibitors to PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4) can be combined with a second therapeutic agent chosen from one or more of the agents listed in Table 1 (e.g., chosen from one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor; 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF
- the combinations described herein can provide a beneficial effect, e.g., in the treatment of a cancer, such as an enhanced anti-cancer effect, reduced toxicity and/or reduced side effects.
- the immunomodulator, the second therapeutic agent, or both can be administered at a lower dosage than would be required to achieve the same therapeutic effect compared to a monotherapy dose.
- inhibitortion includes a reduction in a certain parameter, e.g., an activity, of a given molecule, e.g., an immune checkpoint inhibitor.
- a certain parameter e.g., an activity, of a given molecule
- an immune checkpoint inhibitor e.g., an enzyme that catalyzes the production of a protein
- inhibition of an activity e.g., an activity of, e.g., PD-1, PD-L1, c-MET, ALK, CDK4/6, PI3K, BRAF, FGFR, MET or BCR-ABL, of at least 5%, 10%, 20%, 30%, 40% or more is included by this term.
- the term“Programmed Death 1” or“PD-1” include isoforms, mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1.
- the amino acid sequence of PD-1, e.g., human PD-1 is known in the art, e.g., Shinohara T et al. (1994) Genomics 23(3):704-6; Finger LR, et al. Gene (1997) 197(1-2):177-87.
- or“PD-Ligand 1” or“PD-L1” include isoforms, mammalian, e.g., human PD-1, species homologs of human PD-L1, and analogs comprising at least one common epitope with PD-L1.
- the amino acid sequence of PD-L1, e.g., human PD-L1 is known in the art
- “Lymphocyte Activation Gene-3” or“LAG-3” include all isoforms
- LAG-3 mammalian, e.g., human LAG-3, species homologs of human LAG-3, and analogs comprising at least one common epitope with LAG-3.
- the amino acid and nucleotide sequences of LAG-3, e.g., human LAG-3, is known in the art, e.g., Triebel et al. (1990) J. Exp. Med.171:1393-1405.
- TIM-3 refers to a transmembrane receptor protein that is expressed on Th1 (T helper 1) cells. TIM-3 has a role in regulating immunity and tolerance in vivo (see Hastings et al., Eur J Immunol.2009 Sep;39(9):2492-501).
- CEACAM Carcinoembryonic Antigen-related Cell Adhesion Molecule
- CEACAM includes all family members (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), isoforms, mammalian, e.g., human CEACAM, species homologs of human CEACAM, and analogs comprising at least one common epitope with CEACAM.
- CEACAM e.g., human CEACAM
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%.91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- “functional variant” refers polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol.48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and
- BLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and
- NBLAST NBLAST
- hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
- Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
- Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2X SSC, 0.1% SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C; 3) high stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1% SDS at 65°C. Very high stringency conditions (4) are the preferred conditions and the ones that should be used unless otherwise specified.
- molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L- optical isomers and peptidomimetics.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- polymers of amino acids of any length may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non- amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- nucleic acid refers to any organic acid sequence.
- nucleotide sequence refers to any organic acid sequence.
- polynucleotide sequence and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- the antibody molecule binds to a mammalian, e.g., human, checkpoint molecule, e.g., PD-1, PD-L1, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or TIM-3.
- checkpoint molecule e.g., PD-1, PD-L1, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or TIM-3.
- the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, (e.g., an epitope as described herein) on PD-1, PD-L1, LAG-3,
- CEACAM e.g., CEACAM-1, -3 and/or -5) or TIM-3.
- antibody molecule refers to a protein comprising at least one immunoglobulin variable domain sequence.
- the term antibody molecule includes, for example, full-length, mature antibodies and antigen-binding fragments of an antibody.
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab’, F(ab’) 2 , Fc, Fd, Fd’, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
- the antibodies of the present invention can be monoclonal or polyclonal.
- the antibody can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a
- antibody includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody
- glycosylation the number of cysteine residues, effector cell function, or complement function.
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
- variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- the VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions" (CDR), interspersed with regions that are more conserved, termed "framework regions" (FR or FW).
- CDR complementarity determining regions
- CDR complementarity determining region
- HCDR1, HCDR2, HCDR3 three CDRs in each heavy chain variable region
- LCDR1, LCDR2, LCDR3 three CDRs in each light chain variable region
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the “Chothia” number scheme are also sometimes referred to as“hypervariable loops.”
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- an“immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the PD-1 polypeptide, or an epitope thereof.
- the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the PD-1 polypeptide.
- the antigen-binding site of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An“effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- the antibody molecule can be a polyclonal or a monoclonal antibody.
- the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No.5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International Publication WO 92/20791; Markland et al. International Publication No. WO 92/15679; Breitling et al. International Publication WO 93/01288; McCafferty et al.
- the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human
- a non-human antibody e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- the non-human antibody is a rodent (mouse or rat antibody).
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al.
- An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No.4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to PD-1.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S.
- Patent 5,225,539 Jones et al.1986 Nature 321:552-525; Verhoeyan et al.1988 Science 239:1534; Beidler et al.1988 J. Immunol.141:4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on March 26, 1987; Winter US
- humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in US 5,585,089, e.g., columns 12-16 of US 5,585,089, e.g., columns 12-16 of US 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on December 23, 1992.
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. No. 5,624,821 and U.S. Pat. No.5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- an antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
- a "derivatized" antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- another antibody e.g., a bispecific antibody or a diabody
- detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- an appropriate spacer e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester
- homobifunctional e.g., disuccinimidyl suberate
- An antibody molecules may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety.
- Radioactive isotopes can be used in diagnostic or therapeutic applications. Radioactive isotopes that can be coupled to the anti- PSMA antibodies include, but are not limited to ⁇ -, ⁇ -, or ⁇ -emitters, or ⁇ -and ⁇ -emitters.
- radioactive isotopes include, but are not limited to iodine ( 131 I or 125 I), yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), rhodium ( 188 Rh), sulfur ( 35 S) , carbon ( 14 C), tritium ( 3 H), chromium ( 51 Cr), chlorine ( 36 Cl), cobalt ( 57 Co or 58 Co), iron ( 59 Fe), selenium ( 75 Se), or gallium ( 67 Ga).
- Radioisotopes useful as therapeutic agents include yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), and rhodium ( 188 Rh).
- Radioisotopes useful as labels include iodine ( 131 I or 125 I), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), carbon ( 14 C), and tritium ( 3 H), or one or more of the therapeutic isotopes listed above.
- the invention provides radiolabeled antibody molecules and methods of labeling the same.
- a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
- the conjugated antibody is radiolabeled with a radioisotope, e.g.,
- the antibody molecule can be conjugated to a therapeutic agent.
- therapeutically active radioisotopes have already been mentioned.
- examples of other therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin,
- daunorubicin dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S. Pat. No.5,208,020), CC-1065 (see U.S. Pat. Nos. 5,475,092, 5,585,499, 5,846, 545) and analogs or homologs thereof.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, CC-1065, melphalan, carmustine (BSNU) and lomustine (CCNU),
- antimetabolites e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine
- alkylating agents e.g., mechlorethamine, thioepa chlorambucil, CC-1065, melphalan, carmustine (BSNU) and lomustine (CCNU)
- cyclothosphamide busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis- dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclinies (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine, vinblastine, taxol and maytansinoids).
- DDP dichlorodiamine platinum
- anthracyclinies e.g., daunorubicin (formerly daunomycin) and doxorubicin
- antibiotics e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)
- the combination therapies can include an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule) and a second therapeutic agent, e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- an immunomodulator e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule
- a second therapeutic agent e.g., a second therapeutic agent chosen from one or more of the agents listed in Table 1.
- the therapy or the therapeutic agents must be administered at the same time and/or formulated for delivery together (e.g., in the same composition), although these methods and compositions are within the scope described herein.
- the immunomodulator and the second therapeutic agent can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
- the agents in the combination can be administered in any order. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
- the additional therapeutic agent utilized in this combination may be administered together in a single composition or administered separately in different compositions. In general, it is expected that additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- a combination includes a formulation of the immunomodulator and the second therapeutic agent, with or without instructions for combined use or to
- the combined compounds can be manufactured and/or formulated by the same or different manufacturers.
- the combination partners may thus be entirely separate pharmaceutical dosage forms or pharmaceutical compositions that are also sold independently of each other.
- instructions for their combined use are provided: (i) prior to release to physicians (e.g. in the case of a“kit of part” comprising the compound of the disclosure and the other therapeutic agent); (ii) by the physicians themselves (or under the guidance of a physician) shortly before administration; (iii) the patient themselves by a physician or medical staff.
- the combination therapies disclosed herein can include an inhibitor of an inhibitory molecule of an immune checkpoint molecule.
- immune checkpoints refers to a group of molecules on the cell surface of CD4 and CD8 T cells. These molecules can effectively serve as “brakes” to down-modulate or inhibit an anti-tumor immune response. Inhibition of an inhibitory molecule can be performed by inhibition at the DNA, RNA or protein level.
- an inhibitory nucleic acid e.g., a dsRNA, siRNA or shRNA
- the inhibitor of an inhibitory signal is, a polypeptide e.g., a soluble ligand, or an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule.
- Immune checkpoint molecules useful in the methods and compositions of the present invention include, but are not limited to, Programmed Death 1 (PD-1), PD-1, PD-L1, PD-L2, Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4), TIM-3, CEACAM (e.g., CEACAM-1,
- CEACAM-3 and/or CEACAM-5 LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H1, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, TGFR (e.g., TGFR beta).
- TGFR e.g., TGFR beta
- the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA- 4, or any combination thereof).
- an immune checkpoint molecule e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA- 4, or any combination thereof.
- the PD-1 inhibitor is an anti-PD-1 antibody chosen from
- Nivolumab Pembrolizumab or Pidilizumab.
- the anti-PD-1 antibody is Nivolumab.
- Alternative names for Nivolumab include MDX-1106, MDX-1106-04, ONO-4538, or BMS-936558.
- the anti-PD-1 antibody is Nivolumab (CAS Registry Number: 946414-94-4).
- Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PD- 1.
- Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD- 1 are disclosed in US 8,008,449 and WO2006/121168.
- the inhibitor of PD- 1 is Nivolumab, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy and light chain amino acid sequences of Nivolumab are as follows: Heavy chain (SEQ ID NO: 2)
- the anti-PD-1 antibody is Pembrolizumab.
- Pembrolizumab (also referred to as Lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA®; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1. Pembrolizumab and other humanized anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134–44, US 8,354,509 and WO2009/114335.
- the inhibitor of PD-1 is Pembrolizumab disclosed in, e.g., US 8,354,509 and WO 2009/114335, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy and light chain amino acid sequences of Pembrolizumab are as follows: Heavy chain (SEQ ID NO: 4)
- RVVSVLTVLH QDWLNGKEYK CKVSNKGLPS SIEKTISKAK GQPREPQVYT 350
- the anti-PD-1 antibody is Pidilizumab.
- Pidilizumab (CT-011; Cure Tech) is a humanized IgG1k monoclonal antibody that binds to PD-1.
- Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are disclosed in WO2009/101611.
- anti-PD-1 antibodies include AMP 514 (Amplimmune), among others, e.g., anti- PD-1 antibodies disclosed in US 8,609,089, US 2010028330, and/or US 20120114649.
- exemplary PD-L1 or PD-L2 Inhibitors include AMP 514 (Amplimmune), among others, e.g., anti- PD-1 antibodies disclosed in US 8,609,089, US 2010028330, and/or US 20120114649.
- the PD-L1 inhibitor is an antibody molecule. In some embodiments, the PD-L1 inhibitor is an antibody molecule.
- the anti-PD-Ll inhibitor is chosen from YW243.55.S70, MPDL3280A, MEDI- 4736, MSB-0010718C, or MDX-1105.
- the anti-PD-L1 antibody is MSB0010718C.
- MSB0010718C also referred to as A09-246-2; Merck Serono
- A09-246-2 Merck Serono
- Pembrolizumab and other humanized anti-PD-L1 antibodies are disclosed in
- the heavy and light chain amino acid sequences of MSB0010718C include at least the following: Heavy chain variable region (SEQ ID NO: 24 as disclosed in WO2013/079174) (SEQ ID NO: 6) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFYADKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS
- the PD-L1 inhibitor is YW243.55.S70.
- the YW243.55.S70 antibody is an anti-PD-Ll described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID Nos.20 and 21, respectively, of WO 2010/077634), and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the PD-L1 inhibitor is MDX-1105.
- MDX-1105 also known as BMS-936559, is an anti-PD-Ll antibody described in WO2007/005874, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the PD-L1 inhibitor is MDPL3280A (Genentech / Roche).
- MDPL3280A is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1.
- MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Patent No.: 7,943,743 and U.S Publication No.: 20120039906.
- the PD-L2 inhibitor is AMP-224.
- AMP-224 is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342).
- a combination described herein includes a TIM-3 inhibitor.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
- Exemplary anti-TIM-3 antibodies are disclosed in U.S. Patent No.: 8,552,156, WO 2011/155607, EP 2581113 and U.S Publication No.: 2014/044728.
- Exemplary LAG-3 Inhibitors are disclosed in U.S. Patent No.: 8,552,156, WO 2011/155607, EP 2581113 and U.S Publication No.: 2014/044728.
- Exemplary LAG-3 Inhibitors are disclosed in U.S. Patent No.: 8,552,156, WO 2011/155607, EP 2581113 and U.S Publication No.: 2014/044728.
- a combination described herein includes a LAG-3 inhibitor.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
- the anti-LAG-3 antibody is BMS-986016.
- BMS-986016 also referred to as BMS986016; Bristol-Myers Squibb
- BMS-986016 and other humanized anti-LAG-3 antibodies are disclosed in US 2011/0150892, WO2010/019570, and WO2014/008218.
- a combination described herein includes a CTLA-4 inhibitor.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
- Exemplary anti-CTLA-4 antibodies include Tremelimumab (IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206); and Ipilimumab (CTLA-4 antibody, also known as MDX-010, CAS No.477202-00-9).
- Tremelimumab IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206
- Ipilimumab CLA-4 antibody, also known as MDX-010, CAS No.477202-00-9
- the combination includes an anti-PD-1 antibody molecule, e.g., as described herein, and an anti-CTLA-4 antibody, e.g., ipilimumab.
- an anti-CTLA-4 antibody e.g., ipilimumab.
- exemplary doses that can be use include a dose of anti-PD-1 antibody molecule of about 1 to 10 mg/kg, e.g., 3 mg/kg, and a dose of an anti-CTLA-4 antibody, e.g., ipilimumab, of about 3 mg/kg.
- the anti-PD-1 antibody molecule is administered after treatment, e.g., after treatment of a melanoma, with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g., vemurafenib or dabrafenib).
- an anti-CTLA-4 antibody e.g., ipilimumab
- BRAF inhibitor e.g., vemurafenib or dabrafenib.
- the inhibitor is a soluble ligand (e.g., a CTLA-4-Ig), or an antibody or antibody fragment that binds to PD-L1, PD-L2 or CTLA-4.
- a soluble ligand e.g., a CTLA-4-Ig
- an antibody or antibody fragment that binds to PD-L1, PD-L2 or CTLA-4.
- the anti-PD-1 antibody molecule can be administered in combination with an anti-CTLA-4 antibody, e.g., ipilimumab, for example, to treat a cancer (e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer).
- a cancer e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer.
- the anti-PD-1 molecules described herein are administered in combination with one or more other inhibitors of PD-1, PD-L1 and/or PD-L2, e.g., as described herein.
- the antagonist may be an antibody, an antigen binding fragment thereof, an
- immunoadhesin a fusion protein, or oligopeptide.
- the anti-PD-1 or PD-L1 antibody molecule is administered in combination with an anti-LAG-3 antibody or an antigen-binding fragment thereof. In another embodiment, the anti-PD-1 or PD-L1 antibody molecule is administered in combination with an anti-TIM-3 antibody or antigen-binding fragment thereof. In yet other embodiments, the anti- PD-1 or PD-L1 antibody molecule is administered in combination with an anti-LAG-3 antibody and an anti-TIM-3 antibody, or antigen-binding fragments thereof.
- the combination of antibodies recited herein can be administered separately, e.g., as separate antibodies, or linked, e.g., as a bispecific or trispecific antibody molecule.
- a bispecific antibody that includes an anti-PD-1 or PD-L1 antibody molecule and an anti-TIM-3 or anti-LAG-3 antibody, or antigen-binding fragment thereof, is administered.
- the combination of antibodies recited herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor).
- a cancer e.g., a cancer as described herein (e.g., a solid tumor).
- the efficacy of the aforesaid combinations can be tested in animal models known in the art. For example, the animal models to test the synergistic effect of anti- PD-1 and anti-LAG-3 are described, e.g., in Woo et al. (2012) Cancer Res.72(4):917-27).
- the anti-PD-1 or PD-L1 antibody molecule is administered in combination with an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5).
- an inhibitor of CEACAM e.g., CEACAM-1, -3 and/or -5.
- the inhibitor of CEACAM is an anti-CEACAM antibody molecule.
- CEACAM carcinoembryonic antigen cell adhesion molecules
- CEACAM-1 and CEACAM-5 are believed to mediate, at least in part, inhibition of an anti-tumor immune response (see e.g., Markel et al. J Immunol. 2002 Mar 15;168(6):2803-10; Markel et al. J Immunol.2006 Nov 1;177(9):6062-71; Markel et al. Immunology.2009 Feb;126(2):186-200; Markel et al.
- CEACAM-1 has been described as a heterophilic ligand for TIM-3 and as playing a role in TIM-3-mediated T cell tolerance and exhaustion (see e.g., WO 2014/022332; Huang, et al. (2014) Nature doi:10.1038/nature13848).
- co-blockade of CEACAM-1 and TIM-3 has been shown to enhance an anti-tumor immune response in xenograft colorectal cancer models (see e.g., WO 2014/022332; Huang, et al. (2014), supra).
- co- blockade of CEACAM-1 and PD-1 reduce T cell tolerance as described, e.g., in WO
- CEACAM inhibitors can be used with the other immunomodulators described herein (e.g., anti-PD-1 and/or anti-TIM-3 inhibitors) to enhance an immune response against a cancer, e.g., a melanoma, a lung cancer (e.g., NSCLC), a bladder cancer, a colon cancer an ovarian cancer, and other cancers as described herein.
- a cancer e.g., a melanoma
- a lung cancer e.g., NSCLC
- bladder cancer e.g., a colon cancer an ovarian cancer
- other cancers as described herein.
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM inhibitor (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5 inhibitor).
- a CEACAM inhibitor e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5 inhibitor.
- the inhibitor of CEACAM is an anti-CEACAM antibody molecule.
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti- CEACAM-1 antibody molecule.
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM- 3 inhibitor, e.g., an anti- CEACAM-3 antibody molecule.
- the anti-PD-1 antibody molecule is administered in combination with a CEACAM-5 inhibitor, e.g., an anti- CEACAM-5 antibody molecule.
- a CEACAM-5 inhibitor e.g., an anti- CEACAM-5 antibody molecule.
- Exemplary anti-CEACAM-1 antibodies are described in WO 2010/125571, WO 2013/082366 and WO 2014/022332, e.g., a monoclonal antibody 34B1, 26H7, and 5F4; or a recombinant form thereof, as described in, e.g., US 2004/0047858, US 7,132,255 and WO 99/052552.
- the anti-CEACAM antibody binds to CEACAM-5 as described in, e.g., Zheng et al. PLoS One.2010 Sep 2;5(9). pii: e12529
- the combination therapies disclosed herein include a modulator of a costimulatory molecule.
- the costimulatory modulator, e.g., agonist, of a costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or soluble fusion) of an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like proteins, a cytokine receptor, an integrin, a signaling lymphocytic activation molecules (SLAM proteins), an activating NK cell receptor, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CD11a/CD18), 4-1BB (CD137), B7-H3, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp
- CD226 SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM
- the combination therapies disclosed herein include a costimulatory molecule, e.g., an agonist associated with a positive signal that includes a costimulatory domain of CD28, CD27, ICOS and GITR.
- a costimulatory molecule e.g., an agonist associated with a positive signal that includes a costimulatory domain of CD28, CD27, ICOS and GITR.
- a combination described herein includes a GITR agonist.
- the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
- Exemplary GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies), such as, a GITR fusion protein described in U.S. Patent No.: 6,111,090, European Patent No.: 0920505B1, U.S Patent No.: 8,586,023, PCT Publication Nos.: WO 2010/003118 and 2011/090754, or an anti-GITR antibody described, e.g., in U.S. Patent No.: 7,025,962, European Patent No.: 1947183B1, U.S. Patent No.: 7,812,135, U.S. Patent No.: 8,388,967, U.S.
- anti-GITR antibodies e.g., bivalent anti-GITR antibodies
- the GITR agonist is used in combination with a PD-1 inhibitor, e.g., as described in WO2015/026684.
- the GITR agonist is used in combination with a TLR agonist, e.g., as described in WO2004060319, and International Publication No.: WO2014012479. Additional Combinations
- the combination therapies include a modified T-cell, e.g., in combination with an adoptive T-cell immunotherapy using chimeric antigen receptor (CAR) T cells (e.g., as described by John LB, et al. (2013) Clin. Cancer Res.19(20): 5636-46).
- CAR chimeric antigen receptor
- the combination therapies disclosed herein can also include a cytokine, e.g., interleukin-21 or interleukin-2.
- a cytokine e.g., interleukin-21 or interleukin-2.
- the combination described herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor or melanoma).
- immunomodulators that can be used in the combination therapies include, but are not limited to, e.g., afutuzumab (available from Roche®); pegfilgrastim (Neulasta®);
- lenalidomide CC-5013, Revlimid®
- Thalomid® thalidomide
- actimid CC4047
- cytokines e.g., IL-21 or IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon ⁇ , CAS 951209-71-5, available from IRX Therapeutics).
- the combination therapies can be administered to a subject in conjunction with (e.g., before, simultaneously or following) one or more of: bone marrow transplantation, T cell ablative therapy using chemotherapy agents such as, fludarabine, external- beam radiation therapy (XRT), cyclophosphamide, and/or antibodies such as OKT3 or
- the anti-PD-1 or PD-L1 antibody molecules are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
- B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
- subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
- subjects receive the anti-PD-1 or PD-L1 antibody molecules.
- the anti-PD-1 or PD-L1 antibody molecules are administered before or following surgery.
- Another example of a further combination therapy includes decarbazine for the treatment of melanoma.
- decarbazine for the treatment of melanoma.
- the combined use of PD-1 blockade and chemotherapy is believed to be facilitated by cell death, that is a consequence of the cytotoxic action of most chemotherapeutic compounds, which can result in increased levels of tumor antigen in the antigen presentation pathway.
- Other combination therapies that may result in synergy with PD-1 blockade through cell death are radiation, surgery, and hormone deprivation. Each of these protocols creates a source of tumor antigen in the host.
- Angiogenesis inhibitors may also be combined with PD-1 blockade. Inhibition of angiogenesis leads to tumor cell death which may feed tumor antigen into host antigen presentation pathways.
- Combination therapies can also be used in combination with bispecific antibodies.
- Bispecific antibodies can be used to target two separate antigens.
- anti-Fc receptor/anti tumor antigen e.g., Her-2/neu
- bispecific antibodies have been used to target macrophages to sites of tumor. This targeting may more effectively activate tumor specific responses.
- the T cell arm of these responses would by augmented by the use of PD-1 blockade.
- antigen may be delivered directly to DCs by the use of bispecific antibodies which bind to tumor antigen and a dendritic cell specific cell surface marker.
- Tumors evade host immune surveillance by a large variety of mechanisms. Many of these mechanisms may be overcome by the inactivation of proteins which are expressed by the tumors and which are immunosuppressive. These include among others TGF-beta (Kehrl, J. et al. (1986) J. Exp. Med.163: 1037-1050), IL-10 (Howard, M. & O'Garra, A. (1992) Immunology Today 13: 198-200), and Fas ligand (Hahne, M. et al. (1996) Science 274: 1363-1365).
- Antibodies or antigen-binding fragments thereof to each of these entities may be used in combination with anti-PD-1 to counteract the effects of the immunosuppressive agent and favor tumor immune responses by the host.
- Anti-CD40 antibodies are able to substitute effectively for T cell helper activity (Ridge, J. et al. (1998) Nature 393: 474-478) and can be used in conjunction with PD-1 antibodies (Ito, N. et al. (2000) Immunobiology 201 (5) 527-40).
- Antibodies to T cell costimulatory molecules such as CTLA-4 (e.g., U.S. Pat. No.5,811,097), OX-40 (Weinberg, A. et al.
- PD-1 blockade can be combined with other forms of immunotherapy such as cytokine treatment (e.g., interferons, GM-CSF, G-CSF, IL-2, IL-21), or bispecific antibody therapy, which provides for enhanced presentation of tumor antigens (see e.g., Holliger (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak (1994) Structure 2:1121- 1123).
- cytokine treatment e.g., interferons, GM-CSF, G-CSF, IL-2, IL-21
- bispecific antibody therapy which provides for enhanced presentation of tumor antigens
- the combination therapies disclosed herein can be further combined with an immunogenic agent, such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al. (2004) J. Immunol.173:4919-28).
- an immunogenic agent such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al. (2004) J. Immunol.173:4919-28).
- tumor vaccines include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MART1 and/or tyrosinase, or tumor cells transfected to express the cytokine GM-CSF.
- PD-1 blockade can be combined with a vaccination protocol.
- Many experimental strategies for vaccination against tumors have been devised (see Rosenberg, S., 2000,
- a vaccine is prepared using autologous or allogeneic tumor cells. These cellular vaccines have been shown to be most effective when the tumor cells are transduced to express GM-CSF. GM-CSF has been shown to be a potent activator of antigen presentation for tumor vaccination (Dranoff et al.
- PD-1 blockade can be used in conjunction with a collection of recombinant proteins and/or peptides expressed in a tumor in order to generate an immune response to these proteins.
- proteins are normally viewed by the immune system as self antigens and are therefore tolerant to them.
- the tumor antigen may also include the protein telomerase, which is required for the synthesis of telomeres of chromosomes and which is expressed in more than 85% of human cancers and in only a limited number of somatic tissues (Kim, N et al. (1994) Science 266: 2011-2013). (These somatic tissues may be protected from immune attack by various means).
- Tumor antigen may also be "neo-antigens" expressed in cancer cells because of somatic mutations that alter protein sequence or create fusion proteins between two unrelated sequences (ie. bcr-abl in the Philadelphia chromosome), or idiotype from B cell tumors.
- tumor vaccines may include the proteins from viruses implicated in human cancers such a Human Papilloma Viruses (HPV), Hepatitis Viruses (HBV and HCV) and Kaposi's Herpes Sarcoma Virus (KHSV).
- HPV Human Papilloma Viruses
- HBV Hepatitis Viruses
- KHSV Kaposi's Herpes Sarcoma Virus
- Another form of tumor specific antigen which may be used in conjunction with PD-1 blockade is purified heat shock proteins (HSP) isolated from the tumor tissue itself. These heat shock proteins contain fragments of proteins from the tumor cells and these HSPs are highly efficient at delivery to antigen presenting cells for eliciting tumor immunity (Suot, R & Srivastava, P (1995) Science 269:1585-1588; Tamura, Y. et al. (1997) Science 278:117-120).
- HSP heat shock proteins
- DC Dendritic cells
- DC's can be produced ex vivo and loaded with various protein and peptide antigens as well as tumor cell extracts (Nestle, F. et al. (1998) Nature Medicine 4: 328-332). DCs may also be transduced by genetic means to express these tumor antigens as well. DCs have also been fused directly to tumor cells for the purposes of immunization (Kugler, A. et al. (2000) Nature Medicine 6:332-336). As a method of vaccination, DC immunization may be effectively combined with PD-1 blockade to activate more potent anti-tumor responses. Second Therapeutic Agents
- the second therapeutic agent can be chosen from one or more of: 1) an IAP inhibitor; 2) a TOR kinase inhibitor; 3) a HDM2 ligase inhibitor; 4) a PIM kinase inhibitor; 5) a HER3 kinase inhibitor; 6) a Histone Deacetylase (HDAC) inhibitor; 7) a Janus kinase inhibitor; 8) an FGF receptor inhibitor; 9) an EGF receptor inhibitor; 10) a c-MET inhibitor; 11) an ALK inhibitor; 12) a CDK4/6-inhibitor; 13) a PI3K inhibitor; 14) a BRAF inhibitor; 15) a CAR T cell (e.g., a CAR T cell targeting CD19); 16) a MEK inhibitor; or 17) a BCR-ABL inhibitor; e.g., chosen from one or more of the agents listed in Table 1.
- an inhibitor of the immune checkpoint molecule is used in a method or composition described herein.
- an inhibitor of the immune checkpoint molecule described herein e.g., the PD-1 inhibitor, e.g., the anti-PD-1 antibody (e.g., Nivolumab or Pembrolizumab); or the PD-L1 inhibitor, e.g., the anti-PD-L1 antibody (e.g., MSB0010718C) (alone or in combination with other immunomodulators) is used in combination with one or more of the agents listed in Table 1; e.g., 1) an Inhibitor of Apoptosis (IAP) inhibitor; 2) an inhibitor of a Target of Rapamycin (TOR) kinase; 3) an inhibitor of a human homolog of mouse double minute 2 E3 ubiquitin ligase (HDM2); 4) a PIM kinase inhibitor; 5) an inhibitor of Human epidermal growth factor 3 (HER3) kinas
- IAP Inhibi
- one or more of the aforesaid combinations is used to treat a disorder, e.g., a disorder described herein (e.g., a disorder disclosed in Table 1). In one embodiment, one or more of the aforesaid combinations is used to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- one or more of the immunomodulators described herein are used in combination with:
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with an IAP inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the IAP inhibitor is disclosed in Table 1, e.g., LCL161, or in a publication recited in Table 1, e.g., International Patent Publication No. WO2008/016893 (e.g., Formula (I), Example 1, and Compound A), European Patent No.2051990, and U.S. Patent No.8,546,336.
- the IAP inhibitor is disclosed, e.g., in International Patent Publication No. WO2008/016893 (e.g., Formula (I), Example 1, and Compound A), European Patent No. 2051990, and U.S. Patent No.8,546,336.
- the IAP inhibitor e.g., LCL161
- the structure e.g., LCL161
- the publication recited in Table 1 e.g., International Patent Publication No. WO2008/016893 (e.g., Formula (I), Example 1, and Compound A), European Patent No.2051990, and U.S. Patent No.8,546,336.
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with LCL161 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a breast cancer or a pancreatic cancer; or a hematological malignancy, e.g., multiple myeloma or a hematopoeisis disorder.
- a cancer or disorder described in Table 1 e.g., a solid tumor, e.g., a breast cancer or a pancreatic cancer
- a hematological malignancy e.g., multiple myeloma or a hematopoeisis disorder.
- R 1 is H, C 1 -C 4 alkyl, C 2 -C 4 alkenyl, C 2 -C 4 alkynyl or C 3 -C 10 cycloalkyl, which R 1 may be unsubstituted or substituted;
- R 2 is H, C 1 -C 4 alkyl, C 2 -C 4 alkenyl, C 2 -C 4 alkynyl, C 3 -C 10 cycloalkyl which R 2 may be unsubstituted or substituted;
- R 3 is H, CF 3 , C 2 F 6 , C 1 -C 4 alkyl, C 2 -C 4 alkenyl, C 2 -C 4 alkynyl, CH 2 -Z, or
- R 2 and R 3 taken together with the nitrogen atom to which they are attached, form a heterocyclic ring, which alkyl, alkenyl, alkynyl or het ring may be unsubstituted or substituted;
- Z is H, OH, F, Cl, CH 3 , CH 2 CI, CH 2 F or CH 2 OH;
- R 4 is C 0-10 alkyl, C 0-10 alkenyl, C 0-10 alkynyl, C 3 -C 10 cycloalkyl, wherein the C 0-10 alkyl, or cycloalkyl group is unsubstituted or substituted;
- A is het, which may be substituted or unsubstituted
- D is C 1 -C 7 alkylene or C 2 -C 9 alkenylene, C(O), O, NR 7 , S(O)r, C(O)-C 1 -C 10 alkyl, 0-C 1 - C 10 alkyl, S(O)r-C r C 10 alkyl, C (O) C 0 -C 10 arylalkyl, OC 0 -C 10 arylalkyl, or S(O)r C 0 -C 10 arylalkyl, which alkyl and aryl groups may be unsubstituted or substituted;
- r is O, 1 or 2;
- a 1 is a substituted or unsubstituted aryl or unsubstituted or substituted het which substituents on aryl and het are halo, alkyl, lower alkoxy, NR 5 R 6 , CN, NO 2 or SR 5 ;
- each Q is independently H, C 1 -C 10 alkyl, C 1 -C 10 alkoxy, aryl C 1 -C 10 alkoxy, OH, O-C 1 - C 10 alkyl, (CH 2 ) 0 - 6 -C 3 -C 7 cycloalkyl, aryl, aryl C 1 -C 10 alkyl, O-(CH 2 ) 0 - 6 aryl, (CH 2 ) 1 - 6 het, het, O-(CH 2 ) 1-6 het, -OR 11 , C(O)R 11 , -C(O)N(R 11 )(R 12 ), N(R 11 )(R 12 J 1 SR 11 , S(O)R 111 S(O) 2 R 11 , S(O) 2 - N(R 11 )(R 12 ), or NR 11 -S(O) 2 -(R 12 ), wherein alkyl, cycloalkyl and
- n 0, 1 , 2 or 3, 4, 5, 6 or 7;
- het is a 5- to 7-membered monocyclic heterocyclic ring containing 1-4 heteroring atoms selected from N, O and S or an 8- to 12-membered fused ring system that includes one 5- to 7- membered monocyclic heterocyclic ring containing 1 , 2 or 3 heteroring atoms selected from N, O and S, which het is unsubstituted or substituted;
- R 11 and R 12 are independently H, C 1 -C 10 alkyl, (CH 2 ) 0 - 6 -C 3 -C 7 cycloalkyl, (CH 2 ) 0 - 6 - (CH) 0 - 1 (aryl) 1 .
- alkyl substituents of R 11 and R 12 may be unsubstituted or substituted by one or more substituents selected from C 1 -C 10 alkyl, halogen, OH, O-C 1 -C 6 alkyl, -S-C 1 -C 6 alkyl, CF 3 or NR 11 R 12 ;
- substituted cycloalkyl substituents of R 11 and R 12 are substituted by one or more substituents selected from a C 2 -C 10 alkene; C 1 -C 6 alkyl; halogen; OH; 0-C 1 - C 6 alkyl; S-C 1 -C 6 alkyl,CF 3 ; or NR 11 R 12 ;
- substituted het or substituted aryl of R 11 and R 12 are substituted by one or more substituents selected from halogen, hydroxy, C 1 -C 4 alkyl, C 1 -C 4 alkoxy, nitro, CNO-C(O)- C r C 4 alkyl and C(O)-O-C r C 4 -alkyl;
- R 5 , R 6 and R 7 are independently hydrogen, lower alkyl, aryl, aryl lower alkyl, cycloalkyl, or cycloalkyl lower alkyl, C(O)R 5 ; S(O)R 5 C(O)OR 5 C(O)N R 5 R 6 , and
- R 1 , R 2 , R 3 , R 4 , Q, and A and A 1 groups are independently halo, hydroxy, lower alkyl, lower alkenyl, lower alkynyl, lower alkanoyl, lower alkoxy, aryl, aryl lower alkyl, amino, amino lower alkyl, diloweralkylamino, lower alkanoyl, amino lower alkoxy, nitro, cyano, cyano lower alkyl, carboxy, lower carbalkoxy, lower alkanoyl, aryloyl, lower arylalkanoyl, carbamoyl, N-mono- or N,N-di lower alkyl carbamoyl, lower alkyl carbamic acid ester, amidino, guanidine, ureido, mercapto, sulfo, lower alkylthio, sulfoamino, sulfonamide, benzosulfonamide,
- R 8 and R 14 can be the same or different and are independently H or lower alkyl, or R 8 and R 14 , together with the N atom, form a 3- to 8-membered heterocyclic ring containing a nitrogen heteroring atoms and may optionally contain one or two additional heteroring atoms selected from nitrogen, oxygen and sulfur, which heterocyclic ring may be unsubstituted or substituted with lower alkyl, halo, lower alkenyl, lower alkynyl, hydroxy, lower alkoxy, nitro, amino, lower alkyl, amino, diloweralkyl amino, cyano, carboxy, lower carbalkoxy, formyl, lower alkanoyl, oxo, carbarmoyl, ⁇ /-lower or ⁇ /, ⁇ /- dilower alkyl carbamoyl, mercapto, or lower alkylthio; and
- R 9 , R 10 and R 13 are independently hydrogen, lower alkyl, halogen substituted lower alkyl, aryl, aryl lower alkyl, halogen substituted aryl, halogen substituted aryl lower alkyl.
- LCL161 has the following structure:
- LCL161 is (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4- fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2-oxoethyl)-2-(methylamino)propanamide.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a TOR kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the TOR kinase inhibitor is disclosed in Table 1, e.g., Rad-001, or in a publication recited in Table 1, e.g., in International Patent Publication No. WO 2014/085318 (e.g.,
- the TOR kinase inhibitor e.g., Rad-001
- the TOR kinase inhibitor has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., International Patent Publication No. WO 2014/085318 (e.g., Compound B).
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab,
- Pembrolizumab or MSB0010718C is used in combination with Rad-001 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a sarcoma, a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology)), a melanoma (e.g., an advanced melanoma), a digestive/gastrointestinal cancer, a gastric cancer, a neurologic cancer, a prostate cancer, a bladder cancer, a breast cancer; or a hematological malignancy, e.g., a lymphoma or leukemia.
- a solid tumor e.g., a sarcoma
- a lung cancer e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squam
- Rad-001 has the following structure:
- Rad-001 is ((1R, 9S, 12S, 15R, 16E, 18R, 19R, 21R, 23S, 24E, 26E, 28E, 30S, 32S, 35R)-1,18-dihydroxy-12- ⁇ (1R)-2-[(1S, 3R, 4R)-4-(2-hydroxyethoxy)-3- methoxycyclohexyl]-1-methylethyl ⁇ -19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36- dioxa-4-aza-tricyclo[30.3.1.04,9] hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentaone).
- the inhibitor of the immune checkpoint molecule is used in combination with a HDM2 ligase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the HDM2 ligase inhibitor is disclosed in Table 1, e.g., CGM097, or in a publication recited in Table 1, e.g., International Patent Publication No. WO2011/076786 (e.g., Formula (I) or Example 106).
- the HDM2 ligase inhibitor is disclosed, e.g., in International Patent Publication No.
- the HDM2 ligase inhibitor e.g., CGM097
- the HDM2 ligase inhibitor has the structure provided in Table 1 (compound or generic structure), or as disclosed in the publication recited in Table 1, e.g., International Patent Publication No. WO2011/076786 (e.g., Formula (I) or Example 106).
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab, Pembrolizumab or MSB0010718C
- the HDM2 ligase inhibitor is a compound of formula (I), or a tautomer or N-oxide or pharmaceutically acceptable salt or solvate thereof,
- Z is CH 2 or N-R 4 ;
- X is halogen
- R 4 is selected from the group consisting of H and C 1 -C 7 -alkyl
- R 6 is independently selected from the group consisting of H, R'O, and (R') 2 N;
- R 7 is independently selected from the group consisting of R'O and (R') 2 N;
- each R' is independently selected from the group consisting of H, C 1 -C 7 -alkyl, C 1 -C 7 - alkenyl, halo- C 1 -C 7 -alkyl, halo-C 1 -C 7 -alkenyl, C 3 -C 12 -cycloalkyl, heterocyclyl, aryl, hydroxy- C 1 -C 7 -alkyl, C 1 -C 7 -alkoxy-C 1 -C 7 alkyl, amino-C 1 -C 7 -alkyl, N- C 1 -C 7 -alkyl-amino- C 1 -C 7 -alkyl, N,N-di- C 1 -C 7 -alkyl-amino- C 1 -C 7 -alkyl, C 3 -C 12 -cycloalkyl- C 1 -C 7 -alkyl, heterocyclyl- C 1 -C 7 - alkyl,
- heterocyclyl-carbonyl- C 1 -C 7 -alkyl aryl-carbonyl- C 1 -C 7 -alkyl, C 1 -C 7 -alkyl-carbonyl-amino- C 1 - C 7 -alkyl, C 1 -C 7 -alkyl-carbonyl-N- C 1 -C 7 -alkyl-amino- C 1 -C 7 -alkyl, halo- C 1 -C 7 -alkyl–carbonyl- amino- C 1 -C 7 -alkyl, halo- C 1 -C 7 -alkyl-carbonyl-N- C 1 -C 7 -alkyl-amino- C 1 -C 7 -alkyl, wherein aryl, heterocyclyl and C 3 -C 12 -cycloalkyl are unsubstituted or substituted by 1-4 substituents selected from C 1 -C 7 -alky
- each R 1 is independently selected from the group consisting of halogen, cyano, nitro, C d- alkyl, C 1 -C 7 -alkenyl, halo- C 1 -C 7 -alkyl, hydroxyl, C 1 -C 7 -alkoxy, amino, N- C 1 -C 7 -alkyl-amino, N,N-di- C 1 -C 7 -alkyl-amino, amino-carbonyl-amino, N- C 1 -C 7 -alkyl-amino-carbonyl-amino, N.N-di- C 1 -C 7 -alkyl-amino-carbonyl-amino, C 1 -C 7 -alkyl-carbonyl-amino, amino-carbonyl, N- C 1 -C 7 -alkyl-amino-carbonyl, ⁇ , ⁇ -di- C 1 -C 7 -alkyl-
- R 2 is selected from
- phenyl, 2-pyridyl or 3-pyridyl being optionally substituted by 1-2 additional substituents selected from halogen, cyano, C 1 -C 7 -alkyl, halo- C 1 -C 7 -alkyl, hydroxyl, C 1 -C 7 -alkoxy, or hydroxy- C 1 -C 7 -alkyl;
- Z is a 4-6 membered heterocyclic ring, annulated to phenyl in para and meta position, containing 1-3 heteroatoms selected from N,O, S,which is optionally substituted by 1-2 additional substituents selected from halogen, cyano, C 1 -C 7 -alkyl, halo- C 1 -C 7 -alkyl, hydroxyl, C 1 -C 7 -alkoxy, hydroxyl- C 1 -C 7 -alkyl;
- each R 3 is independently selected from H, C 1 -C 7 -alkyl, hydroxy- C 1 -C 7 -alkyl, C 3 -C 12 - cycloalkyl, C 1 -C 7 -alkoxy- C 1 -C 7 -alkyl-carbonyl, amino-C 1 -C 7 -alkyl-carbonyl, N- C 1 -C 7 -alkyl- amino- C 1 -C 7 -alkyl-carbonyl, N, N-di-C 1 -C 7 -alkyl-amino- C 1 -C 7 -alkyl-carbonyl, (R 5 ) 2 N-C 3 -C 12 - cycloalkyl, (R 5 ) 2 N- C 1 -C 7 -alkyl, (R 5 ) 2 N-C 3 -C 12 -cycloalkyl-C 1 -C 7 -alkyl, (R 5 ) 2 N-C
- C 1 -C 7 -alkoxy amino, N- C 1 -C 7 -alkyl-amino, N,N-di- C 1 -C 7 -alkyl-amino, hydroxy-carbonyl, C 1 -C 7 -alkoxy-carbonyl, amino-carbonyl, N- C 1 -C 7 -alkyl-amino-carbonyl, N,N-di- C 1 -C 7 -alkyl-amino-carbonyl, C 1 -C 7 - alkyl-carbonyl, C 1 -C 7 -alkyl-sulphonyl, heterocyclyl, C 1 -C 7 -alkyl-carbonyl-amino, C 1 -C 7 -alkyl- carbonyl-N- C 1 -C 7 -alkyl-amino, and
- each R 5 is independently selected from H, C 1 -C 7 -alkyl, hydroxy- C 1 -C 7 -alkyl, C 1 -C 7 - alkyl-carbonyl, C 1 -C 7 -alkyl-carbonyl, C 1 -C 7 -alkyl-carbonyl- C 1 -C 7 -alkyl, amino-carbonyl- C 1 - C 7 -alkyl, N- C 1 -C 7 -alkyl-amino-carbonyl- C 1 -C 7 -alkyl, N,N-di- C 1 -C 7 -alkyl-amino-carbonyl- C 1 - C 7 -alkyl, C 1 -C 7 -alkyl-sulfonyl, amino-sulfonyl, N- C 1 -C 7 -alkyl-amino-sulfonyl, N,N-di- C 1 -C 7
- R 1 is ortho-chloro
- R 2 is selected from para- C 1 -C 7 -alkyl-phenyl, para-(halo- C 1 -C 7 -alkyl)-phenyl, para- C 1 -C 7 -alkoxy- phenyl, para-halo-phenyl, para-nitro-phenyl, para-(C 1 -C 7 -alkoxy-carbonyl)-phenyl, para- (hydroxy-carbonyl)-phenyl, wherein the phenyl is optionally substituted by 1-2 additional substituents, said substituents being independently selected from halo and methyl,
- R 6 and R 7 are not both ethoxy or methoxy.
- CGM097 has the following structure:
- CGM097 is (S)-1-(4-chlorophenyl)-7-isopropoxy-6-methoxy-2-(4- ⁇ methyl-[4-(4-methyl-3-oxo-piperazin-1-yl)-trans-cyclohexylmethyl]-amino ⁇ phenyl)-1,4- dihydro-2H-isoquinolin-3one.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a PIM kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the PIM kinase inhibitor is disclosed in Table 1, or in a publication recited in Table 1, e.g., International Patent Publication No. WO2010/026124 (e.g., Formula I or Example 70), European Patent Application No. EP2344474, and U.S. Patent Publication No.2010/0056576.
- the PIM kinase inhibitor is disclosed, e.g., in International Patent Publication No. WO2010/026124 (e.g., Formula I or Example 70), European Patent Application No. EP2344474, and U.S. Patent Publication No.2010/0056576.
- the PIM kinase inhibitor e.g., LGH447, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g.. International Patent
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab, Pembrolizumab or MSB0010718C
- the PIM kinase inhibitor is used in combination with the PIM kinase inhibitor to treat a cancer or disorder described in Table 1, e.g., hematological malignancy, e.g., multiple myeloma, myelodysplastic syndrome, myeloid leukemia, or non-Hodgkin lymphoma.
- the PIM kinase inhibitor is a compound of formula (I),
- X l , X 2 , X 3 and X 4 are independently selected from CR2 and N; provided that at least one but not more than two of X 1 , X 2 , X 3 and X 4 are N;
- Y is selected from a group consisting of cycloalkyl, partially unsaturated cycloalkyl, andiieterocycloalkyl, wherein each member of said group may be substituted with up to four substituents;
- Z 2 and Z 3 are independently selected from CR 12 and N; provided that not more than one of Z 2 and Z 3 can be N;
- R 1 is selected from the group consisting of hydrogen, -NHR 3 halo, hydroxyl, alkyl, cyano, and nitro;
- R 2 and R 12 independently at each occurrence are selected from the group consisting of hydrogen, halo, hydroxyl, nitro, cyano, SO 3 H and substituted or unsubstituted alkyl, alkenyl, alkynyl, alkoxy, amino, cycloalkyl, hetero cycloalkyl, and partially saturated cycloalkyl;
- R 3 is selected from the group consisting of hydrogen, -CO-R 4 and substituted or unsubstituted alkyl, cycloalkyl, heterocyclyl, aryl, and heteroaryl;
- R 4 is selected from the group consisting of alkyl, substituted alkyl, alkoxy, substituted alkoxy, amino, substituted amino, and alkylamino; and R 5 represents a group selected from substituted or unsubstituted aryl, C 3 -C 7 cycloalkyl, heteroaryl, partially unsaturated cycloalkyl and alkyl, wherein each said substituted R 5 group may be substituted with up to four substituents selected from halo, cyano, amino, C 1-4 alkyl, C 3-6 cycloalkyl, alkoxy, nitro, carboxy, carbonyl, carboalkoxy, aminocarboxy, substituted
- aminocarbonyl aminosulfonyl, substituted aminosulfonyl and alkoxy alkyl.
- LGH447 has the following structure:
- LGH447 is N-(4-((1R,3S,5S)-3-amino-5-methylcyclohexyl)pyridine- 3-yl)-6-(2,6-difluorophenyl)-3-fluoropicolinamide.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a HER3 kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the HER3 kinase inhibitor is disclosed in Table 1, e.g., LJM716, or in a publication recited in Table 1.
- the HER3 kinase inhibitor is disclosed, e.g., in International Patent Publication No.2012/022814 and U.S. Patent No.8,735,551.
- LJM716 is a monoclonal antibody provided in Table 1, or as disclosed in the publication recited in Table 1.
- the inhibitor of the immune checkpoint molecule e.g., one of Nivolumab, Pembrolizumab or MSB0010718C
- a cancer or disorder described in Table 1 e.g., a solid tumor, e.g. a gastric cancer, an esophageal cancer, a breast cancer, a head and neck cancer, a stomach cancer, or a digestive/gastrointestinal cancer therapy.
- the HER3 kinase inhibitor e.g., LJM716, is an anti-HER3 monoclonal antibody or antigen binding fragment thereof, that comprises a VH of SEQ ID NO: 141 and VL of SEQ ID NO: 140, as described in U.S.8,735,551.
- the HER3 kinase inhibitor, e.g., LJM716, is an anti-HER3 monoclonal antibody or antigen binding fragment thereof, that comprises a heavy chain variable region CDR1 of SEQ ID NO: 128;
- the HER3 kinase inhibitor e.g., LJM716, is an anti-HER3 monoclonal antibody or antigen binding fragment thereof, that recognizes a conformational epitope of a HER3 receptor, e.g., the conformational epitope comprises amino acid residues 265-277, and 315 within domain 2 and amino acid residues 571, 582-584, 596-597, 600-602, and 609-615 within domain 4 of the HER3 receptor of SEQ ID NO: 1 of U.S.
- the amino acid sequences of the heavy and light chain variable regions of LJM716 include at least the following: Heavy chain variable region (SEQ ID NO: 141 as disclosed in U.S.8,735,551) (SEQ ID NO: 8) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSQGKSTYYADSV KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGDEGFDIWGQGTLVTVSS Light chain variable region (SEQ ID NO: 140 as disclosed in U.S.8,735,551) (SEQ ID NO: 9) DIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIYGASSLQSGVPSRFSG SGSGTDFTLTISSLQPEDFATYYCQQYSSFPTTFGQGTKVEIK
- the inhibitor of the immune checkpoint molecule is used in combination with a
- the HDAC inhibitor is disclosed in Table 1, e.g., LBH589, or in a publication recited in Table 1, e.g., in International Patent Publication Nos.2014/072493 and 2002/022577 (e.g., formula (I) and Example 200) and European Patent Application No. EP1870399.
- the HDAC inhibitor is disclosed, e.g., in International Patent Publication Nos. 2014/072493 and 2002/022577 (e.g., formula (I) and Example 200) and European Patent Application No. EP1870399.
- LBH589 has the structure (compound or generic) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., in
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with LBH589 to treat a cancer or disorder described in Table 1, e.g., a solid tumor,e.g., a bone cancer, a small cell lung cancer, a respiratory/thoracic cancer a prostate cancer, a non-small cell lung cancer (NSCLC), a nerologic cancer, a gastric cancer, a melanoma, a breast cancer, a pancreatic cancer, a colorectal cancer, a renal cancer, or a head and neck cancer, or a liver cancer; or a hematological malignancy, e.g., multiple myeloma, a hematopoeisis disorder,
- a solid tumor e.g., a bone cancer, a small cell lung cancer, a respiratory/thoracic cancer a prostate cancer, a non-small cell lung cancer (
- the HDAC inhibitor is a compound of formula (I):
- R 1 is H, halo, or a straight chain C 1 -C 6 alkyl (especially methyl, ethyl or n-propyl, which methyl, ethyl and n-propyl substituents are unsubstituted or substituted by one or more substituents described below for alkyl substituents);
- R 2 is selected from H, C 1 -C 10 alkyl, (e.g. methyl, ethyl or -CH 2 CH 2 -OH), C 4 - C 9 cycloalkyl, C 4 -C 9 heterocycloalkyl, C 4 -C 9 heterocycloalkylalkyl, cycloalkylalkyl (e.g., cyclopropylmethyl), aryl, heteroaryl, arylalkyl (e.g. benzyl), heteroarylalkyl (e.g.
- R 5 is selected from H, C 1 -C 6 alkyl, C 4 -C 9 cycloalkyl, C 4 -C 9 heterocycloalkyl, acyl, aryl, heteroaryl, arylalkyl (e.g., benzyl), heteroarylalkyl (e.g., pyridylmethyl), aromatic polycycles, non
- n, n 1 , n 2 , and n 3 are the same or different and independently selected from 0 - 6, when n1 is 1-6, each carbon atom can be optionally and independently substituted with R 3 and/or R 4 ;
- X and Y are the same or different and independently selected from H, halo, C 1 -C 4 alkyl, such as CH 3 and CF 3, NO 2 , C(O)R 1 , OR 9 , SR 9 , CN, and NR 10 R 11 ;
- R 6 is selected from H, C 1 -C 6 alkyl, C 4 - C 9 cycloalkyl, C 4 - C 9 heterocycloalkyl, cycloalkylalkyl (e.g., cyclopropylmethyl), aryl, heteroaryl, arylalkyl (e.g., benzyl, 2- phenylethenyl), heteroarylalkyl (e.g., pyridylmethyl), OR 12 , and NR 13 R 14 ;
- R 7 is selected from OR 15 , SR ⁇ 5 , S(O)R 16 , SO 2 R 17 , NR 13 R ⁇ 4 , and NR 12 SO 2 R 6 ;
- R 8 is selected from H, OR 15 , NR 13 R 14 , C 1 -C 6 alkyl, C 4 - C 9 cycloalkyl, C 4 -C 9
- heterocycloalkyl aryl, heteroaryl, arylalkyl (e.g., benzyl), and heteroarylalkyl (e.g.,
- R 9 is selected from C 1 -C 6 alkyl, for example, CH 3 and CF 3 , C(O)-alkyl, for example C(O)CH 3 , and C(O)CF 3 ;
- R 10 and R 11 are the same or different and independently selected from H, C 1 -C 4 alkyl, and -C(O)-alkyl;
- R 12 is selected from H, C 1 -C 6 alkyl, C 4 - C 9 cycloalkyl, C 4 - C 9 heterocycloalkyl, C 4 - C 9 heterocycloalkylalkyl, aryl, mixed aryl and non-aryl polycycle, heteroaryl, arylalkyl (e.g., benzyl), and heteroarylalkyl (e.g., pyridylmethyl);
- R 13 and R 14 are the same or different and independently selected from H, C 1 -C 6 alkyl, C 4 -C 9 cycloalkyl, C 4 - C 9 heterocycloalkyl, aryl, heteroaryl, arylalkyl (e.g., benzyl), heteroarylalkyl (e.g., pyridylmethyl), amino acyl, or R 13 and R 14 together with the nitrogen to which they are bound are C 4 - C 9 heterocycloalkyl, heteroaryl, polyheteroaryl, non-aromatic polyheterocycle or mixed aryl and non-aryl polyheterocycle;
- R 15 is selected from H, Ci-Ce alkyl, C 4 - C 9 cycloalkyl, C 4 - C 9 heterocycloalkyl, aryl, heteroaryl, arylalkyl, heteroarylalkyl and (CH 2 ) m ZR 12 ;
- R 16 is selected from C 1 -C 6 alkyl, C 4 -C 9 cycloalkyl, C 4 -C 9 heterocycloalkyl, aryl, heteroaryl, polyheteroaryl, arylalkyl, heteroarylalkyl and (CH 2 ) m ZR ⁇ 2 ;
- R 17 is selected from C 1 -C 6 alkyl, C 4 - C 9 cycloalkyl, C 4 - C 9 heterocycloalkyl, aryl, aromatic polycycles, heteroaryl, arylalkyl, heteroarylalkyl, polyheteroaryl and
- n is an integer selected from 0 to 6;
- LBH589 has the following structure:
- LBH589 is (E)-N-hydroxy-3-(4-(((2-(2-methyl-1H-indol-3- yl)ethyl)amino)methyl)phenyl)acrylamide.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a Janus kinase inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the Janus kinase inhibitor is disclosed in Table 1, e.g., INC424, or in a publication recited in Table 1, e.g., in International Patent Publication Nos.
- WO2007/070514 e.g., Formula (I) or Example 67
- WO2014/018632 European Patent Application No. EP2474545, and U.S. Patent No.7,598,257
- the Janus kinase inhibitor is disclosed, e.g., in International Patent Publication Nos.2007/070514 (e.g., Formula (I) or Example 67) and 2014/018632, European Patent Application No. EP2474545, and U.S. Patent No.7,598,257.
- the Janus kinase inhibitor e.g., INC424, has the structure (compound or generic) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., in
- the inhibitor of the immune checkpoint molecule (e.g., one of Nivolumab, Pembrolizumab or MSB0010718C) is used in combination with INC424 to treat a cancer or disorder described in Table 1, e.g., a solid tumor,e.g., a prostate cancer, a lung cancer, a breast cancer, a pancreatic cancer, a colorectal cancer; or a hematological malignancy, e.g., multiple myeloma, lymphoma (e.g., non-Hodgkin's lymphoma), or leukemia (e.g., myeloid leukemia, lymphocytic leukemia).
- the cancer has, or is identified as having, a JAK mutation.
- the JAK mutation is a JAK2 V617F mutation.
- the Janus kinase inhibitor is a compound of Formula (I):
- a 1 and A 2 are independently selected from C and N;
- T, U, and V are independently selected from O, S, N, CR 5 , and NR 6 ; wherein the 5- membered ring formed by A 1 , A 2 , U, T, and V is aromatic;
- X is N or CR 4 ;
- Y is C 1-8 alkylene, C 2-8 alkenylene, C 2-8 alkynylene, (CR 11 R 12 )p-(C 3-10 cycloalkylene)- (CR 11 R I2 ) q , (CR l I R 12 ) p -(arylene)-(CR 11 R 12 ) q , (CR 11 R 12 ) p -(C 1-10 heterocycloalkylene)-(CR 11 R 12 ) q , (CR 11 R 12 )p-(heteroarylene)-(CR 11 'R 12 ) q , (CR 11 R 12 )pO(CR 11 R 12 ), (CR 11 R 12 ) p S(CR 11 R 12 ), (CR 11 R 12 ) p C(O)(CR 11 R 12 ) q , (CR 1 (CR 1 I R 12 ) p C(O)NR c (CR I 1 R 12 ) q , (CR 11 R I2 ) p C(
- W is C 1-8 alkylenyl, C 2-8 alkenylenyl, C 2-8 alkynylenyl, O, S , C(O), C(O)NR c' , C(O)O, OC(O), OC(O)NR c’ , NR c’ , NR c’ C(O)NR d’ , S(O), S(O)NR c' , S(O) 2 , or S(O) 2 NR c" ;
- Q is H, halo, CN, NO 2 , Ci -8 alkyl, C 2- S alkenyl, C 2-8 alkynyl, d. 8 haloalkyl, halosulfanyl, aryl, cycloalkyl, heteroaryl, or heterocycloalkyl, wherein said C 1-8 alkyl, C 2-8 alkenyl, C 2-8 alkynyl, Ci -8 haloalkyl, aryl, cycloalkyl, heteroaryl, or heterocycloalkyl is optionally substituted with 1, 2, 3 or 4 substituents independently selected from halo, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, C 1-4 haloalkyl, halosulfanyl, C 1-4 hydroxyalkyl, C 1-4 cyanoalkyl, Cy 2 , CN, NO 2 , OR 3' , SR a' , C(O)R b" , C
- Cy 1 and Cy 2 are independently selected from aryl, heteroaryl, cycloalkyl, and
- heterocycloalkyl each optionally substituted by 1, 2, 3, 4 or 5 substituents independently selected from halo, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, C 1-4 haloalkyl, halosulfanyl, C 1-4 hydroxyalkyl, C 1-4 cyanoalkyl, CN, NO 2 , 0R a" , SR a" , C(O)R b" , C(O)NR c" R d" , C(O)OR 3" ,
- R 1 , R 2 , R 3 , and R 4 are independently selected from H, halo, C 1-6 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, C 1-6 haloalkyl, halosulfanyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, CN, NO 2 , OR 7 , SR 7 , C(O)R 8 , C(O)NR 9 R 10 , C(O)OR 7 OC(O)R 8 , OC(O)NR 9 R 10 , NR 9 R 10 , NR 9 C(O)R 8 , NR 0 C(O)OR 7 , S(O)R 8 , S(O)NR 9 R 10 , S(O) 2 R 8 , NR 9 S(O) 2 R 8 , and S(O) 2 NR 9 R 10 ;
- R 5 is H, halo, C )-4 alkyl, C 2-4 alken
- R 6 is H, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, C 1-4 haloalkyl, OR 7 , C(O)R 8 , C(O)NR 9 R 10 , C(O)OR 7 , S(O)R 8 , S(O)NR 9 R 10 , S(O) 2 R 8 , or S(O) 2 NR 9 R 10 ;
- R 7 is H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl;
- R 8 is H, C 1-6 alkyl, Ci -6 haloalkyl, C 2-6 alkenyl, C 2 . 6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl;
- R 9 and R 10 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2 . 6 alkynyl, C 1-6 alkylcarbonyl, arylcarbonyl, C 1-6 alkylsulfonyl, arylsulfonyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl and
- R 9 and R 10 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group
- R 11 and R 12 are independently selected from H and - ⁇ ⁇ - ⁇ 2 - ⁇ 3 - ⁇ 4 ;
- D 1 and E 1 are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2 . 6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene, wherein each of the Ci -6 alkylene, C 2-6 alkenylene, C 2 . 6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, CN, NO 2 , N 3 , SCN, OH, Ci. 6 alkyl, C 1-6 haloalkyl, C 2 . 8 alkoxyalkyl, C 1-6 alkoxy, C 1-6 haloalkoxy, amino, C 1-6 alkylamino, and C 2-8 dialkylamino;
- D 2 and E 2 are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, (C 1-6 alkylene) r -O-(C 1-6 alkylene) s , (C 1-6 alkylene) r -S-( C 1-6 alkylene) s , (C 1-6 alkylene) r -NR e -(C 1-6 alkylene) s , (C , .
- D 3 and E 3 are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene, wherein each of the C )-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, CN, NO 2 , N 3 , SCN, OH, C 1-6 alkyl, C 1-6 haloalkyl, C 2-8 alkoxyalkyl, C 1-6 alkoxy, C 1-6 haloalkyl, amino, C 1-6 alkylamino, and C 2-8 dialkylamino;
- R a is H, Cy 1 , -(C 1-6 alkyl)-Cy 1 , C -6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, or C 2 . 6 alkynyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and heterocycloalkyl;
- R b is H, Cy 1 , -(C 1-6 alkyl)-Cy', C 1-6 alkyl, C 1-6 haloalkyl, C 2 . 6 alkenyl, C 2-6 alkynyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2 . 6 alkenyl, or C 2 . 6 alkynyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and
- R a’ and R a" are independently selected from H, Ci -6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl and heterocycloalkylalkyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl
- R b’ and R b” are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2- 6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl and heterocycloalkylalkyl wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and heterocycloalkyl;
- R c and R d are independently selected from H, Cy 1 , -(C 1-6 alkyl)-Cy', C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, or C 2-6 alkynyl, is optionally substituted with 1, 2, or 3 substituents independently selected from Cy 1 , - (C 1-6 alkyl)-Cy', OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, and halosulfanyl;
- R c and R d together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group optionally substituted with 1, 2, or 3 substituents
- R c’ and R d’ are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2- 6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl and heterocycloalkylalkyl wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and heterocycloalkyl;
- R c’ and R d’ together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group optionally substituted with 1, 2, or 3 substituents
- R c” and R d are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2- 6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl and heterocycloalkylalkyl wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2 - 6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and heterocycloalkyl;
- R c and R d together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents
- R independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 haloalkyl, halosulfanyl, aryl, arylalkyl, heteroaryl, heteroarylalkyl, cycloalkyl and heterocycloalkyl;
- R j is H, CN, NO 2 , or C 1-6 alkyl
- R e and R f are independently selected from H and C 1-6 alkyl
- R i is H, CN, or NO 2 ;
- n 0 or 1 ;
- n 0 or 1
- p 0, 1, 2, 3, 4, 5, or 6;
- q 0, 1, 2, 3, 4, 5 or 6;
- r is 0 or 1;
- INC424 has the following structure:
- INC424 is (3R)-3-cyclopentyl-3-[4-(7H-pyrrolo-[2,3-d]pyrimidin-4- yl)-1H-pyrazol-1-yl]propanenitrile.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with an FGF receptor inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the FGF receptor inhibitor is disclosed in Table 1, e.g., BUW078, or in a publication recited in Table 1, e.g., International Patent Publication No.
- the FGF receptor inhibitor e.g., BUW078, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g.,
- the FGF receptor inhibitor is disclosed in Table 1, e.g., BGJ398, or in a publication recited in Table 1, e.g., U.S.8,552,002 (e.g., Example 145 or Formula (I) in column 6).
- the FGF receptor inhibitor e.g., BGJ398, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., U.S.8,552,002 (e.g., Example 145 or Formula (I) in column 6).
- MSB0010718C is used in combination with BUW078 or BGJ398 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a digestive/gastrointestinal cancer; or a hematological cancer.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a digestive/gastrointestinal cancer; or a hematological cancer.
- the FGF receptor inhibitor is a compound of Formula (I):
- X represents N or CH
- R 1 represents hydrogen, halogen, alkyl, alkyl substituted with saturated heterocyclyl which is unsubstituted or substituted by alkyl, amino, mono-substituted amino wherein the substituent is selected from the group consisting of alkyl, aminoalkyl, alkylaminoalkyl, dialkylaminoalkyl, di-substituted amino wherein the substituents are selected from the group consisting of alkyl, aminoalkyl, alkylaminoalkyl, dialkylaminoalkyl, alkoxy, substituted alkoxy wherein the substituents are selected from the group consisting of halo and alkoxy;
- R 2 represents hydrogen, halogen, alkyl, alkyl substituted with saturated heterocyclyl which is unsubstituted or substituted by alkyl, amino, mono-substituted amino wherein the substituent is selected from the group consisting of alkyl, aminoalkyl, alkylaminoalkyl, dialkylaminoalkyl, di-substituted amino wherein the substituents are selected from the group consisting of alkyl, aminoalkyl, alkylaminoalkyl, dialkylaminoalkyl, alkoxy, substituted alkoxy wherein the substituents are selected from the group consisting of halo and alkoxy;
- A represents aryl or heteroaryl;
- B represents aryl or heteroaryl
- R A1 represents hydrogen or a substituent different from hydrogen
- R A2 represents a direct bond or an alkanediyl
- R B1 represents hydrogen or a substituent different from hydrogen
- R represents a direct bond or aminocarbonyl
- n represents an integer selected from 0 to 3;
- n an integer selected from 0 to 5;
- BUW078 has the following structure:
- BUW078 is 8-(2,6-difluoro-3,5-dimethoxy-phenyl)-quinoxaline-5- carboxylic acid (4-dimethylaminomethyl-1H-imidazol-2-yl)-amide.
- the FGF receptor inhibitor has the following structure:
- n 0, 1, 2, 3, 4 or 5;
- X, Y and Z are each independently selected from N or C-R 5 , wherein at least two of X, Y and Z are N;
- X 1 is oxygen
- hydroxyguanidino formamidino; isothioureido; ureido; mercapto; C(O)H or other acyl; acyloxy; substituted hydroxy; carboxy; sulfo; sulfamoyl; carbamoyl; a substituted or unsubstituted cyclic group, for example the cyclic group (whether substituted or unsubstituted) may be cycloalkyl, e.g.
- cyclohexyl phenyl, pyrrole, imidazole, pyrazole, isoxazole, oxazole, thiazole, pyridazine, pyrimidine, pyrazine, pyridyl, indole, isoindole, indazole, purine, indolizidine, quinoline, isoquinoline, quinazoline, pteridine, quinolizidine, piperidyl, piperazinyl, pyrollidine, morpholinyl or thiomorpholinyl and, for example, substituted lower aliphatic or substituted hydroxy may be substituted by such substituted or unsubstituted cyclic groups;
- -L 1 - having 1, 2, 3, 4 or 5 in-chain atoms (e.g. selected from C, N, O and S) and optionally being selected from (i) C 1 , C 2 , C 3 or C 4 alkyl, such an alkyl group optionally being interrupted and/or terminated by
- R a is hydrogen, hydroxy, hydrocarbyloxy or hydrocarbyl, wherein hydrocarbyl is optionally interrupted by an -O- or -NH- linkage and may be, for example, selected from an aliphatic group (e.g., having 1 to 7 carbon atoms, for example 1, 2, 3, or 4), cycloalkyl, especially cyclohexyl, cycloalkenyl, especially cyclohexenyl, or another carbocyclic group, for example phenyl; where the hydrocarbyl moiety is substituted or unsubstituted;
- each R 4 is the same or different and selected from an organic or inorganic moiety, for example, each R 4 is the same or different and selected from halogen; hydroxy; protected hydroxy for example trialkylsilylhydroxy; amino; amidino; guanidino; hydroxyguanidino; formamidino; isothioureido; ureido; mercapto; C(O)H or other acyl; acyloxy; carboxy; sulfo; sulfamoyl;
- X is CR 5 , wherein R 5 is H; X1 is oxygen; Y is N; Z is N; R 1 is a substituted organic moiety is a cyclic group (e.g., phenyl) substituted with 4-ethylpiperazinyl and –L 1 - is N Ra , wherein N Ra is H; R 2 is an organic moiety (e.g., H); R 3 is an organic moiety (e.g., lower aliphatic, e.g., methyl); R 4 is chloro or methoxy; and n is 4.
- R 5 is H
- X1 is oxygen
- Y is N
- Z is N
- R 1 is a substituted organic moiety is a cyclic group (e.g., phenyl) substituted with 4-ethylpiperazinyl and –L 1 - is N Ra , wherein N Ra is H;
- R 2 is an organic moiety (e.g., H);
- BGJ398 has the following structure:
- BGJ398 is 3-(2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4-(4- ethylpiperazin-1-yl)phenyl)amino)pyrimidin-4-yl)-1-methylurea.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with an EGF receptor inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the EGF receptor inhibitor is disclosed in Table 1, e.g., EGF816, or in a publication recited in Table 1, e.g., in WO 2013/184757 (e.g., Formula (5), in claims 7, 10, 11 and 12, or in Example 5).
- the EGF receptor inhibitor, e.g., EGF816, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., in WO 2013/184757 (e.g., Formula (5), in claims 7, 10, 11 and 12, or in Example 5).
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with EGF816 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)).
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)).
- NSCLC non-small cell lung cancer
- EGF816 is administered at an oral dose of about 50 to 500 mg, e.g., about 100 mg to 400 mg, about 150 mg to 350 mg, or about 200 mg to 300 mg, e.g., about 100 mg, 150 mg or 200 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- EGF816 is administered at an oral dose from about 100 to 200 mg, e.g., about 150 mg, once a day.
- the EGF receptor inhibitor is of formula:
- W 1 and W 2 are independently CR 1 or N;
- R 1 , R 1’ and R 2 are independently hydrogen; halo; cyano; C 1-6 alkyl; C 1-6 haloalkyl; 5-6 membered heteroaryl comprising 1-4 heteroatoms selected from N, O and S; phenyl, 5-6 membered heterocyclyl comprising 1-2 heteroatoms selected from N, O, S and P, and optionally substituted by oxo; - X 1 -C(O)OR 3 ; -X 1 -O-C(O)R 3 ; -X 1 -C(O)R 3 ; -X 1 -C(O)NR 4 R 5 ; -X 1 -C(O)NR 4 - X 3 -C(O)OR 3 ; -X 1 -C(O)NR 4 -X 3 -S(O) 0 - 2 R 6 ; -X 1 -NR 4 R 5 ; -X 1 -NR 4 -X 2 -C(O)R
- R 3 , R 4 and R 5 are independently hydrogen, C 1-6 alkyl or C 1-6 haloalkyl; or wherein R 4 and R 5 together with N in NR 4 R 5 may form a 4-7 membered ring containing 1-2 heteroatoms selected from N, O, S and P, and optionally substituted with 1-4 R 7 ;
- R 6 is C 1-6 alkyl or C 1-6 haloalkyl
- R 6a and R 6b are independently hydroxy, C 1-6 alkyl, C 1-6 haloalkyl, C 1-6 alkoxy, C 1-6 haloalkoxy, 6-10 membered monocyclic or bicyclic aryl; a 5-10 membered heteroaryl comprising 1-4 heteroatoms selected from N, O and S; or a 4-12 membered monocyclic or bicyclic heterocyclyl comprising 1-4 heteroatoms selected from N, O and S, and optionally substituted with oxo; R 8 is
- X 1 and X 2 are independently a bond or C 1-6 alkyl
- X 3 is C 1-6 alkyl
- X 4 is C 2-6 alkyl
- R 12 , R 13 , R 16 and R 17 are independently hydrogen or C 1-6 alkyl
- R 14 and R 15 are independently hydrogen; C 1-6 alkyl; -C(O)O-(C 1-6 alkyl); C 3-7 cycloalkyl unsubstituted or substituted with C 1-6 alkyl; or R 14 and R 15 together with N in NR 14 R 15 may form a 4-7 membered ring containing 1-2 heteroatoms selected from N, O, S, and P, and optionally substituted with 1-4 R 18 groups;
- R 7 and R 18 are independently oxo, halo, hydroxyl, C 1-6 alkyl or C 1-6 alkoxy; and m and q are independently 1-2;
- R 1 and R 1’ are independently hydrogen; methyl; t-butyl;
- R 2 is hydrogen; chloro; methyl; trifluoromethyl; methoxy;
- piperidinylmethyl ((4-methyl-3-oxo-piperazin-lyl)methyl); ((4-acetylpiperazin-1-yl)methyl); (1,1-dioxidothiomorpholine-4-carbonyl); pyrrolidinyl carbonyl unsubstituted or substituted by 1- 2 hydroxy; pyrrolidinylethoxy; (l,l-dioxidothiomorpholino)methyl; or 1,2,4-oxadiazolyl unsubstituted or substituted by C 1-6 alkyl;
- R 2 is -CH 2 -N(CH 3 )-C(O)-CH 3 ; -CH 2 -O-(CH 2 ) 2 -OCH 3 ; -CH 2 -N(CH 3 )- (CH 2 ) 2 -SO 2 (CH 3 ); -C(O)NH-(CH 2 ) 1 . 2 -C(O)-OCH 3 ; -C(O)NH-(CH 2 ) 1 . 2 -C(O)OH; or -C(O)NH- (CH 2 ) 2 -SO 2 (CH 3 ).
- R 8 is
- R 14 and R 15 are independently hydrogen, C 1-6 alkyl or C 3-7 cycloalkyl; or R 14 and R 15 together with N in NR 14 R 15 may form an azetidinyl, piperidyl, pyrrolidinyl or morpholinyl; where said azetidinyl or pyrrolidinyl can be optionally substituted with 1-2 halo, methoxy or hydroxyl; and
- R 12 and R 13 are independently hydrogen, halo, cyano, C 1-6 alkyl or C 1-6 haloalkyl;
- R 16 and R 17 are independently hydrogen or C 1-6 alkyl; or R 16 and R 17 together with the carbon to which they are attached may form a C 3-6 cycloalkyl.
- the EGF receptor inhibitor has the following structure: or
- EGF816 has the followin structure:
- EGF816 is (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2- enoyl)azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a c-MET inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the c-MET inhibitor is disclosed in Table 1, e.g., INC280, or in a publication recited in Table 1, e.g., in EP 2099447 (e.g., in claim 1 or 53) or US 7,767,675 (e.g., in claim 4).
- the c-MET inhibitor e.g., INC280, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with INC280 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non- small cell lung cancer (NSCLC)), glioblastoma multiforme (GBM), a renal cancer, a liver cancer or a gastric cancer.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non- small cell lung cancer (NSCLC)), glioblastoma multiforme (GBM), a renal cancer, a liver cancer or a gastric cancer.
- the cancer has, or is identified as having, a c-MET mutation (e.g., a c-MET mutation or a c-MET amplification).
- INC280 is administered at an oral dose of about 100 to 1000 mg, e.g., about 200 mg to 900 mg, about 300 mg to 800 mg, or about 400 mg to 700 mg, e.g., about 400 mg, 500 mg or 600 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- INC280 is administered at an oral dose from about 400 to 600 mg twice a day.
- the c-MET inhibitor has the following structure:
- A is N or CR 3 ;
- Cy 1 is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, each optionally substituted by 1, 2, 3, 4, or 5 ⁇ W-X-Y-Z;
- Cy 2 is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, each optionally substituted by 1, 2, 3, 4, or 5 -W'-X'-Y'-Z';
- L 1 is (CR 4 R 5 ) m , (CR 4 R 5 ) p -(cycloalkylene)-(CR 4 R 5 ) q , (CR 4 R 5 ) p -(arylene)-(CR 4 R 5 ) q , (CR 4 R 5 ) p -(heterocycloalkylene)-(CR 4 R 5 ) q , (CR 4 R 5 ) p -(heteroarylene)-(CR 4 R 5 ) q ,
- R 1 is H or ⁇ W"-X"-Y"-Z"
- R 2 is H, halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, CN, NO 2 , OR A , SR A , C(O)R B , C(O)NR C R D , C(O)OR A , OC(O)R B , OC(O)NR C R D , NR C R D , NR C C(O)R B
- R 3 is H, cycloalkyl, aryl, heterocycloalkyl, heteroaryl, halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, , CN, NO 2 , OR A , SR A , C(O)R B , C(O)NR C R D , C(O)OR A , OC(O)R B , OC(O)NR C R D , NR C R D , NR C C(O)R B , NR C C(O)NR C R D , NR C C(O)OR A , S(O)R B , S(O)NR C R D , S(O) 2 R B , NR C S(O) 2 R B , and S(O) 2 NR C R D ; wherein said cycloalkyl, aryl, heterocycloalkyl, heteroaryl, or C 1-6 alky
- R 2 and ⁇ L 2 -Cy 2 are linked together to form a group of formula:
- ring B is a fused aryl or fused heteroaryl ring, each optionally substituted with 1, 2, or 3 -W'-X'-Y'-Z';
- R 4 and R 5 are independently selected from H, halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 alkoxy, alkoxyalkyl, cyanoalkyl, heterocycloalkyl, cycloalkyl, C 1-6 haloalkyl, CN, and NO 2 ;
- R 7 and R 8 are independently selected from H, halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 alkoxy, C 1-6 haloalkyl, CN, and NO 2 ;
- R 7 and R 8 together with the C atom to which they are attached form a 3, 4, 5, 6, or 7 - membered cycloalkyl or heterocycloalkyl ring, each optionally substituted by 1, 2, or 3 substituent independently selected from halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 alkoxy, C 1-6 haloalkyl, CN, and NO 2 ;
- R 9 is H, C 1-6 alkyl, C 2-6 alkenyl, or C 2-6 alkynyl;
- W, W', and W" are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, O, S, NR h , CO, COO, CONR h , SO, SO 2 , SONR h and
- each of the C 1-6 alkylene, C 2-6 alkenylene, and C 2-6 alkynylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, C 1-6 alkyl, C 1-6 haloalkyl, OH, C 1-6 alkoxy, C 1-6 haloalkoxy, amino, C 1-6 alkylamino, and C 2-8 dialkylamino;
- X, X', and X" are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene, wherein each of the C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, CN, NO 2 , OH, C 1-6 alkyl, C 1-6 haloalkyl, C 2-8 alkoxyalkyl, C 1-6 alkoxy, C 1-6 haloalkoxy, C 2-8 alkoxyalkoxy, cycloalkyl, heterocycloalkyl, C(O)OR j , C(O)NR h R i , amino, C 1-6 alkylamino, and C 2-8 dialkylamin
- Y, Y', and Y" are independently absent or independently selected from C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, O, S, NR h , CO, COO, CONR h , SO, SO 2 , SONR h , and NR h CONR i , wherein each of the C 1-6 alkylene, C 2-6 alkenylene, and C 2-6 alkynylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, C 1-6 alkyl, C 1-6 haloalkyl, OH, C 1-6 alkoxy, C 1-6 haloalkoxy, amino, C 1-6 alkylamino, and C 2-8 dialkylamino;
- heterocycloalkyl ring each optionally substituted by 1, 2, or 3 substituents independently selected from halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, halosulfanyl, CN, NO 2 , OR a3 , SR a3 , C(O)R b3 , C(O)NR c3 R d3 , C(O)OR a3 , OC(O)R b3 , OC(O)NR c3 R d3 , NR c3 R d3 ,
- heterocycloalkyl ring each optionally substituted by 1, 2, or 3 substituents independently selected from halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, halosulfanyl, CN, NO 2 , OR a3 , SR a3 , C(O)R b3 , C(O)NR c3 R d3 , C(O)OR a3 , OC(O)R b3 , OC(O)NR c3 R d3 , NR c3 R d3 ,
- Cy 4 , and Cy 5 are independently selected from aryl, cycloalkyl, heteroaryl, and
- R A is H, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl wherein said C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl or heteroaryl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R B is H, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl wherein said C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R C and R D are independently selected from H, C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, wherein said C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R C and R D together with the N atom to which they are attached form a 4-, 5-, 6- or 7 - membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R a , R a1 , R a2 , R a3 , and R a4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl,
- heteroarylalkyl, cycloalkylalkyl, and heterocycloalkylalkyl wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2 - 6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R b , R b1 , R b2 , R b3 , and R b4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl,
- heteroarylalkyl, cycloalkylalkyl, and heterocycloalkylalkyl wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy; R c and R d are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, ary
- heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkyl;
- R c and R d together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c1 and R d1 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1- 6 haloalkoxy;
- R c1 and R d1 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c2 and R d2 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl heterocycloalkylalkyl, arylcycloalkyl, arylheterocycloalkyl, arylheteroaryl, biaryl, heteroarylcycloalkyl, heteroarylheterocycloalkyl, heteroarylaryl, and biheteroaryl, wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkylalkyl, heterocycloalkylalkyl, wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalky
- arylcycloalkyl arylheterocycloalkyl, arylheteroaryl, biaryl, heteroarylcycloalkyl
- heteroarylheterocycloalkyl, heteroarylaryl, and biheteroaryl are each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, C 1-6 haloalkoxy, hydroxyalkyl, cyanoalkyl, aryl, heteroaryl, C(O)OR a4 , C(O)R b4 , S(O) 2 R b3 , alkoxyalkyl, and alkoxyalkoxy;
- R c2 and R d2 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 baloalkyl, C 1-6 haloalkoxy, hydroxyalkyl, cyanoalkyl, aryl, heteroaryl, C(O)OR a4 , C(O)R b4 , S(O) 2 R b3 , alkoxyalkyl, and alkoxyalkoxy;
- R c3 and R d3 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1- 6 haloatkoxy;
- R c3 and R d3 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c4 and R d4 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2- 6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl,
- cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1- 6 haloalkoxy;
- R c4 and R d4 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R e , R e1 , R e2 , and R e4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, (C 1-6 alkoxy)-C 1-6 alkyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, and heterocycloalkylalkyl;
- R f , R f1 , R f2 , and R f4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, and heterocycloalkyl;
- R g is H, CN, and NO 2 ;
- R h and R i are independently selected from H and C 1-6 alkyl
- R j is H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl;
- n 0, 1, 2, 3, 4, 5, or 6;
- p 0, 1, 2, 3, or 4;
- q 0, 1, 2, 3, or 4;
- r is 0, 1, 2, 3, 4, 5, or 6;
- s 0, 1, 2, 3, or 4;
- t 0, 1, 2, 3, or 4;
- L 1 is (CR 4 R 5 ) m , wherein R 4 and R 5 are independently H and m is 1; Cy 1 is heteroaryl; R 1 is H; A is N; R 2 is H; L 2 is (CR 7 R 8 ) r ,wherein r is 0; and Cy 2 is aryl substituted with 2 W'-X'-Y'-Z'.
- INC280 has the following structure:
- INC280 is 2-fluoro-N-methyl-4-[7-(quinolin-6- ylmethyl)imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide, or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with an Alk inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the Alk inhibitor is disclosed in Table 1, e.g., LDK378, or in a publication recited in Table 1, e.g., in WO 2008/073687 (e.g., Example 7/Compound 66) or US 8,039,479 (e.g., claim 1 or 5) (also known as ceritinib (Zykadia®).
- the Alk inhibitor, e.g., LDK378, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., in WO 2008/073687 (e.g., Example 7/Compound 66) or US 8,039,479 (e.g., claim 1 or 5).
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with LDK378 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a lymphoma (e.g., an anaplastic large-cell lymphoma or non-Hodgkin lymphoma), an inflammatory myofibroblastic tumor (IMT), or a neuroblastoma.
- the NSCLC is a stage IIIB or IV NSCLC, or a relapsed locally advanced or metastic NSCLC.
- the cancer e.g., the lung cancer, lymphoma, inflammatory myofibroblastic tumor, or neuroblastoma
- the ALK fusion has, or is identified as having, an ALK rearrangement or translocation, e.g., an ALK fusion.
- the ALK fusion is an EML4-ALK fusion, e.g., an EML4-ALK fusion described herein.
- the ALK fusion is an ALK-ROS1 fusion.
- the cancer has progressed on, or is resistant or tolerant to, a ROS1 inhibitor, or an ALK inhibitor, e.g., an ALK inhibitor other than LDK378.
- the cancer has progressed on, or is resistant or tolerant to, crizotinib.
- the subject is an ALK-na ⁇ ve patient, e.g., a human patient.
- the subject is a patient, e.g., a human patient, that has been pretreated with an ALK inhibitor.
- the subject is a patient, e.g., a human patient, that has been pretreated with LDK378.
- LDK378 and Nivolumab are administered to an ALK-na ⁇ ve patient. In another embodiment, LDK378 and Nivolumab are administered to a patient that has been pretreated with an ALK inhibitor. In yet another embodiment, LDK378 and Nivolumab are administered to a patient that has been pretreated with LDK378.
- LDK378 is administered at an oral dose of about 100 to 1000 mg, e.g., about 150 mg to 900 mg, about 200 mg to 800 mg, about 300 mg to 700 mg, or about 400 mg to 600 mg, e.g., about 150 mg, 300 mg, 450 mg, 600 mg or 750 mg. In certain embodiment, LDK378 is administered at an oral dose of about 750 mg or lower, e.g., about 600 mg or lower, e.g., about 450 mg or lower. In certain embodiments, LDK378 is administered with food. In other embodiments, the dose is under fasting condition. The dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- LDK378 is administered daily. In one embodiment, LDK378 is administered at an oral dose from about 150 mg to 750 mg daily, either with food or in a fasting condition. In one embodiment, LDK378 is administered at an oral dose of about 750 mg daily, in a fasting condition. In one embodiment, LDK378 is administered at an oral dose of about 750 mg daily, via capsule or tablet. In another embodiment, LDK378 is administered at an oral dose of about 600 mg daily, via capsule or tablet. In one embodiment, LDK378 is administered at an oral dose of about 450 mg daily, via capsule or tablet.
- LDK378 is administered at a dose of about 450 mg and nivolumab is administered at a dose of about 3 mg/kg. In another embodiment, the LDK378 dose is 600 mg and the nivolumab dose is 3 mg/kg. In one embodiment, LDK378 is administered with a low fat meal.
- the Alk inhibitor has the following structure:
- R 1 is halo or C 1-6 alkyl
- R 2 is H
- R 3 is (CR 2 ) 0-2 SO 2 R 12 ;
- R 4 is C 1-6 alkyl, C 2-6 alkenyl or C 2-6 alkynyl; OR 12 , NR(R 12 ), halo, nitro, SO 2 R 12 ,
- R 6 is isopropoxy or methoxy
- R 8 and R 9 is (CR 2 ) q Y and the other is C 1-6 alkyl, cyano, C(O)O 0-1 R 12 , CONR(R 12 ) or CONR(CR 2 ) p NR(R 12 );
- X is (CR 2 ) q Y, cyano, C(O)O 0-1 R 12 , CONR(R 12 ), CONR(CR 2 ) p NR(R 12 ),
- CONR(CR 2 ) p OR 12 CONR(CR 2 ) p SR 12 , CONR(CR 2 ) p S(O) 1-2 R 12 or (CR 2 ) 1-6 NR(CR 2 ) p OR 12 ;
- Y is pyrrolidinyl, piperidinyl or azetidinyl, each of which is attached to the phenyl ring via a carbon atom;
- R 12 and R 13 are independently 3-7 membered saturated or partially unsaturated carbocyclic ring, or a 5-7 membered heterocyclic ring comprising N, O and/or S; aryl or heteroaryl; or R 12 is H or C 1-6 alkyl;
- R is H or C 1-6 alkyl
- n 0-1;
- p 0-4;
- LDK378 has the following structure:
- LDK378 is 5-chloro-N2-(2-isopropoxy-5-methyl-4-(piperidin-4-yl)- phenyl)-N4-[2-(propane-2-sulfonyl)-phenyl]-pyrimidine-2,4-diamine, or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a CDK4/6 inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the CDK4/6 inhibitor is disclosed in Table 1, e.g., LEE011, or in a publication recited in Table 1, e.g., in US 8,685,980 or US 8,415,355 (e.g., Formula (I) in columns 3-4 or in Example 74 at column 66).
- the CDK4/6 inhibitor e.g., LEE011
- MSB0010718C is used in combination with LEE011 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a neurologic cancer, melanoma or a breast cancer, or a hematological malignancy, e.g., lymphoma.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a neurologic cancer, melanoma or a breast cancer, or a hematological malignancy, e.g., lymphoma.
- a cancer described in Table 1 e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a neurologic cancer, melanoma or a breast cancer,
- the CDK4/6 inhibitor has the following structure:
- X is CR 9 or N
- R 1 is C 1-8 alkyl, CN, C(O)OR 4 or CONR 5 R 6 , a 5-14 membered heteroaryl group, or a 3-14 membered cycloheteroalkyl group;
- R 2 is C 1-8 alkyl, C 3-14 cycloalkyl, or a 5-14 membered heteroaryl group, and wherein R 2 may be substituted with one or more C 1-8 alkyl, or OH;
- L is a bond, C 1-8 alkylene, C(O), or C(O)NR 10 , and wherein L may be substituted or unsubstituted;
- Y is H, R 11 , NR 12 R 13 , OH, or Y is part of the following group
- Y is CR 9 or N; where 0-3 R 8 may be present, and R 8 is C 1-8 alkyl, oxo, halogen, or two or more R 8 may form a bridged alkyl group;
- W is CR 9 , or N, or O (where W is O, R 3 is absent); R 3 is H, C 1-8 alkyl, C 1-8 alkylR 14 , C 3-14 cycloalkyl, C(O)C 1-8 alkyl, C 1-8 haloalkyl, C 1-8 alkylOH, C(O)NR 14 R 15 , C 1-8 cyanoalkyl, C(O)R 14 , C 0-8 alkylC(O)C 0-8 alkylNR 14 R 15 , C 0-8 alkylC(O)OR 14 , NR 14 R 15 , SO 2 C 1-8 alkyl, C 1-8 alkylC 3-14 cycloalkyl, C(O)C 1-8 alkylC 3-14 cycloalkyl, C 1-8 alkoxy, or OH which may be substituted or unsubstituted when R 3 is not H.
- R 9 is H or halogen
- R 4 , R 5 , R 6 , R 7 , R 10 , R 11 , R 12 , R 13 , R 14 , and R 15 are each independently selected from H, C 1- 8 alkyl, C 3-14 cycloalkyl, a 3-14 membered cycloheteroalkyl group, a C 6-14 aryl group, a 5-14 membered heteroaryl group, alkoxy, C(O)H, C(N)OH, C(N)OCH 3 , C(O)C 1-3 alkyl, C 1-8 alkylNH 2 , C 1-6 alkylOH, and wherein R 4 , R 5 , R 6 , R 7 , R 10 , R 11 , R 12 , and R 13 , R 14 , and R 15 when not H may be substituted or unsubstituted;
- n and n are independently 0-2;
- L, R 3 , R 4 , R 5 , R 6 , R 7 , R 10 , R 11 , R 12 , and R 13 , R 14 , and R 15 may be substituted with one or more of C 1-8 alkyl, C 2-8 alkenyl, C 2-8 alkynyl, C 3-14 cycloalkyl, 5-14 membered heteroaryl group, C 6-14 aryl group, a 3-14 membered cycloheteroalkyl group, OH, (O), CN, alkoxy, halogen, or NH 2 .
- X is CR 9 , wherein R 9 is H; R 1 is CONR 5 R 6 , wherein R 5 and R 6 are both C 1-8 alkyl, specifically methyl; R 2 is C 3-14 cycloalkyl, specifically cyclopentyl; L is a bond;
- Y is N, zero R 8 are present, W is N, m and n are both 1, and R 3 is H.
- LEE011 has the following structure:
- LEE011 is 7-cyclopentyl-2-(5-piperazin-1-yl-pyridin-2-ylamino)- 7H-pyrrolo[2,3-d]pyrimidine-6-carboxylic acid dimethylamide or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a PI3K-inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer described herein e.g., a cancer disclosed in Table 1
- the PI3K-inhibitor is disclosed in Table 1, e.g., BKM120 or BYL719, or in a publications recited in Table 1, e.g., in WO2007/084786 (e.g., Example 10 in [0389] or Formula (I) in [0048]) or WO2010/029082 (e.g., Example 15 or Formula (I)).
- the PI3K-inhibitor e.g., BKM120 or BYL719, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publications recited in Table 1 e.g., in
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with BKM120 or BYL719 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a prostate cancer, an endocrine cancer, an ovarian cancer, a melanoma, a bladder cancer, a female reproductive system cancer, a digestive/gastrointestinal cancer, a colorectal cancer, glioblastoma multiforme (GBM), a head and neck cancer, a gastric cancer, a pancreatic cancer or a breast cancer; or a hematological malignancy, e.g., leukemia, NSCLC)
- GBM glioblastoma multiforme
- the PI3K-inhibitor has the following structure:
- W is CRWor N, wherein Rw is selected from the group consisting of (1) hydrogen, (2) cyano, (3) halogen, (4) methyl, (5) trifluoromethyl, and (6) sulfonamido; R 1 is selected from the group consisting of (1) hydrogen, (2) cyano, (3) nitro, (4) halogen, (5) substituted and unsubstituted alkyl, (6) substituted and unsubstituted alkenyl, (7) substituted and unsubstituted alkynyl, (8) substituted and unsubstituted aryl, (9) substituted and unsubstituted heteroaryl, (10) substituted and unsubstituted heterocyclyl, (11) substituted and unsubstituted cycloalkyl, (12) -COR 1a , (13) -CO 2 R 1a (14)–CONR 1a R 1b , (15)–NR 1a R 1b ,, (16)–NR 1a COR 1b
- W is CRw and Rw is hydrogen
- R 1 is unsubstituted heterocyclyl
- R 2 is hydrogen
- R 3 is substituted alkyl
- R 4 is hydrogen
- BKM120 has the following structure:
- BKM120 is 4-(trifluoromethyl)-5-(2,6-dimorpholinopyrimidin-4- yl)pyridine-2-amine or a pharmaceutically acceptable salt thereof.
- the PI3K-inhibitor has the following structure:
- R 1 represents one of the following substituents: (1) unsubstituted or substituted, preferably substituted C 1 -C 7 alkyl, wherein said substituents are independently selected from one or more, preferably one to nine of the following moieties: deuterium, fluoro, or one to two of the following moietiesC 3 -C 5 cycloalkyl; (2) optionally substituted C 3 -C 5 cycloalkyl wherein said substituents are independently substituted C 3 -C 5 cycloalkyl wherein said substituents are independently selected from one or more, preferably one to four of the following moieties: deuterium, C 1 -C 4 alkyl (preferably methyl), fluoro, cyano, aminocarbonyl; (3) optionally substituted phenyl wherein said substituents are independently selected from one or more, preferably one to two of the following moieties: deuterium, halo, cyano, C 1 -C 7 alkyl, C 1 -C 7 alky
- A is ;
- R 1 is substituted C 1 -C 7 alkyl, wherein said substituents are independently selected from one or more, preferably one to nine of deuterium, fluoro, or C 3 -C 5 cycloalkyl;
- R 2 is hydrogen, and
- R 3 is methyl.
- BYL719 has the following structure:
- BYL719 is (S)-pyrrolidine-1,2-dicarboxylic acid 2-amide 1-( ⁇ 4- methyl-5-[2-(2,2,2-trifluoro-1,1-dimethyl-ethyl)-pyridin-4-yl]-thiazol-2-yl ⁇ -amide) or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a BRAF inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the BRAF inhibitor is disclosed in Table 1, e.g., LGX818, or in a publication recited in Table 1, e.g., WO2011/025927 (e.g., Example 6/Compound 6 or Formula (Ia) in
- the BRAF inhibitor e.g., LGX818, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with LGX818 to treat a cancer described in Table 1, e.g., a solid tumor, e.g., a lung cancer (e.g., non-small cell lung cancer (NSCLC)), a melanoma, e.g., advanced melanoma, a thyroid cancer, e.g, papillary thyroid cancer, or a colorectal cancer.
- the cancer has, or is identified as having, a BRAF mutation (e.g., a BRAF V600E mutation), a BRAF wildtype, a KRAS wildtype or an activating KRAS mutation.
- the cancer may be at an early, intermediate or late stage.
- the BRAF inhibitor has the following structure:
- R 2 , R 3 , R 5 , and R 6 are independently selected from hydrogen, halo, cyano, C 1-4 alkyl, halo-substituted C 1-4 alkyl, C 1-4 alkoxy and halo-substituted C 1- 4 alkoxy; with the proviso that when R 5 is fluoro and R 1 is selected from hydrogen, -X1R8a, - X 1 C(O)NR 8a R 8b , -XNR 8a X 2 R 8b , -X 1 NR 8a C(O)X 2 OR 8b and–X 1 NR 8a S(O) 0-2 R 8b , R 3 and R 6 are not both hydrogen; R 4 is selected from–R 9 and–NR 10 R 11 ; wherein R 9 is selected from C 1-6 alkyl, C 3- 8 cycloalkyl, C 3-8 heterocycloalkyl, aryl, and heteroaryl; where
- R 3 is halo (e.g., chloro); R 4 is R 9 ; R 9 is C 1-6 alkyl (e.g., methyl), R 5 is halo (e.g., fluoro), R 7 is C 1-4 alkyl (e.g., isopropyl); Y is CR 6 ; and R 6 is H.
- LGX818 has the following structure:
- LGX818 is methyl (S)-(1-((4-(3-(5-chloro-2-fluoro-3- (methylsulfonamido)phenyl)-1-isopropyl-1H-pyrazol-4-yl)pyrimidin-2-yl)amino)propan-2- yl)carbamate or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a CAR T cell targeting CD19 to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the CAR T cell targeting CD19 is disclosed in Table 1, e.g., CTL019, or in a publication recited in Table 1, e.g., WO 2012/079000, e.g., SEQ ID NO: 12 (e.g., full-length CAR) or SEQ ID NO: 14 (e.g., CD19 scFv).
- the CAR T cell targeting CD19 e.g., CTL019, has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1.
- one of Nivolumab is disclosed in Table 1, e.g., CTL019, or in a publication recited in Table 1, e.g., WO 2012/079000, e.g., SEQ ID NO: 12 (e.g., full-length CAR) or SEQ ID NO: 14 (e.g., CD19 scFv).
- the CAR T cell targeting CD19 e.g., CTL
- Pembrolizumab or MSB0010718C is used in combination with CTL019 to treat a cancer described in Table 1, e.g., a solid tumor, or a hematological malignancy, e.g., a lymphocytic leukemia or a non-Hodgkin lymphoma.
- the CAR T cell targeting CD19 has the USAN designation
- CTL019 is made by a gene modification of T cells is mediated by stable insertion via transduction with a self-inactivating, replicationdeficient Lentiviral (LV) vector containing the CTL019 transgene under the control of the EF-1 alpha promoter.
- CTL019 is a mixture of transgene positive and negative T cells that are delivered to the subject on the basis of percent transgene positive T cells.
- the inhibitor of the immune checkpoint molecule is used in combination with a MEK inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- a cancer described herein e.g., a cancer disclosed in Table 1.
- the MEK inhibitor is disclosed in Table 1, e.g., MEK162, or in a publication recited in Table 1, e.g., WO2003/077914 (e.g., Example 18/Compound 29lll or Formula II).
- the MEK inhibitor e.g., MEK162
- WO2003/077914 e.g., Example 18/Compound 29lll or Formula II.
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with MEK162 to treat a cancer described in Table 1.
- the cancer or disorder treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma, a multisystem genetic disorder, a digestive/gastrointestinal cancer, a gastric cancer, or a colorectal cancer; or rheumatoid arthritis.
- the cancer has, or is identified as having, a KRAS mutation.
- the MEK inhibitor has the following structure:
- R 1 , R 2 , R 9 and R 10 are independently selected from hydrogen, halogen, cyano, nitro, trifluoromethyl, difluoromethoxy, trifluoromethoxy, azido, -OR 3 , -C(O)R 3 , -C(O)OR 3 ,
- R 3 is selected from hydrogen, trifluoromethyl, and
- R', R" and R'" independently are selected from hydrogen, lower alkyl, lower alkenyl, aryl and arylalkyl;
- R" is selected from lower alkyl, lower alkenyl, aryl and arylalkyl; or
- any two of R', R", R'" or R"" can be taken together with the atom to which they are attached to form a 4 to 10 membered carbocyclic, heteroaryl or heterocyclic ring, each of which is optionally substituted with one to three groups independently selected from halogen, cyano, nitro, trifluoromethyl, difluoromethoxy, trifluoromethoxy, azido, aryl, heteroaryl, arylalkyl, heteroarylalkyl, heterocyclyl, and heterocyclylalkyl; or
- R 3 and R 4 can be taken together with the atom to which they are attached to form a 4 to 10 membered carbocyclic, heteroaryl or heterocyclic ring, each of which is optionally substituted with one to three groups independently selected from halogen, cyano, nitro, trifluoromethyl, difluoromethoxy, trifluoromethoxy, azido, - NR SO 2 R “" , -SO 2 NR ' R “ , -C(O)R , -C(O)OR , - OC(O)R , -NR ' C(0)0R "” , - NR C(O)R “ , -C(O)NRR “ , -SO 2 R "” , -NR ' R “ , -NR ' C(O)NR “ R '” , - NR ' C(NCN)NR “ R '” , -OR , aryl, heteroaryl, arylalkyl
- R 4 and R 5 independently represent hydrogen or C 1 -C 6 alkyl
- R 4 and R 5 together with the atom to which they are attached form a 4 to 10 membered carbocyclic, heteroaryl or heterocyclic ring, each of which is optionally substituted with one to three groups independently selected from halogen, cyano, nitro, trifluoromethyl,
- R 6 is selected from trifluoromethyl
- R 7 is selected from hydrogen
- W is selected from heteroaryl, heterocyclyl, -C(O)OR 3 , -C(O)NR 3 R 4 , -C(O)NR 4 OR 3 , - C(O)R 4 OR 3 , -C(O)(C 3 -C 10 cycloalkyl), -C(O)(C 1 -C 10 alkyl), -C(O)(aryl), -C(O)(heteroaryl) and - C(O)(heterocyclyl), each of which is optionally substituted with 1-5 groups independently selected from -NR 3 R 4 , -OR 3 , -R 2 , and C 1 - C 10 alkyl, C 2 -C 10 alkenyl, and C 2 -C 10 alkynyl, each of which is optionally substituted with 1 or 2 groups independently selected from-NR 3 R 4 and-OR 3 ;
- R 8 is selected from hydrogen, -SCF 3 , -Cl, -Br, -F, cyano, nitro, trifluoromethyl, difluoromethoxy, trifluoromethoxy, azido, -OR 3 , -C(O)R 3 , -C(O)OR 3 ,-NR 4 C(O)OR 6 , -OC(O)R 3 , -NR 4 SO 2 R 6 , -SO 2 NR 3 R 4 , -NR 4 C(O)R 3 , -C(O)NR 3 R 4 ,-NR 5 C(O)NR 3 R 4 , -NR 3 R 4 , and
- n 0, 1, 2, 3, 4 or 5;
- R 7 is C ⁇ - C 10 alkyl, C 3 -C 7 cycloalkyl or C 3 -C 7 cycloalkylalkyl, each of which can be optionally substituted with 1 - 3 groups independently selected from oxo, halogen, cyano, nitro, trifluoromethyl, difluoromethoxy, trifluoromethoxy, azido, -NR 4 SO 2 R 6 , - SO 2 NR 3 R 4 , -C(O)R 3 , -C(O)OR 3 , -OC(O)R 3 , -SO 2 R 3 , -NR 4 C(O)OR 6 , -NR 4 C(O)R 3 , -C(O)NR 3 R 4 , - NR 3 R 4 , -NR 5 C(O)NR 3 R 4 , -NR 5 C(NCN)NR 3 R 4 , -OR 3 , aryl, heteroaryl, aryl
- heteroarylalkyl heterocyclyl, and heterocyclylalkyl.
- R 1 is halogen
- R 2 is hydrogen
- R 3 is C 1 - C 10 alkyl substituted with OR’ and R’ is hydrogen
- R 4 is hydrogen
- R 7 is C 1 - C 10 alkyl
- R 8 is bromo
- R 9 is halogen
- R 10 is hydrogen
- W is–C(O)NR 4 OR 3 .
- MEK162 has the following structure:
- MEK162 is 5-((4-bromo-2-fluorophenyl)amino)-4-fluoro-N-(2- hydroxyethoxy)-1-methyl-1H-benzo[d]imidazole-6-carboxamide or a pharmaceutically acceptable salt thereof.
- the inhibitor of the immune checkpoint molecule (alone or in combination with other immunomodulators) is used in combination with a BCR-ABL inhibitor to treat a cancer, e.g., a cancer described herein (e.g., a cancer disclosed in Table 1).
- the BCR-ABL inhibitor is disclosed in Table 1, e.g., AMN-107, or in a publication recited in Table 1, e.g., in WO 2004/005281 (e.g., in Example 92 or Formula (I) in claim 1) or US 7,169,791 (e.g., in claim 8).
- AMN-107 has the structure (compound or generic structure) provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., in WO 2004/005281 (e.g., in Example 92 or Formula (I) in claim 1) or US 7,169,791 (e.g., in claim 8).
- one of Nivolumab, Pembrolizumab or MSB0010718C is used in combination with AMN-107 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a neurologic cancer, a melanoma, a digestive/gastrointestinal cancer, a colorectal cancer, a head and neck cancer; or a hematological malignancy, e.g., chronic myelogenous leukemia (CML), a lymphocytic leukemia, a myeloid leukemia; Parkinson's disease; or pulmonary hypertension.
- CML chronic myelogenous leukemia
- a lymphocytic leukemia a myeloid leukemia
- Parkinson's disease Parkinson's disease
- pulmonary hypertension e.g., chronic myelogenous leukemia (CML), a lymphocytic leukemia, a myeloid leukemia; Parkinson's disease; or pulmonary hypertension.
- the BCR-ABL inhibitor has the following structure:
- R 1 represents hydrogen, lower alkyl, lower alkoxy-lower alkyl, acyloxy-lower alkyl, carboxy- lower alkyl, lower alkoxycarbonyl-lower alkyl, or phenyl-lower alkyl;
- R 2 represents hydrogen, lower alkyl, optionally substituted by one or more identical or different radicals R 3 , cycloalkyl, benzcycloalkyl, heterocyclyl, an aryl group, or a mono- or bicyclic heteroaryl group comprising zero, one, two or three ring nitrogen atoms and zero or one oxygen atom and zero or one sulfur atom, which groups in each case are unsubstituted or mono- or polysubstituted; and
- R 3 represents hydroxy, lower alkoxy, acyloxy, carboxy, lower alkoxycarbonyl, carbamoyl, N- mono- or N,N-disubstituted carbamoyl, amino, mono- or disubstituted amino, cycloalkyl, heterocyclyl, an aryl group, or a mono- or bicyclic heteroaryl group comprising zero, one, two or three ring nitrogen atoms and zero or one oxygen atom and zero or one sulfur atom, which groups in each case are unsubstituted or mono- or polysubstituted; or wherein
- R 1 and R 2 together represent alkylene with four, five or six carbon atoms optionally mono- or disubstituted by lower alkyl, cycloalkyl, heterocyclyl, phenyl, hydroxy, lower alkoxy, amino, mono- or disubstituted amino, oxo, pyridyl, pyrazinyl or pyrimidinyl; benzalkylene with four or five carbon atoms; oxaalkylene with one oxygen and three or four carbon atoms; or azaalkylene with one nitrogen and three or four carbon atoms wherein nitrogen is unsubstituted or substituted by lower alkyl, phenyl-lower alkyl, lower alkoxycarbonyl-lower alkyl, carboxy- lower alkyl, carbamoyl-lower alkyl, N-mono- or N,N-disubstituted carbamoyl- lower alkyl, cycloalkyl, lower alkoxy
- R 4 represents hydrogen, lower alkyl, or halogen
- R 1 is hydrogen
- R 2 is phenyl substituted with CF 3 and
- R4 is CH 3
- AMN-107 has the followin structure:
- AMN-107 is 4-methyl-3-[[4-(3-pyridinyl)-2-pyrimidinyl]amino]-N- [5-(4-methyl-1H-imidazol1yl)-3-(trifluoromethyl)phenyl]benzamide or an N-oxide or pharmaceutically acceptable salt thereof.
- SMAC mimetic LCL161 also known as SMAC mimetic LCL161 is an orally bioavailable second mitochondrial-derived activator of caspases (SMAC) mimetic and inhibitor of IAP (Inhibitor of Apoptosis Protein) family of proteins, with antineoplastic activity.
- SMAC mimetic LCL161 binds to IAPs, such as X chromosome-linked IAP (XIAP) and cellular IAPs 1 and 2. Since IAPs shield cancer cells from the apoptosis process, this agent can be used to restore and promote the induction of apoptosis through apoptotic signaling pathways in cancer cells.
- IAPs are overexpressed by many cancer cell types and suppress apoptosis by binding and inhibiting active caspases-3, -7 and -9, which play essential roles in apoptosis (programmed cell death), necrosis and inflammation.
- LCL161 has the structure provided in Table 1, or as disclosed in the publication recited in Table 1, e.g., International Patent Publication No. WO2008/016893 (e.g., Formula (I), Example 1, and Compound A), European Patent No.2051990, and U.S. Patent No. 8,546,336.
- LCL161 has the following structure:
- LCL161 is (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4- fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2-oxoethyl)-2-(methylamino)propanamide.
- an immunomodulatory e.g., an inhibitor of the immune checkpoint molecule (e.g., a PD-1 inhibitor, e.g., Nivolumab or Pembrolizumab, a PD-L1 inhibitor, e.g., MSB0010718C, or a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule) is used in combination with LCL161 to treat a cancer or disorder described in Table 1, e.g., a solid tumor, e.g., a breast cancer or a pancreatic cancer; or a hematological malignancy, e.g., multiple myeloma or a hematopoeisis disorder.
- a PD-1 inhibitor e.g., Nivolumab or Pembrolizumab
- a PD-L1 inhibitor e.g., MSB0010718C
- a TIM-3 inhibitor e.g., an anti-TIM-3 antibody molecule
- the inhibitor of the immune checkpoint molecule (e.g., an anti-PD-1 antibody molecule or an anti-TIM-3 antibody molecule) is administered intravenously.
- LCL161 is administered orally.
- the inhibitor of the immune checkpoint molecule (e.g., the anti-PD-1 antibody molecule or anti- TIM-3 antibody molecule) is administered, e.g., intravenously, at least one, two, three, four, five, six, or seven days, e.g., three days, after LCL161 is administered, e.g., orally.
- LCL161 is administered orally.
- the inhibitor of the immune checkpoint molecule (e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule) is administered, e.g., intravenously, at least one, two, three, four, five, six, or seven days, e.g., three days, before LCL161 is administered, e.g., orally.
- the inhibitor of the immune checkpoint molecule (e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule) is administered, e.g., intravenously, on the same day, as LCL161 is administered, e.g., orally.
- the administration of the inhibitor of the immune checkpoint molecule e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule
- LCL161 results in a synergistic effect.
- the inhibitor of the immune checkpoint molecule e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule
- LCL161 results in a synergistic effect.
- concentration LCL161 that is required to achieve inhibition, e.g., growth inhibition, is lower than the therapeutic dose of LCL161 as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50- 60%, 60-70%, 70-80%, or 80-90% lower.
- the concentration of the inhibitor of the immune checkpoint molecule e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule
- the concentration of the inhibitor of the immune checkpoint molecule is lower than the therapeutic dose of the inhibitor of the immune checkpoint molecule (e.g., the anti-PD-1 antibody molecule or anti-TIM-3 antibody molecule) as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- administration of LCL161, alone or in combination with an anti-PD-1 antibody molecule increases the expression of an immune-active cytokine, e.g., IFN-gamma, in the cancer or the subject.
- administration of LCL161, alone or in combination with an anti-PD-1 antibody molecule reduces the expression of an immune-suppressive cytokine, e.g., IL-10, in the cancer or the subject.
- the LCL161 is administered at a dose (e.g., oral dose) of about 10- 3000 mg, e.g., about 20-2400 mg, about 50-1800 mg, about 100-1500 mg, about 200-1200 mg, about 300-900 mg, e.g., about 600 mg, about 900 mg, about 1200 mg, about 1500 mg, about 1800 mg, about 2100 mg, or about 2400 mg.
- a dose e.g., oral dose
- a dose e.g., oral dose of about 10- 3000 mg, e.g., about 20-2400 mg, about 50-1800 mg, about 100-1500 mg, about 200-1200 mg, about 300-900 mg, e.g., about 600 mg, about 900 mg, about 1200 mg, about 1500 mg, about 1800 mg, about 2100 mg, or about 2400 mg.
- LCL161 is administered once a week or once every two weeks.
- LDK378 (ceritinib) is an Anaplastic Lymphoma Kinase (ALK) inhibitor. Its chemical formula is 5-chloro-N 2 -(2-isopropoxy-5-methyl-4-(piperidin-4-yl)phenyl)-N 4 -[2-(propane-2- sulfonyl)-phenyl]-pyrimidine-2,4-diamine.
- a process for preparing LDK378 was disclosed in WO2008/073687.
- the compound has been approved by the US FDA as ZYKADIA® for the treatment of patients with Anaplastic Lymphoma Kinase (ALK)-positive metastatic non-small cell lung cancer (NSCLC), who have progressed on or are intolerant to crizotinib.
- ALK Anaplastic Lymphoma Kinase
- NSCLC metastatic non-small cell lung cancer
- the currently approved daily dose for use of LDK378 (alone) in NSCLC is 750 mg orally on an empty stomach (i.e., is not to be administered within 2 hours of a meal).
- LDK378 demonstrated a high rate of rapid and durable responses in 246 ALK-positive NSCLC patients treated in the 750 mg dose group (RD). In these patients the overall response rate (ORR) was 58.5%. Among the 144 ALK-positive NSCLC patients with a confirmed complete response (CR) or partial response (PR), 86.1% of those patients achieved a response within 12 weeks, with a median time to response of 6.1 weeks. The estimated median duration of response (DOR) based on investigator assessment was long at 9.69 months. The median progression-free survival (PFS) was 8.21 months with 53.3% of the patients censored.
- ORR overall response rate
- ceritinib showed this level of high anti-cancer activity regardless of prior ALK inhibitor status (i.e., whether or not the patient received previous treatment with an ALK inhibitor).
- a high ORR of 54.6% and 66.3% was observed in patients treated with a prior ALK inhibitor and in ALK inhibitor-na ⁇ ve patients, respectively.
- metastatic ALK-positive NSCLC remains a difficult disease to treat.
- Harnessing the immune system to treat patients with NSCLC represents a novel and new treatment approach, and nivolumab can be safely combined with LDK378.
- Combination therapy involving targeted agent LDK378 and immunotherapy can improve progression- free survival and ultimately overall survival in NSCLC patients.
- the present disclosure relates to a pharmaceutical combination, especially a pharmaceutical combination product, comprising the combination of an immunomodulator and an agent disclosed herein.
- the compounds in the pharmaceutical combination can be administered separately or together.
- LDK378 and the Nivolumab can be administered independently at the same time or separately within time intervals, wherein time intervals allow that the combination partners are jointly active.
- pharmaceutical combination refers to a product obtained from mixing or combining in a non-fixed combination the active ingredients, e.g. (i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) Nivolumab or a pharmaceutically acceptable salt thereof separately or together.
- non-fixed combination means that the active ingredients, e.g. LDK378 and Nivolumab, are both administered separately or together, independently at the same time or separately within time intervals, wherein such administration provides therapeutically effective levels of the active ingredient in the subject in need.
- cocktail therapy e.g. the administration of three or more active ingredients.
- This term defines especially a“kit of parts” in the sense that the combination partners (i) LDK378 and (ii) Nivolumab (and if present further one or more co-agents) as defined herein can be dosed independently of each other.
- joint therapeutically effective means that the compounds show synergistic interaction when administered separately or together, independently at the same time or separately within time intervals, to treat a subject in need, such as a warm-blooded animal in particular a human.
- the combination of the present disclosure possesses beneficial therapeutic properties, e.g. synergistic interaction, strong in-vivo and in-vitro antitumor response, which can be used as a medicine. Its characteristics render it particularly useful for the treatment of cancer.
- Suitable cancers that can be treated with the combination of the present disclosure include but are not limited to anaplastic large cell lymphoma (ALCL), neuroblastoma, lung cancer, non-small cell lung cancer (NSCLC).
- the cancer is NSCLC.
- the combination according to the present disclosure can besides or in addition be administered especially for cancer therapy in combination with chemotherapy, radiotherapy, immunotherapy, surgical intervention, or in combination of these.
- Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
- Other possible treatments are therapy to maintain the patient’s status after tumor regression, or even chemo-preventive therapy, for example in patients at risk.
- the combination of LDK378 and Nivolumab can be used to manufacture a medicament for an ALK mediated disease as described above.
- the combination can be used in a method for the treatment of an ALK, as described above, said method comprising administering an effective amount of a combination of (i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) Nivolumab or a pharmaceutically acceptable salt thereof separately or together, to a subject in need thereof, according to the present disclosure.
- jointly (therapeutically) active may mean that the compounds may be given separately or sequentially (in a chronically staggered manner, especially a sequence specific manner) in such time intervals that they preferably, in the warm-blooded animal, especially human, to be treated, and still show a (preferably synergistic) interaction (joint therapeutic effect).
- a joint therapeutic effect can, inter alia, be determined by following the blood levels, showing that both compounds are present in the blood of the human to be treated at least during certain time intervals, but this is not to exclude the case where the compounds are jointly active although they are not present in blood simultaneously.
- the present disclosure also describes the method for the treatment of an ALK mediated disease, wherein the combination of (i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) Nivolumab or a pharmaceutically acceptable salt thereof separately or together.
- the present disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising effective amounts of (i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) Nivolumab, or a pharmaceutically acceptable salt thereof.
- the present disclosure also describes the pharmaceutical combination according to the present disclosure in the form of a“kit of parts” for the combined administration.
- the independent formulations or the parts of the formulation, product, or composition can then, e.g. be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
- the compounds useful according to the disclosure may be manufactured and/or formulated by the same or different manufacturers.
- the combination partners may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising LDK378 and the Nivolumab); (ii) by the physician themselves (or under the guidance of a physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of the compound of the disclosure and the other therapeutic agent.
- the effect of the combination is synergistic.
- composition is dependent on the species of the subject, the body weight, age and individual condition, the disorder or disease or the severity thereof being treated, and can be determined by standard clinical techniques.
- in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges.
- the precise dose to be employed can also depend on the route of administration, and the seriousness of the condition being treated and can be decided according to the judgment of the practitioner and each subject's circumstances in view of, e.g., published clinical studies. In general, satisfactory results are indicated to be obtained systemically at daily dosages of from 150 mg to 750 mg of LDK378 orally. In most cases, the daily dose for LDK378 can be between 300 mg and 750 mg.
- LDK378 When administered in combination with Nivolumab, LDK378 can be administered at 450 mg with 3 mg/kg nivolumab, 600 mg LDK378 with 3 mg/kg Nivolumab, or 300 mg LDK378 with 3 mg/kg nivolumab.
- the most preferred dose of both compounds for combination therapy is 600 mg of LDK378 with 3 mg/kg Nivolumab.
- Particularly 600 mg LDK378 with 3 mg/kg Nivolumab is the most preferred dosing regimen for treating ALK-positive (e.g., EML4-ALK) NSCLC.
- Nivolumab can be administered as the fixed dose infusion every two weeks. Ceritinib is to be taken together with a low fat meal.
- ceritinib is administered within 30 minutes after consuming a low fat meal.
- a patient should refrain from eating for at least an hour after intake of ceritinib and the low fat meal.
- administration of ceritinib with daily meal intake can reduce the incidence and/or severity of gastrointestinal events. It is estimated that the steady state exposure of ceritinib at 450 mg and 600 mg with daily low-fat meal intake is within 20% relative to that of ceritinib at the recommended phase II dose of 750 mg administered fasted, as predicted by model-based clinical trial simulation, using a population pharmacokinetic model established for ALK-positive cancer patients in one clinical study in conjunction with absorption parameters estimated from another clinical study.
- The“low-fat meal” denotes herein a meal that contains approximately 1.5 to 15 grams of fat and approximately 100 to 500 total calories.
- ceritinib does not have a mechanism of action that would be expected to antagonize an immune response. Furthermore, immune-related adverse events have not been frequently reported in ceritinib trials. Potential overlapping toxicities between ceritinib and Nivolumab include diarrhea, nausea, AST and ALT elevations, pneumonitis, and hyperglycemia. The mechanisms of these toxicities are not expected to be similar, given the mechanisms of action of the two compounds and thus the safety profile can be managed.
- LDK378 for use as a medicine, wherein LDK378, or a pharmaceutically acceptable salt thereof, is to be administered in combination with Nivolumab, or a pharmaceutically acceptable salt thereof, for the treatment of an ALK mediated disease, e.g. cancer.
- ALK mediated disease refers to a disease in which activity of the kinase leads to abnormal activity of the regulatory pathways including overexpression, mutation or relative lack of activity of other regulatory pathways in the cell that result in excessive cell proliferation, e.g. cancer.
- the ALK mediated disease can be non-small cell lung cancer (NSCLC) that is driven by the echinoderm microtubule-associated protein-like 4 (EML4) - anaplastic lymphoma kinase (ALK) translocation.
- NSCLC non-small cell lung cancer
- EML4 echinoderm microtubule-associated protein-like 4
- ALK anaplastic lymphoma kinase
- ALK is translocated, mutated, and/or amplified in several tumor types, and thus ALK mediated disease include, in addition to NSCLC, neuroblastoma, and anaplastic large cell lymphoma (ALCL). Alterations in ALK play a key role in the pathogenesis of these tumors.
- Other fusion partners of ALK besides EML4 that can be relevant in an ALK mediated disease are KIF5B, TFG, KLC1 and PTPN3, but are expected to be less common than EML4. Preclinical experiments have shown that the various ALK fusion partners mediate ligand-independent
- a pharmaceutical combination comprising (i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) nivolumab, or a pharmaceutically acceptable salt thereof.
- LDK378 in combination with Nivolumab for the manufacture of a medicament for an ALK mediated disease.
- LDK378 in combination with Nivolumab for the manufacture of a medicament according to item 13, wherein the cancer is non-small cell lung cancer.
- a pharmaceutical composition comprising LDK378 or a pharmaceutically acceptable salt thereof and Nivolumab or a pharmaceutically acceptable salt thereof for simultaneous or separate administration for the treatment of cancer.
- composition according to items 22 or 23, wherein the composition comprises effective amounts of LDK378 and nivolumab.
- composition according to any one of items 15 to 18, wherein the composition further comprises a pharmaceutical acceptable carrier.
- LDK378 for use as a medicine, wherein LDK378, or a pharmaceutically acceptable salt thereof, is to be administered in combination with Nivolumab, or a
- LDK378 for use as a medicine according to item 19, for the treatment of cancer.
- a method for treating cancer in a subject in need thereof comprising
- LDK378, or a pharmaceutically acceptable salt thereof a therapeutically effective amount of i) LDK378, or a pharmaceutically acceptable salt thereof, and (ii) nivolumab, or a pharmaceutically acceptable salt thereof.
- Lung cancer is the most common cancer worldwide and the sub-type non-small cell lung cancer (NSCLC) accounts for approximately 85% of lung cancer cases.
- NSCLC sub-type non-small cell lung cancer
- EGFR epidermal growth factor receptor
- L858R and exon 19 deletion (Ex19del) activating EGFR oncogenic mutations predominate in NSCLC patients and account for 38% and 46% of EGFR NSCLC mutations respectively.
- EGFR Exon 20 insertion mutations (Ex20ins) are also relatively frequent, accounting for 9% of all EGFR mutations in NSCLC patients.
- TKIs reversible EGFR Tyrosine Kinase Inhibitors
- erlotinib and gefitinib reversible EGFR Tyrosine Kinase Inhibitors
- TKIs EGFR Tyrosine Kinase Inhibitors
- Second-generation EGFR TKIs have been developed to try to overcome the mechanism of acquired resistance.
- third- generation EGFR TKIs have been developed which are WT EGFR sparing but also have relative equal potency for activating EGFR (L858R and ex19del) and acquired (T790M) mutations.
- Third generation EFGR TKIs such as AZD9291 (mereletinib) and CO-1686 (rociletinib) are beginning to enter clinical development and are showing significant initial promise (e.g., see “AZD9291 in EGFR Inhibitor–Resistant Non–Small-Cell Lung Cancer”, Hanne et al., N Engl J Med, 2015; 372; 1689-99 and“Rociletinib in EGFR-Mutated Non–Small-Cell Lung Cancer”, Sequist et al, J Med, 2015; 372; 1700-9).
- ASP8273 a novel mutant-selective irreversible EGFR inhibitor, inhibits growth of non-small cell lung cancer (NSCLC) cells with EGFR activating and T790M resistance mutations”, Sakagami et al., AACR; Cancer Res 2014; 74; 1728.
- the present invention relates to the surprising finding that a combination treatment comprising the selective mutated-EGFR inhibitor EGF816 and the anti-PD-1 antagonist Nivolumab are safe and tolerated when administered as a combination therapy to treat patients with NSCLC that have mutated-EGFR.
- EGF816 is an EGFR inhibitor.
- EGF816 is also known as (R,E)-N-(7-chloro-1-(1-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-1Hbenzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), or a pharmaceutically acceptable salt thereof.
- a particularly useful salt is the mesylate salt thereof.
- WO2013/184757 the contents of which are hereby incorporated by reference, describes EGF816, its method of preparation and pharmaceutical compositions comprising EGF816.
- EGF816 has the following structure:
- EGF816 is a targeted covalent irreversible EGFR inhibitor that selectively inhibits activating and acquired resistance mutants (L858R, ex19del and T790M), while sparing WT EGFR. (see Jia et al., Cancer Res October 1, 201474; 1734). EGF816 has shown significant efficacy in EGFR mutant (L858R, ex19del and T790M) cancer models (in vitro and in vivo) with no indication of WT EGFR inhibition at clinically relevant efficacious concentrations.
- the disclosure relates to a pharmaceutical combination, comprising (a) a compound of formula I:
- the disclosure provides a combination for use in a method of treating a cancer, especially an EGFR mutated cancer wherein:
- the combined administration has clinical efficacy, e.g., as measured by
- the progression of cancer may be monitored by methods known to those in the art.
- the progression may be monitored by way of visual inspection of the cancer, such as, by means of X-ray, CT scan or MRI or by tumor biomarker detection.
- an increased growth of the cancer indicates progression of the cancer.
- Progression of cancer such as NSCLC or tumors may be indicated by detection of new tumors or detection of metastasis or cessation of tumor shrinkage.
- Tumor evaluations can be made based on RECIST criteria (Therasse et al. 2000), New Guidelines to Evaluate the Response to Treatment in Solid Tumors, Journal of National Cancer Institute, Vol.92; 205-16 and revised RECIST guidelines (version 1.1)
- Tumor progression may be determined by comparison of tumor status between time points after treatment has commenced or by comparison of tumor status between a time point after treatment has commenced to a time point prior to initiation of the relevant treatment.
- the lymphoma e.g., an anaplastic large-cell lymphoma or non- Hodgkin lymphoma
- the lymphoma has, or is identified as having, an ALK translocation, e.g., an EML4-ALK fusion.
- the combination is for use in the treatment of NSCLC.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by one or more of: aberrant activation, or amplification, or mutations of epidermal growth factor receptor.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring an EGFR exon 20 insertion, an EGFR exon 19 deletion, EGFR L858R mutation, EGFR T790M, or any combination thereof.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring L858R and T790M mutations of EGFR. In some embodiments, the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring an EGFR exon 20 insertion and T790M mutations of EGFR.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring an EGFR exon 19 deletion and T790M mutations of EGFR.
- the combination is for use in the treatment of NSCLC, wherein the NSCLC is characterized by harboring EGFR mutation selected from the group consisting of an exon 20 insertion, an exon 19 deletion, L858R mutation, T790M mutation, and any combination thereof.
- the cancer is an inflammatory myofibroblastic tumor (IMT).
- IMT inflammatory myofibroblastic tumor
- the inflammatory myofibroblastic tumor has, or is identified as having, an ALK rearrangement or translocation, e.g., an ALK fusion, e.g., an EML4-ALK fusion.
- the cancer is a neuroblastoma.
- the neuroblastoma has, or is identified as having, an ALK rearrangement or translocation, e.g., an ALK fusion, e.g., an EML4-ALK fusion.
- an ALK rearrangement or translocation e.g., an ALK fusion, e.g., an EML4-ALK fusion.
- EGF816 may be administered at a dose of 75, 100, 150, 225, 150, 200, 225, 300 or 350 mg. These doses may be administered once daily. E.g. EGF816 may be administered at a dose of 100 or 150 mg once daily.
- Nivolumab may be administered in an amount from about 1 mg/kg to 5 mg/kg, e.g., 3 mg/kg, and may be administered over a period of 60 minutes, ca. once a week to once every 2, 3 or 4 weeks.
- the combination of EGF816 and Nivolumab is administered as a combination therapy wherein the administration protocol is:
- Nivolumab is administered intravenously over a period of 60 minutes at least one hour after administration of (i), every 2 weeks.
- the administration protocol is repeated for the duration of a 28 day cycle.
- the term“pharmaceutical combination” as used herein means a product that results from the mixing or combining of more than one active ingredient and includes both fixed and non- fixed combinations of the active ingredients.
- the term“fixed combination” means that the active ingredients, e.g., a compound of formula (I) and one or more combination partners, are both administered to a patient simultaneously in the form of a single entity or dosage.
- the term“non- fixed combination” means that the active ingredients, e.g., a compound of the present invention and one or more combination partners, are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient.
- cocktail therapy e.g., the administration of three or more active ingredients.
- a pharmaceutical combination comprising:
- a kit comprising the pharmaceutical combinations according to any one of Enumerated Embodiments 1 to 3 and information about using the constituents of the
- Embodiments 1 to 3 simultaneously, separately or sequentially.
- a method of treating or preventing cancer in a subject in need thereof comprising sequential, simultaneous or separate administration of (R,E)-N-(7-chloro-1-(1-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide, or a pharmaceutically acceptable salt thereof and Nivolumab according to any one of
- Embodiments 1 to 3 in a jointly therapeutically effective amount to treat or prevent said cancer.
- Embodiments 1 to 3 in the form of a kit for combined administration comprising (a) one or more dosage units of (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-1H- benzo[d]imidazol-2-yl)-2-methylisonicotinamide, or a pharmaceutically acceptable salt thereof, and (b) one or more dosage units of Nivolumab.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Hospice & Palliative Care (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gynecology & Obstetrics (AREA)
- Dermatology (AREA)
- Pregnancy & Childbirth (AREA)
- Physiology (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2017004360A MX378690B (es) | 2014-10-03 | 2015-10-02 | Terapias de combinacion. |
| KR1020177012013A KR20170066546A (ko) | 2014-10-03 | 2015-10-02 | 조합 요법 |
| EP19206634.8A EP3662903A3 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| ES15782164T ES2774448T3 (es) | 2014-10-03 | 2015-10-02 | Terapias de combinación |
| EP15782164.6A EP3200775B1 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| CA2963281A CA2963281A1 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| BR112017006664A BR112017006664A2 (pt) | 2014-10-03 | 2015-10-02 | terapias de combinação |
| CN201580066100.7A CN107106687A (zh) | 2014-10-03 | 2015-10-02 | 组合治疗 |
| EA201790737A EA201790737A1 (ru) | 2014-10-03 | 2015-10-02 | Комбинированная терапия |
| JP2017517730A JP2017535528A (ja) | 2014-10-03 | 2015-10-02 | 組み合わせ治療 |
| AU2015327868A AU2015327868A1 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| US15/515,469 US20170209574A1 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| US16/878,155 US20210000951A1 (en) | 2014-10-03 | 2020-05-19 | Combination therapies |
| AU2021204687A AU2021204687A1 (en) | 2014-10-03 | 2021-07-05 | Combination therapies |
| JP2021191659A JP2022043060A (ja) | 2014-10-03 | 2021-11-26 | 組み合わせ治療 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462059832P | 2014-10-03 | 2014-10-03 | |
| US62/059,832 | 2014-10-03 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/515,469 A-371-Of-International US20170209574A1 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
| US16/878,155 Continuation US20210000951A1 (en) | 2014-10-03 | 2020-05-19 | Combination therapies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016054555A2 true WO2016054555A2 (en) | 2016-04-07 |
| WO2016054555A3 WO2016054555A3 (en) | 2016-06-30 |
Family
ID=54337395
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/053799 Ceased WO2016054555A2 (en) | 2014-10-03 | 2015-10-02 | Combination therapies |
Country Status (12)
| Country | Link |
|---|---|
| US (2) | US20170209574A1 (enExample) |
| EP (2) | EP3200775B1 (enExample) |
| JP (2) | JP2017535528A (enExample) |
| KR (1) | KR20170066546A (enExample) |
| CN (1) | CN107106687A (enExample) |
| AU (2) | AU2015327868A1 (enExample) |
| BR (1) | BR112017006664A2 (enExample) |
| CA (1) | CA2963281A1 (enExample) |
| EA (1) | EA201790737A1 (enExample) |
| ES (1) | ES2774448T3 (enExample) |
| MX (2) | MX378690B (enExample) |
| WO (1) | WO2016054555A2 (enExample) |
Cited By (77)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017007658A1 (en) * | 2015-07-07 | 2017-01-12 | Rigel Pharmaceuticals, Inc. | A combination for immune mediated cancer treatment |
| US9605070B2 (en) | 2014-01-31 | 2017-03-28 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US9644032B2 (en) | 2015-05-29 | 2017-05-09 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| US20170145093A1 (en) | 2008-04-09 | 2017-05-25 | Genentech, Inc. | Novel compositions and methods for the treatment of immune related diseases |
| US9683048B2 (en) | 2014-01-24 | 2017-06-20 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| WO2017175200A1 (en) * | 2016-04-08 | 2017-10-12 | The Regents Of The University Of California | Modified hyaluronic acid hydrogels and proteins for the time-controlled release of biologic agents |
| US9815897B2 (en) | 2013-05-02 | 2017-11-14 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (PD-1) |
| WO2018035395A1 (en) * | 2016-08-19 | 2018-02-22 | Irx Therapeutics, Inc. | Uses of pd-1/pd-l1 inhibitors and/or ctla-4 inhibitors with a biologic containing multiple cytokine components to treat cancer |
| WO2018039275A1 (en) | 2016-08-24 | 2018-03-01 | Ignyta, Inc. | Combinations for the treatment of cancer |
| US9908936B2 (en) | 2014-03-14 | 2018-03-06 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| WO2018049027A1 (en) | 2016-09-07 | 2018-03-15 | Trustees Of Tufts College | Combination therapies using immuno-dash inhibitors and pge2 antagonists |
| US9920123B2 (en) | 2008-12-09 | 2018-03-20 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2018081898A1 (en) * | 2016-11-03 | 2018-05-11 | Trillium Therapeutics Inc. | Improvements in cd47 blockade therapy by hdac inhibitors |
| WO2018081897A1 (en) * | 2016-11-03 | 2018-05-11 | Trillium Therapeutics Inc. | Enhancement of cd47 blockade therapy by proteasome inhibitors |
| US9975957B2 (en) | 2014-03-31 | 2018-05-22 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| US9988452B2 (en) | 2014-10-14 | 2018-06-05 | Novartis Ag | Antibody molecules to PD-L1 and uses thereof |
| US10004745B2 (en) | 2010-06-03 | 2018-06-26 | Pharmacyclics Llc | Use of inhibitors of Bruton'S tyrosine kinase (Btk) |
| WO2018175179A1 (en) * | 2017-03-20 | 2018-09-27 | Vaccinex, Inc. | Treatment of cancer with a semaphorin-4d antibody in combination with an epigenetic modulating agent |
| WO2018178250A1 (en) | 2017-03-31 | 2018-10-04 | Boehringer Ingelheim International Gmbh | Anticancer combination therapy |
| US10093742B2 (en) | 2015-07-23 | 2018-10-09 | Inhibrx, Inc. | Multispecific GITR-binding fusion proteins and methods of use thereof |
| US10112997B2 (en) | 2015-05-28 | 2018-10-30 | Oncomed Pharmaceuticals, Inc. | Tight-binding agents and uses thereof |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| WO2019077132A1 (en) | 2017-10-19 | 2019-04-25 | Debiopharm International S.A. | COMBINATION PRODUCT FOR THE TREATMENT OF CANCER |
| WO2019087092A1 (en) | 2017-11-06 | 2019-05-09 | Aurigene Discovery Technologies Limited | Conjoint therapies for immunomodulation |
| WO2019087087A1 (en) | 2017-11-03 | 2019-05-09 | Aurigene Discovery Technologies Limited | Dual inhibitors of tim-3 and pd-1 pathways |
| JP2019515044A (ja) * | 2016-05-05 | 2019-06-06 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | チェックポイント分子を標的とするdnaモノクロナール抗体 |
| JP2019514393A (ja) * | 2016-05-04 | 2019-06-06 | フレッド ハッチンソン キャンサー リサーチ センター | 細胞に基づくネオ抗原ワクチンおよびその使用 |
| EP3397262A4 (en) * | 2015-12-28 | 2019-06-19 | Syndax Pharmaceuticals Inc. | COMBINATION OF AN HDAC INHIBITOR AND ANTI-PD-L1 ANTIBODY FOR THE TREATMENT OF EGG CANCER |
| WO2019122337A1 (en) | 2017-12-21 | 2019-06-27 | Debiopharm International S.A. | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| US10344090B2 (en) | 2013-12-12 | 2019-07-09 | Shanghai Hangrui Pharmaceutical Co., Ltd. | PD-1 antibody, antigen-binding fragment thereof, and medical application thereof |
| JP2019527236A (ja) * | 2016-08-01 | 2019-09-26 | モレキュラー テンプレーツ,インコーポレイティド | 癌を治療するための免疫調節剤と組み合わせた低酸素活性化型プロドラッグの投与 |
| US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
| US10478494B2 (en) | 2015-04-03 | 2019-11-19 | Astex Therapeutics Ltd | FGFR/PD-1 combination therapy for the treatment of cancer |
| CN110662540A (zh) * | 2017-06-02 | 2020-01-07 | 拜耳股份公司 | 用于治疗癌症的瑞格菲尼和pd-1/pd-l1(2)抑制剂的组合产品 |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| WO2020024932A1 (en) * | 2018-07-31 | 2020-02-06 | Ascentage Pharma (Suzhou) Co., Ltd. | Method for treating cancer by combination of iap inhibitor and modulator of immune checkpoint molecule |
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| US10611836B2 (en) | 2013-07-16 | 2020-04-07 | Genentech, Inc. | Methods of treating cancer using PD-1 axis binding antagonists and tigit inhibitors |
| US10639368B2 (en) | 2016-05-27 | 2020-05-05 | Agenus Inc. | Anti-TIM-3 antibodies and methods of use thereof |
| CN111148518A (zh) * | 2017-03-30 | 2020-05-12 | 丹娜法伯癌症研究院 | 使用cdk4/6抑制剂调控调节性t细胞和免疫应答的方法 |
| WO2020109328A1 (en) | 2018-11-26 | 2020-06-04 | Debiopharm International S.A. | Combination treatment of hiv infections |
| JP2020517658A (ja) * | 2017-04-20 | 2020-06-18 | ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago | 免疫療法用抗体と連結させたecm親和性ペプチドを用いてがんを処置するための方法および組成物 |
| WO2020148447A1 (en) | 2019-01-17 | 2020-07-23 | Debiopharm International S.A. | Combination product for the treatment of cancer |
| WO2020159504A1 (en) * | 2019-01-30 | 2020-08-06 | Nomocan Pharmaceuticals Llc | Antibodies to m(h)dm2/4 and their use in diagnosing and treating cancer |
| EP3696191A1 (en) | 2019-02-14 | 2020-08-19 | Fundación Instituto de Investigación contra la Leucemia Josep Carreras (IJC) | Car t-cells for the treatment of cd1a-positive cancer |
| US20200261573A1 (en) * | 2015-12-17 | 2020-08-20 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| US20200319163A1 (en) * | 2019-03-29 | 2020-10-08 | Georgetown University | Methods and compositions overcoming cancer cell immune resistance |
| EP3768259A2 (en) | 2018-03-14 | 2021-01-27 | Aurigene Discovery Technologies Limited | Method of modulating tigit and pd-1 signalling pathways using 1,2,4-oxadiazole compounds |
| WO2021023721A1 (en) | 2019-08-02 | 2021-02-11 | Fundacio Clinic Per A La Recerca Biomedica | Car t-cells against bcma for the treatment of multiple myeloma |
| WO2021030251A1 (en) | 2019-08-12 | 2021-02-18 | Purinomia Biotech, Inc. | Methods and compositions for promoting and potentiating t-cell mediated immune responses through adcc targeting of cd39 expressing cells |
| US10954301B2 (en) | 2015-12-14 | 2021-03-23 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof |
| US10954567B2 (en) | 2012-07-24 | 2021-03-23 | Pharmacyclics Llc | Mutations associated with resistance to inhibitors of Bruton's Tyrosine Kinase (BTK) |
| WO2021058794A1 (en) | 2019-09-25 | 2021-04-01 | Debiopharm International S.A. | Dosing regimens for treatment of patients with locally advanced squamous cell carcinoma |
| WO2021098757A1 (en) * | 2019-11-21 | 2021-05-27 | Beigene, Ltd. | Methods of cancer treatment using anti-ox40 antibodies in combination with anti-tigit antibodies |
| CN112996814A (zh) * | 2018-11-14 | 2021-06-18 | 拜耳公司 | 用于治疗癌症的抗ceacam6和抗pd-1或抗pd-l1抗体的药物组合 |
| US11046776B2 (en) | 2016-08-05 | 2021-06-29 | Genentech, Inc. | Multivalent and multiepitopic antibodies having agonistic activity and methods of use |
| US11136384B2 (en) | 2016-11-30 | 2021-10-05 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| US11147818B2 (en) * | 2016-06-24 | 2021-10-19 | Infinity Pharmaceuticals, Inc. | Combination therapies |
| US11155624B2 (en) | 2016-11-01 | 2021-10-26 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (PD-1) |
| US11208484B2 (en) * | 2016-10-10 | 2021-12-28 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | Use of combination of anti-PD-1 antibody and VEGFR inhibitor in preparation of drug for treating cancers |
| US11312718B2 (en) | 2011-01-10 | 2022-04-26 | Infinity Pharmaceuticals, Inc. | Formulations of (S)-3-(1-(9H-purin-6-ylamino)ethyl)-8-chloro-2-phenylisoquinolin-1(2H)-one |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| RU2774838C2 (ru) * | 2017-06-02 | 2022-06-23 | Байер Хелскеа Ллк | Комбинация регорафениба и ингибиторов pd-1/pd-l1(2) для лечения рака |
| US11407830B2 (en) | 2017-01-09 | 2022-08-09 | Tesaro, Inc. | Methods of treating cancer with anti-PD-1 antibodies |
| US11407840B2 (en) | 2017-07-27 | 2022-08-09 | Nomocan Pharmaceuticals Llc | Antibodies to M(H)DM2/4 and their use in diagnosing and treating cancer |
| US11433065B2 (en) | 2008-01-04 | 2022-09-06 | Intellikine Llc | Certain chemical entities, compositions and methods |
| US11535670B2 (en) | 2016-05-11 | 2022-12-27 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US20230091221A1 (en) * | 2017-09-26 | 2023-03-23 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical composition |
| EP4234582A1 (en) | 2022-02-28 | 2023-08-30 | Onechain Immunotherapeutics SL | Humanized cd1a targeting moiety for the treatment of cd1a-positive cancer |
| WO2023161530A1 (en) | 2022-02-28 | 2023-08-31 | Onechain Immunotherapeutics S.L | HUMANIZED CD1a TARGETING MOIETY FOR THE TREATMENT OF CD1A-POSITIVE CANCER |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| EP4417623A1 (en) | 2023-02-15 | 2024-08-21 | Fundació Institut de Recerca Contra la Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
| US12103974B2 (en) | 2018-05-23 | 2024-10-01 | Beigene, Ltd. | Anti-OX40 antibodies and methods of use |
| US12122833B2 (en) | 2016-05-11 | 2024-10-22 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US12298311B2 (en) | 2017-02-07 | 2025-05-13 | Saitama Medical University | Immunological biomarker for predicting clinical effect of cancer |
| US12442820B2 (en) | 2019-02-20 | 2025-10-14 | Saitama Medical University | Peripheral blood biomarker for evaluating anti-tumor immune effect of radiation therapy |
Families Citing this family (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| MX2011000235A (es) | 2008-07-08 | 2011-02-23 | Incyte Corp | 1,2,5-oxadiazoles como inhibidores de indolamina 2,3-dioxigenasa. |
| CN118286440A (zh) | 2014-02-04 | 2024-07-05 | 辉瑞大药厂 | 用于治疗癌症的pd-1拮抗剂和vegfr抑制剂的组合 |
| BR112017018234A2 (pt) | 2015-02-26 | 2018-04-17 | Merck Patent Gmbh | inibidores de pd-1 / pd-l1 para o tratamento de câncer |
| PH12017502013B1 (en) | 2015-05-07 | 2022-07-22 | Agenus Inc | Anti-ox40 antibodies and methods of use thereof |
| HUE050750T2 (hu) | 2015-05-29 | 2021-01-28 | Agenus Inc | CTLA-4 elleni antitestek és eljárások alkalmazásukra |
| KR102712880B1 (ko) | 2015-06-16 | 2024-10-02 | 메르크 파텐트 게엠베하 | Pd-l1 길항제 조합 치료 |
| CN114605548A (zh) | 2015-09-01 | 2022-06-10 | 艾吉纳斯公司 | 抗-pd-1抗体及其使用方法 |
| JP2018532756A (ja) * | 2015-11-04 | 2018-11-08 | インサイト・コーポレイションIncyte Corporation | インドールアミン2,3−ジオキシゲナーゼを阻害するための医薬組成物と方法、及びその適応 |
| SG11201804265XA (en) | 2015-12-02 | 2018-06-28 | Agenus Inc | Antibodies and methods of use thereof |
| US11883404B2 (en) | 2016-03-04 | 2024-01-30 | Taiho Pharmaceuticals Co., Ltd. | Preparation and composition for treatment of malignant tumors |
| KR102793563B1 (ko) | 2016-03-04 | 2025-04-11 | 다이호야쿠힌고교 가부시키가이샤 | 악성 종양 치료용 제제 및 조성물 |
| US20190183972A1 (en) * | 2016-06-03 | 2019-06-20 | Imclone Llc | Combination of ramucirumab and pembrolizumab for the treatment of certain cancers |
| CA3029902A1 (en) | 2016-07-07 | 2018-01-11 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| CN106350488B (zh) * | 2016-09-19 | 2019-09-27 | 大连大学 | 用于治疗肿瘤的pd-1封闭cik的制备方法 |
| MX2019003755A (es) | 2016-10-06 | 2019-08-12 | Pfizer | Regimen de dosificacion de avelumab para el tratamiento de cancer. |
| WO2018071500A1 (en) | 2016-10-11 | 2018-04-19 | Agenus Inc. | Anti-lag-3 antibodies and methods of use thereof |
| CA3041340A1 (en) | 2016-11-09 | 2018-05-17 | Agenus Inc. | Anti-ox40 antibodies, anti-gitr antibodies, and methods of use thereof |
| KR20240024296A (ko) | 2016-12-05 | 2024-02-23 | 쥐원 쎄라퓨틱스, 인크. | 화학요법 레지멘 동안의 면역 반응의 보존 |
| KR102603681B1 (ko) | 2016-12-07 | 2023-11-17 | 아게누스 인코포레이티드 | 항체 및 이의 사용방법 |
| EA201991383A1 (ru) | 2016-12-07 | 2019-12-30 | Эйдженус Инк. | Антитела против ctla-4 и способы их применения |
| WO2019023786A1 (en) | 2017-08-01 | 2019-02-07 | University Health Network | COMBINED THERAPIES FOR THE INHIBITION OF TTK PROTEIN KINASE |
| CA3074876A1 (en) * | 2017-09-08 | 2019-03-14 | University Health Network | Combination therapies for inhibition of polo-like kinase 4 |
| CN116392497A (zh) * | 2017-11-28 | 2023-07-07 | 深圳艾欣达伟医药科技有限公司 | 葡磷酰胺的抗癌医药用途 |
| US20200377599A1 (en) * | 2017-11-30 | 2020-12-03 | Beth Israel Deaconess Medical Center, Inc. | Compositions and methods for treating cancer |
| WO2019136311A2 (en) * | 2018-01-05 | 2019-07-11 | Biograph 55, Inc. | Compositions and methods for cancer immunotherapy |
| AU2019205821C1 (en) | 2018-01-08 | 2025-02-13 | Pharmacosmos Holding A/S | G1T38 superior dosage regimes |
| JP2021516215A (ja) * | 2018-01-10 | 2021-07-01 | アレイ・バイオファーマ・インコーポレーテッド | 癌を処置するための方法および併用療法 |
| CA3091373A1 (en) * | 2018-02-17 | 2019-08-22 | Apollomics Inc. | Cancer treatment using combination of neutrophil modulator with modulator of immune checkpoint |
| US20200376035A1 (en) * | 2018-02-26 | 2020-12-03 | The Trustees Of The University Of Pennsylvania | Methods and compositions comprising cart and a smac mimetic |
| CA3092632A1 (en) * | 2018-03-08 | 2019-09-12 | Astrazeneca Ab | Compositions and methods for treating late stage lung cancer |
| EP4353222A1 (en) | 2018-03-19 | 2024-04-17 | Taiho Pharmaceutical Co., Ltd. | Use of sodium alkyl sulfate |
| CN114366743A (zh) * | 2018-04-09 | 2022-04-19 | G1治疗公司 | 具有驱动致癌突变的癌症的治疗 |
| EP3793585A4 (en) * | 2018-05-16 | 2022-02-23 | Duke University | NEADJUVANT CANCER TREATMENT COMPRISING THE COMBINATION OF AN IMMUNOTOXIN AND A CHECKPOINT INHIBITOR |
| CN112312895B (zh) * | 2018-06-20 | 2023-05-09 | 富士胶片株式会社 | 包含内含药物的脂质体组合物及免疫检查点抑制剂的组合医药 |
| MX2021000726A (es) * | 2018-07-26 | 2021-03-25 | Bristol Myers Squibb Co | Terapia combinada de gen de activacion de linfocitos 3(lag-3) para el tratamiento del cancer. |
| EP3833693A4 (en) * | 2018-08-21 | 2023-06-07 | ABL Bio Inc. | Anti-pd-l1/anti-lag3 bispecific antibodies and uses thereof |
| WO2020071349A1 (ja) * | 2018-10-01 | 2020-04-09 | 富士フイルム株式会社 | 薬物を内包するリポソーム組成物およびプラチナ製剤を含む組合せ医薬 |
| EP3897725A4 (en) * | 2018-12-21 | 2022-11-30 | Actinium Pharmaceuticals, Inc. | COMBINATION OF RADIOIMMUNOTHERAPY AND IMMUNOTHERAPY IN THE TREATMENT OF CANCER |
| WO2020171141A1 (ja) * | 2019-02-20 | 2020-08-27 | 学校法人 埼玉医科大学 | がん免疫療法における長期生存を予測するための方法および組成物 |
| WO2020172233A1 (en) * | 2019-02-22 | 2020-08-27 | The Trustees Of Columbia University In The City Of New York | Treatment of prostate cancer by androgen ablation and il-8 blockade |
| EP3932427A4 (en) * | 2019-02-28 | 2022-12-07 | Taiho Pharmaceutical Co., Ltd. | CANCER THERAPY USING A 3,5-DISUBSTITUTED BENZOLALKYNYL COMPOUND AND PEMBROLIZUMAB |
| JP2022525594A (ja) | 2019-03-15 | 2022-05-18 | ボルト バイオセラピューティクス、インコーポレーテッド | Her2を標的とする免疫結合体 |
| CN110179977A (zh) * | 2019-05-22 | 2019-08-30 | 华中科技大学同济医学院附属同济医院 | 用于治疗黑色素瘤、肺癌或结直肠癌的组合药物制剂 |
| JP7687969B2 (ja) | 2019-06-28 | 2025-06-03 | ボード オブ レジェンツ,ザ ユニバーシティ オブ テキサス システム | リポソーム化アナマイシン前駆体凍結乾燥物の調製 |
| KR20220027941A (ko) | 2019-06-28 | 2022-03-08 | 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 | 리포솜 아나마이신의 재구성 방법 |
| CN114096280A (zh) * | 2019-07-12 | 2022-02-25 | 俄勒冈健康与科学大学 | 用于共同递送有丝分裂激酶抑制剂和免疫检查点抑制剂的治疗构建体 |
| KR20210028339A (ko) * | 2019-09-04 | 2021-03-12 | 크리스탈지노믹스(주) | Hdac 저해제와 항 pd-1 항체 또는 항 pd-l1 항체를 포함하는 약학 조성물 |
| US12377116B2 (en) * | 2019-09-11 | 2025-08-05 | Aureo Co., Ltd. | Composition for enhancing effect of antibody drug |
| IL293144A (en) * | 2019-11-21 | 2022-07-01 | Univ Texas | Lung targeted anticancer therapies with liposomal annamycin |
| US10988479B1 (en) | 2020-06-15 | 2021-04-27 | G1 Therapeutics, Inc. | Morphic forms of trilaciclib and methods of manufacture thereof |
| IL299245A (en) | 2020-06-22 | 2023-02-01 | Ngm Biopharmaceuticals Inc | LAIR-1 binding agents and methods of using them |
| CN112972688A (zh) * | 2021-02-08 | 2021-06-18 | 吉林大学第一医院 | PPARδ抑制剂联合免疫治疗药物在制备抗肿瘤药物中的应用 |
| US20220251218A1 (en) * | 2021-02-10 | 2022-08-11 | Gnt Biotech & Medicals Corporation | Pharmaceutical combination and method for overcoming immune suppression or stimulating immune response against cancer |
| CN115671289B (zh) * | 2021-07-27 | 2024-04-26 | 广州嘉越医药科技有限公司 | 药物组合及其应用 |
| TWI843159B (zh) * | 2021-07-27 | 2024-05-21 | 大陸商廣州嘉越醫藥科技有限公司 | 藥物組合及其應用 |
| EP4402176A4 (en) * | 2021-09-16 | 2025-08-13 | Gt Biopharma Inc | FUSION PROTEINS TARGETING PD-L1 AND METHODS OF USE THEREOF |
| US12173081B2 (en) | 2023-03-21 | 2024-12-24 | Biograph 55, Inc. | CD19/CD38 multispecific antibodies |
| CN117604110B (zh) * | 2024-01-23 | 2024-04-19 | 杭州华得森生物技术有限公司 | 用于乳腺癌诊断和预后判断的生物标志物及其应用 |
| WO2025211692A1 (ko) * | 2024-04-02 | 2025-10-09 | (주)에트노바테라퓨틱스 | 암 예방 또는 치료를 위한 병용 투여용 약학 조성물 세트 |
Citations (134)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2779780A (en) | 1955-03-01 | 1957-01-29 | Du Pont | 1, 4-diamino-2, 3-dicyano-1, 4-bis (substituted mercapto) butadienes and their preparation |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994010202A1 (en) | 1992-10-28 | 1994-05-11 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| WO1996030046A1 (en) | 1995-03-30 | 1996-10-03 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1998045332A2 (en) | 1997-04-07 | 1998-10-15 | Genentech, Inc. | Humanized antibodies and methods for forming humanized antibodies |
| WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| WO1999052552A1 (en) | 1998-04-15 | 1999-10-21 | Brigham & Women's Hospital, Inc. | T cell inhibitory receptor compositions and uses thereof |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO2000035436A2 (en) | 1998-12-16 | 2000-06-22 | Warner-Lambert Company | Treatment of arthritis with mek inhibitors |
| US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
| WO2002006213A2 (en) | 2000-07-19 | 2002-01-24 | Warner-Lambert Company | Oxygenated esters of 4-iodo phenylamino benzhydroxamic acids |
| WO2002022577A2 (en) | 2000-09-01 | 2002-03-21 | Novartis Ag | Hydroxamate derivatives useful as deacetylase inhibitors |
| WO2002066470A1 (en) | 2001-01-12 | 2002-08-29 | Amgen Inc. | Substituted alkylamine derivatives and methods of use |
| US6582959B2 (en) | 1991-03-29 | 2003-06-24 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| WO2003064383A2 (en) | 2002-02-01 | 2003-08-07 | Ariad Gene Therapeutics, Inc. | Phosphorus-containing compounds & uses thereof |
| WO2003076424A1 (en) | 2002-03-08 | 2003-09-18 | Eisai Co. Ltd. | Macrocyclic compounds useful as pharmaceuticals |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US20030190317A1 (en) | 1997-04-07 | 2003-10-09 | Genentech, Inc. | Anti-VEGF antibodies |
| US20030206899A1 (en) | 1991-03-29 | 2003-11-06 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| US6703020B1 (en) | 1999-04-28 | 2004-03-09 | Board Of Regents, The University Of Texas System | Antibody conjugate methods for selectively inhibiting VEGF |
| US20040047858A1 (en) | 2002-09-11 | 2004-03-11 | Blumberg Richard S. | Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof |
| WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
| US6780996B2 (en) | 2002-04-30 | 2004-08-24 | Wyeth Holdings Corporation | Process for the preparation of 7-substituted-3 quinolinecarbonitriles |
| WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
| WO2005012359A2 (en) | 2003-08-01 | 2005-02-10 | Genentech, Inc. | Anti-vegf antibodies |
| US6884879B1 (en) | 1997-04-07 | 2005-04-26 | Genentech, Inc. | Anti-VEGF antibodies |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| US20050112126A1 (en) | 1997-04-07 | 2005-05-26 | Genentech, Inc. | Anti-VEGF antibodies |
| WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
| US20050186208A1 (en) | 2003-05-30 | 2005-08-25 | Genentech, Inc. | Treatment with anti-VEGF antibodies |
| WO2005113556A1 (en) | 2004-05-13 | 2005-12-01 | Icos Corporation | Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta |
| WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| US20060009360A1 (en) | 2004-06-25 | 2006-01-12 | Robert Pifer | New adjuvant composition |
| WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2007014011A2 (en) | 2005-07-21 | 2007-02-01 | Ardea Biosciences, Inc. | N-(arylamino)-sulfonamide inhibitors of mek |
| WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
| WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
| WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
| EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
| WO2008016893A1 (en) | 2006-08-02 | 2008-02-07 | Novartis Ag | Smac peptidomimetics useful as iap inhibitors |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| WO2009036082A2 (en) | 2007-09-12 | 2009-03-19 | Genentech, Inc. | Combinations of phosphoinositide 3-kinase inhibitor compounds and chemotherapeutic agents, and methods of use |
| WO2009055730A1 (en) | 2007-10-25 | 2009-04-30 | Genentech, Inc. | Process for making thienopyrimidine compounds |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| EP2099447A1 (en) | 2006-11-22 | 2009-09-16 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009114870A2 (en) | 2008-03-14 | 2009-09-17 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
| WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
| WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
| WO2010006086A2 (en) | 2008-07-08 | 2010-01-14 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20100056576A1 (en) | 2008-09-02 | 2010-03-04 | Burger Matthew T | Kinase inhibitors and methods of their use |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
| WO2010036380A1 (en) | 2008-09-26 | 2010-04-01 | Intellikine, Inc. | Heterocyclic kinase inhibitors |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2010125571A1 (en) | 2009-04-30 | 2010-11-04 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Anti ceacam1 antibodies and methods of using same |
| WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
| US8039479B2 (en) | 2006-12-08 | 2011-10-18 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| WO2011155607A1 (ja) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | 抗tim-3抗体 |
| US20120022814A1 (en) | 2001-02-28 | 2012-01-26 | Sayre Swarztrauber | Apparatus and methods for multi-channel metering |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| WO2012079000A1 (en) | 2010-12-09 | 2012-06-14 | The Trustees Of The University Of Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| WO2012177624A2 (en) | 2011-06-21 | 2012-12-27 | The Johns Hopkins University | Focused radiation for augmenting immune-based therapies against neoplasms |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| WO2013054331A1 (en) | 2011-10-11 | 2013-04-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| WO2013082366A1 (en) | 2011-12-01 | 2013-06-06 | The Brigham And Women's Hospital, Inc. | Anti-ceacam1 recombinant antibodies for cancer therapy |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
| US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
| WO2013179174A1 (en) | 2012-05-29 | 2013-12-05 | Koninklijke Philips N.V. | Lighting arrangement |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
| WO2014018632A1 (en) | 2012-07-27 | 2014-01-30 | Novartis Ag | Prediction of treatment response to jak/stat inhibitor |
| WO2014022332A1 (en) | 2012-07-31 | 2014-02-06 | The Brigham And Women's Hospital, Inc. | Modulation of the immune response |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| WO2014059251A1 (en) | 2012-10-12 | 2014-04-17 | The Brigham And Women's Hospital, Inc. | Enhancement of the immune response |
| WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
| US8735551B2 (en) | 2010-08-20 | 2014-05-27 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (HER3) |
| WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| US5968511A (en) * | 1996-03-27 | 1999-10-19 | Genentech, Inc. | ErbB3 antibodies |
| CN101333256A (zh) * | 1999-03-25 | 2008-12-31 | 艾博特股份有限两合公司 | 结合人il-12的人抗体及其生产方法 |
| PT1789390E (pt) | 2004-09-02 | 2012-02-08 | Genentech Inc | Inibidores de piridilo da sinalização de hedgehog |
| FR2888850B1 (fr) * | 2005-07-22 | 2013-01-11 | Pf Medicament | Nouveaux anticorps anti-igf-ir et leurs applications |
| WO2007113648A2 (en) * | 2006-04-05 | 2007-10-11 | Pfizer Products Inc. | Ctla4 antibody combination therapy |
| CA2779436A1 (en) * | 2008-10-31 | 2010-05-06 | Biogen Idec Ma Inc. | Light targeting molecules and uses thereof |
| US20120253017A1 (en) * | 2009-05-28 | 2012-10-04 | Victoria Ballard | Stem cell targeting |
| CN102822200A (zh) * | 2009-07-20 | 2012-12-12 | 百时美施贵宝公司 | 对增殖性疾病进行协同性治疗的抗ctla-4抗体与各种治疗方案的组合 |
| BR112016013963A2 (pt) * | 2013-12-17 | 2017-10-10 | Genentech Inc | terapia de combinação compreendendo agonistas de ligação de ox40 e antagonistas de ligação do eixo de pd-1 |
| EP3082853A2 (en) * | 2013-12-20 | 2016-10-26 | The Broad Institute, Inc. | Combination therapy with neoantigen vaccine |
| JOP20200094A1 (ar) * | 2014-01-24 | 2017-06-16 | Dana Farber Cancer Inst Inc | جزيئات جسم مضاد لـ pd-1 واستخداماتها |
| JOP20200096A1 (ar) * | 2014-01-31 | 2017-06-16 | Children’S Medical Center Corp | جزيئات جسم مضاد لـ tim-3 واستخداماتها |
| LT3116909T (lt) * | 2014-03-14 | 2020-02-10 | Novartis Ag | Antikūno molekulės prieš lag-3 ir jų panaudojimas |
| JO3663B1 (ar) * | 2014-08-19 | 2020-08-27 | Merck Sharp & Dohme | الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين |
| BR112017004826A2 (pt) * | 2014-09-13 | 2017-12-12 | Novartis Ag | terapias de combinação de inibidores de alk |
-
2015
- 2015-10-02 AU AU2015327868A patent/AU2015327868A1/en not_active Abandoned
- 2015-10-02 CN CN201580066100.7A patent/CN107106687A/zh active Pending
- 2015-10-02 ES ES15782164T patent/ES2774448T3/es active Active
- 2015-10-02 CA CA2963281A patent/CA2963281A1/en not_active Abandoned
- 2015-10-02 BR BR112017006664A patent/BR112017006664A2/pt not_active Application Discontinuation
- 2015-10-02 US US15/515,469 patent/US20170209574A1/en not_active Abandoned
- 2015-10-02 EP EP15782164.6A patent/EP3200775B1/en active Active
- 2015-10-02 EP EP19206634.8A patent/EP3662903A3/en not_active Withdrawn
- 2015-10-02 WO PCT/US2015/053799 patent/WO2016054555A2/en not_active Ceased
- 2015-10-02 JP JP2017517730A patent/JP2017535528A/ja not_active Ceased
- 2015-10-02 MX MX2017004360A patent/MX378690B/es unknown
- 2015-10-02 KR KR1020177012013A patent/KR20170066546A/ko not_active Ceased
- 2015-10-02 EA EA201790737A patent/EA201790737A1/ru unknown
-
2017
- 2017-04-03 MX MX2020005894A patent/MX2020005894A/es unknown
-
2020
- 2020-05-19 US US16/878,155 patent/US20210000951A1/en not_active Abandoned
-
2021
- 2021-07-05 AU AU2021204687A patent/AU2021204687A1/en not_active Abandoned
- 2021-11-26 JP JP2021191659A patent/JP2022043060A/ja active Pending
Patent Citations (169)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2779780A (en) | 1955-03-01 | 1957-01-29 | Du Pont | 1, 4-diamino-2, 3-dicyano-1, 4-bis (substituted mercapto) butadienes and their preparation |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| US20030203409A1 (en) | 1991-03-29 | 2003-10-30 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| US6582959B2 (en) | 1991-03-29 | 2003-06-24 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
| US20030206899A1 (en) | 1991-03-29 | 2003-11-06 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5585499A (en) | 1992-03-25 | 1996-12-17 | Immunogen Inc. | Cyclopropylbenzindole-containing cytotoxic drugs |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5846545A (en) | 1992-03-25 | 1998-12-08 | Immunogen, Inc. | Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| EP0666868B1 (en) | 1992-10-28 | 2002-04-03 | Genentech, Inc. | Use of anti-VEGF antibodies for the treatment of cancer |
| WO1994010202A1 (en) | 1992-10-28 | 1994-05-11 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| WO1996030046A1 (en) | 1995-03-30 | 1996-10-03 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| EP1947183B1 (en) | 1996-08-16 | 2013-07-17 | Merck Sharp & Dohme Corp. | Mammalian cell surface antigens; related reagents |
| US7025962B1 (en) | 1996-08-16 | 2006-04-11 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| US6884879B1 (en) | 1997-04-07 | 2005-04-26 | Genentech, Inc. | Anti-VEGF antibodies |
| US20050112126A1 (en) | 1997-04-07 | 2005-05-26 | Genentech, Inc. | Anti-VEGF antibodies |
| US7060269B1 (en) | 1997-04-07 | 2006-06-13 | Genentech, Inc. | Anti-VEGF antibodies |
| WO1998045332A2 (en) | 1997-04-07 | 1998-10-15 | Genentech, Inc. | Humanized antibodies and methods for forming humanized antibodies |
| US20030190317A1 (en) | 1997-04-07 | 2003-10-09 | Genentech, Inc. | Anti-VEGF antibodies |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| US7132255B2 (en) | 1998-04-15 | 2006-11-07 | The Brigham And Women's Hospital, Inc. | Identification of compounds that bind biliary glycoprotein and affect cytotoxic T lymphocyte activity |
| WO1999052552A1 (en) | 1998-04-15 | 1999-10-21 | Brigham & Women's Hospital, Inc. | T cell inhibitory receptor compositions and uses thereof |
| WO2000035436A2 (en) | 1998-12-16 | 2000-06-22 | Warner-Lambert Company | Treatment of arthritis with mek inhibitors |
| US6703020B1 (en) | 1999-04-28 | 2004-03-09 | Board Of Regents, The University Of Texas System | Antibody conjugate methods for selectively inhibiting VEGF |
| WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
| WO2002006213A2 (en) | 2000-07-19 | 2002-01-24 | Warner-Lambert Company | Oxygenated esters of 4-iodo phenylamino benzhydroxamic acids |
| EP1870399A1 (en) | 2000-09-01 | 2007-12-26 | Novartis AG | Hydroxamate derivatives useful as deacetylase inhibitors |
| WO2002022577A2 (en) | 2000-09-01 | 2002-03-21 | Novartis Ag | Hydroxamate derivatives useful as deacetylase inhibitors |
| WO2002066470A1 (en) | 2001-01-12 | 2002-08-29 | Amgen Inc. | Substituted alkylamine derivatives and methods of use |
| US20120022814A1 (en) | 2001-02-28 | 2012-01-26 | Sayre Swarztrauber | Apparatus and methods for multi-channel metering |
| WO2003064383A2 (en) | 2002-02-01 | 2003-08-07 | Ariad Gene Therapeutics, Inc. | Phosphorus-containing compounds & uses thereof |
| WO2003076424A1 (en) | 2002-03-08 | 2003-09-18 | Eisai Co. Ltd. | Macrocyclic compounds useful as pharmaceuticals |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US6780996B2 (en) | 2002-04-30 | 2004-08-24 | Wyeth Holdings Corporation | Process for the preparation of 7-substituted-3 quinolinecarbonitriles |
| WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
| US7169791B2 (en) | 2002-07-05 | 2007-01-30 | Novartis Ag | Inhibitors of tyrosine kinases |
| US20040047858A1 (en) | 2002-09-11 | 2004-03-11 | Blumberg Richard S. | Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof |
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
| US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
| US20050186208A1 (en) | 2003-05-30 | 2005-08-25 | Genentech, Inc. | Treatment with anti-VEGF antibodies |
| WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
| WO2005012359A2 (en) | 2003-08-01 | 2005-02-10 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
| WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
| WO2005113556A1 (en) | 2004-05-13 | 2005-12-01 | Icos Corporation | Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta |
| WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| US20060009360A1 (en) | 2004-06-25 | 2006-01-12 | Robert Pifer | New adjuvant composition |
| US8388967B2 (en) | 2005-03-25 | 2013-03-05 | Gitr, Inc. | Methods for inducing or enhancing an immune response by administering agonistic GITR-binding antibodies |
| US7812135B2 (en) | 2005-03-25 | 2010-10-12 | Tolerrx, Inc. | GITR-binding antibodies |
| EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007014011A2 (en) | 2005-07-21 | 2007-02-01 | Ardea Biosciences, Inc. | N-(arylamino)-sulfonamide inhibitors of mek |
| EP2474545A1 (en) | 2005-12-13 | 2012-07-11 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as Janus kinase inhibitors |
| WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
| US7598257B2 (en) | 2005-12-13 | 2009-10-06 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
| WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
| WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
| WO2008016893A1 (en) | 2006-08-02 | 2008-02-07 | Novartis Ag | Smac peptidomimetics useful as iap inhibitors |
| US8546336B2 (en) | 2006-08-02 | 2013-10-01 | Novartis Ag | SMAC peptidometics useful as IAP inhibitors |
| EP2051990A1 (en) | 2006-08-02 | 2009-04-29 | Novartis AG | Smac peptidomimetics useful as iap inhibitors |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| EP2099447A1 (en) | 2006-11-22 | 2009-09-16 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| US7767675B2 (en) | 2006-11-22 | 2010-08-03 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US8039479B2 (en) | 2006-12-08 | 2011-10-18 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
| WO2009036082A2 (en) | 2007-09-12 | 2009-03-19 | Genentech, Inc. | Combinations of phosphoinositide 3-kinase inhibitor compounds and chemotherapeutic agents, and methods of use |
| WO2009055730A1 (en) | 2007-10-25 | 2009-04-30 | Genentech, Inc. | Process for making thienopyrimidine compounds |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009114870A2 (en) | 2008-03-14 | 2009-09-17 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| US20100105667A1 (en) | 2008-05-23 | 2010-04-29 | Novartis Ag | Quinoxaline- and Quinoline-Carboxamide Derivatives |
| WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
| WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
| WO2010006086A2 (en) | 2008-07-08 | 2010-01-14 | Intellikine, Inc. | Kinase inhibitors and methods of use |
| US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US8685980B2 (en) | 2008-08-22 | 2014-04-01 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US8609089B2 (en) | 2008-08-25 | 2013-12-17 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| EP2344474A1 (en) | 2008-09-02 | 2011-07-20 | Novartis AG | Picolinamide derivatives as kinase inhibitors |
| WO2010026124A1 (en) | 2008-09-02 | 2010-03-11 | Novartis Ag | Picolinamide derivatives as kinase inhibitors |
| US20100056576A1 (en) | 2008-09-02 | 2010-03-04 | Burger Matthew T | Kinase inhibitors and methods of their use |
| WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
| US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
| WO2010036380A1 (en) | 2008-09-26 | 2010-04-01 | Intellikine, Inc. | Heterocyclic kinase inhibitors |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| WO2010125571A1 (en) | 2009-04-30 | 2010-11-04 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Anti ceacam1 antibodies and methods of using same |
| US8501758B2 (en) | 2009-08-28 | 2013-08-06 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
| US8709424B2 (en) | 2009-09-03 | 2014-04-29 | Merck Sharp & Dohme Corp. | Anti-GITR antibodies |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
| WO2011155607A1 (ja) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | 抗tim-3抗体 |
| US20140044728A1 (en) | 2010-06-11 | 2014-02-13 | Kyushu University, National University Corporation | Anti-tim-3 antibody |
| US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
| EP2581113A1 (en) | 2010-06-11 | 2013-04-17 | Kyowa Hakko Kirin Co., Ltd. | Anti-tim-3 antibody |
| US8735551B2 (en) | 2010-08-20 | 2014-05-27 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (HER3) |
| WO2012079000A1 (en) | 2010-12-09 | 2012-06-14 | The Trustees Of The University Of Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| WO2012177624A2 (en) | 2011-06-21 | 2012-12-27 | The Johns Hopkins University | Focused radiation for augmenting immune-based therapies against neoplasms |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| WO2013054331A1 (en) | 2011-10-11 | 2013-04-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| US20140271618A1 (en) | 2011-10-11 | 2014-09-18 | Ramot At Tel-Aviv University Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013082366A1 (en) | 2011-12-01 | 2013-06-06 | The Brigham And Women's Hospital, Inc. | Anti-ceacam1 recombinant antibodies for cancer therapy |
| WO2013179174A1 (en) | 2012-05-29 | 2013-12-05 | Koninklijke Philips N.V. | Lighting arrangement |
| WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
| WO2014018632A1 (en) | 2012-07-27 | 2014-01-30 | Novartis Ag | Prediction of treatment response to jak/stat inhibitor |
| WO2014022332A1 (en) | 2012-07-31 | 2014-02-06 | The Brigham And Women's Hospital, Inc. | Modulation of the immune response |
| WO2014059251A1 (en) | 2012-10-12 | 2014-04-17 | The Brigham And Women's Hospital, Inc. | Enhancement of the immune response |
| WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
| WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
Non-Patent Citations (156)
| Title |
|---|
| "Antibody Engineering Lab Manual", SPRINGER-VERLAG, article "Protein Sequence and Structure Analysis of Antibody Variable Domains" |
| "Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS |
| "Remington: The Science and Practice of Pharmacy", 2011, PHARMACEUTICAL PRESS |
| "Remington's Pharmaceutical Sciences", 1990, MACK PRINTING COMPANY, pages: 1289 - 1329 |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| AGATA ET AL., INT IMMUNOL., vol. 8, 1996, pages 765 - 72 |
| ALI, K. ET AL., NATURE, vol. 510, 2014, pages 407 - 411 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| BARBAS ET AL., PNAS, vol. 88, 1991, pages 7978 - 7982 |
| BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060 |
| BENNETT ET AL., J. IMMUNOL., vol. 170, 2003, pages 711 - 8 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER, vol. 54, 2005, pages 307 - 314 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 54, 2005, pages 307 - 314 |
| BLANK, C. ET AL., IMMUNOL. IMMUNOTHER., vol. 56, no. 5, 29 December 2006 (2006-12-29), pages 739 - 745 |
| BROWN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1257 - 66 |
| BRUGGEMAN ET AL., EUR J IMMUNOL, vol. 21, 1991, pages 1323 - 1326 |
| BRUGGEMAN ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 33 - 40 |
| CHOI ET AL., CANCER RES., vol. 68, no. 13, 2008, pages 4971 - 6 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| COLCHER, D. ET AL., ANN N Y ACAD SCI, vol. 880, 1999, pages 263 - 80 |
| COLLINS, M. ET AL., GENOME BIOL., vol. 6, 2005, pages 223.1 - 223.7 |
| COOK, R., J MANAG CARE PHARM, vol. 14, no. 7, 2008, pages 19 - 25 |
| COYLE, A. J. ET AL., NATURE IMMUNOL., vol. 2, no. 3, 2001, pages 203 - 209 |
| DEVITA, V ET AL.: "Cancer: Principles and Practice of Oncology", 1997 |
| DONG ET AL., J MOL MED, vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., J. MOL. MED., vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., NAT MED, vol. 8, 2002, pages 787 - 9 |
| DONG ET AL., NAT. MED., vol. 8, 2002, pages 787 - 9 |
| DONG, C. ET AL., IMMUNOLOG. RES., vol. 28, no. 1, 2003, pages 39 - 48 |
| DRANOFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 3539 - 43 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| EISENHAUER ET AL., EUROPEAN JOURNAL OF CANCER, vol. 45, 2009, pages 228 - 247 |
| EUR. J. IMMUNOL., vol. 32, 2002, pages 634 - 43 |
| FINGER LR ET AL., GENE, vol. 197, no. 1-2, 1997, pages 177 - 87 |
| FOON, K.: "ASCO Educational Book Spring", 2000, pages: 730 - 738 |
| FREDERICK, D.T. ET AL., CLINICAL CANCER RESEARCH, vol. 19, 2013, pages 1225 - 31 |
| FREEMAN ET AL., J. EXP. MED., vol. 192, 2000, pages 1027 - 34 |
| FREY; DUECK, SCIENCE, 2007, pages 972 - 976 |
| FUCHS ET AL., BIOLTECHNOLOGY, vol. 9, 1991, pages 1370 - 1372 |
| GARRAD ET AL., BIOLTECHNOLOGY, vol. 9, 1991, pages 1373 - 1377 |
| GRAM ET AL., PNAS, vol. 89, 1992, pages 3576 - 3580 |
| GREEN, L.L. ET AL., NATURE GENET., vol. 7, 1994, pages 13 - 21 |
| GREENWALD, R. J. ET AL., ANN. REV. IMMUNOL., vol. 23, 2005, pages 515 - 548 |
| GRIFFTHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GROSS, J. ET AL., J. IMMUNOL., vol. 149, 1992, pages 380 - 388 |
| HAHNE, M. ET AL., SCIENCE, vol. 274, 1996, pages 1363 - 1365 |
| HALLETT, WHD ET AL., J OF AMERICAN SOCIETY FOR BLOOD AND MARROW TRANSPLANTATION, vol. 17, no. 8, 2011, pages 1133 - 145 |
| HAMID, O. ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 369, no. 2, 2013, pages 134 - 44 |
| HANNE ET AL.: "AZD9291 in EGFR Inhibitor-Resistant Non-Small-Cell Lung Cancer", N ENGL J MED, vol. 372, 2015, pages 1689 - 99 |
| HASTINGS ET AL., EUR J IMMUNOL., vol. 39, no. 9, September 2009 (2009-09-01), pages 2492 - 501 |
| HAWKINS ET AL., JMOL BIOL, vol. 226, 1992, pages 889 - 896 |
| HAY ET AL., HUM ANTIBOD HYBRIDOMAS, vol. 3, 1992, pages 81 - 85 |
| HE ET AL., J. IMMUNOL., vol. 173, 2004, pages 4919 - 28 |
| HINODA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, no. 18, 1988, pages 6959 - 6963 |
| HOLLIGER, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL., NUC ACID RES, vol. 19, 1991, pages 4133 - 4137 |
| HORN ET AL., J CLIN ONCOL., vol. 27, no. 26, 2009, pages 4232 - 5 |
| HOWARD, M; O'GARRA, A., IMMUNOLOGY TODAY, vol. 13, 1992, pages 198 - 200 |
| HUANG ET AL., NATURE, 2014 |
| HUDES, G ET AL., N. ENGL. J. MED, vol. 356, no. 22, 2007, pages 2271 - 2281 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUTLOFF, A. ET AL., NATURE, vol. 397, 1999, pages 262 - 266 |
| ISHIDA, Y ET AL., EMBO J., vol. 11, 1992, pages 3887 - 3895 |
| ITO, N. ET AL., IMMUNOBIOLOGY, vol. 201, no. 5, 2000, pages 527 - 40 |
| IWAI ET AL., INT. IMMUNOL., vol. 17, 2005, pages 133 - 144 |
| IWAI ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 12293 - 7 |
| JOHN LB ET AL., CLIN. CANCER RES., vol. 19, no. 20, 2013, pages 5636 - 46 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 552 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| KEHRL, J. ET AL., J. EXP. MED., vol. 163, 1986, pages 1037 - 1050 |
| KHAYAT, D, ASCO EDUCATIONAL BOOK SPRING, 2000, pages 414 - 428 |
| KIM, N ET AL., SCIENCE, vol. 266, 1994, pages 2011 - 2013 |
| KOIVUNEN ET AL., CLIN CANCER RES., vol. 14, no. 13, 2008, pages 4275 - 83 |
| KONISHI ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 5094 - 100 |
| KORMAN, A. J ET AL., ADV. IMMUNOL., vol. 90, 2007, pages 297 - 339 |
| KORMAN, A. J. ET AL., ADV. IMMUNOL., vol. 90, 2007, pages 297 - 339 |
| KUGLER, A ET AL., NATURE MEDICINE, vol. 6, 2000, pages 332 - 336 |
| LEPENIES, B ET AL., ENDOCRINE, METABOLIC & IMMUNE DISORDERS-DRUG TARGETS, vol. 8, 2008, pages 279 - 288 |
| LI ET AL., BIOPOLYMERS, vol. 87, 2007, pages 225 - 230 |
| LINDLEY, P. S. ET AL., IMMUNOL. REV., vol. 229, 2009, pages 307 - 321 |
| LINSLEY, P. ET AL., IMMUNITY, vol. 4, 1996, pages 535 - 543 |
| LIU ET AL., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 17, 2007, pages 617 - 620 |
| LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526 |
| LIU ET AL., PNAS, vol. 84, 1987, pages 3439 - 3443 |
| LOBUGLIO ET AL., HYBRIDOMA, vol. 5, 1986, pages 5117 - 5123 |
| LOGOTHETIS, C.: "ASCO Educational Book S", 2000, pages: 300 - 302 |
| LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LYONS ET AL.: "Curr Protoc Cytom.", 2013 |
| MARKEL ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 59, no. 2, February 2010 (2010-02-01), pages 215 - 30 |
| MARKEL ET AL., IMMUNOLOGY, vol. 126, no. 2, February 2009 (2009-02-01), pages 186 - 200 |
| MARKEL ET AL., J IMMUNOL., vol. 168, no. 6, 15 March 2002 (2002-03-15), pages 2803 - 10 |
| MARKEL ET AL., J IMMUNOL., vol. 177, no. 9, 1 November 2006 (2006-11-01), pages 6062 - 71 |
| MELERO, I. ET AL., NATURE MEDICINE, vol. 3, 1997, pages 682 - 685 |
| MOKYR, M. ET AL., CANCER RESEARCH, vol. 58, 1998, pages 5301 - 5304 |
| MORRISON, S. L., SCIENCE, vol. 229, 1985, pages 1202 - 1207 |
| MORRISON, S.L ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1994, pages 6851 - 6855 |
| MOTZER, R.J. ET AL., LANCET, vol. 372, 2008, pages 449 - 456 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NESTLE, F. ET AL., NATURE MEDICINE, vol. 4, 1998, pages 328 - 332 |
| NISHIMURA ET AL., CANC. RES., vol. 47, 1987, pages 999 - 1005 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| OKAZAKI ET AL., CURR OPIN IMMUNOL, vol. 14, 2002, pages 391779 - 82 |
| ORTENBERG ET AL., MOL CANCER THER., vol. 11, no. 6, June 2012 (2012-06-01), pages 1300 - 10 |
| PAL. S.K ET AL., CLIN. ADVANCES IN HEMATOLOGY & ONCOLOGY, vol. 12, no. 2, 2014, pages 90 - 99 |
| PENG ET AL., NATURE BIOTECHNOLOGY, vol. 29, 2011, pages 886 - 891 |
| POLJAK, STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| POPKOV, JOURNAL OF IMMUNOLOGICAL METHODS, vol. 288, 2004, pages 149 - 164 |
| PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599 |
| REITER, Y., CLIN CANCER RES, vol. 2, 1996, pages 245 - 52 |
| RESTIFO, N; SZNOL, M.: "Cancer Vaccines", pages: 3023 - 3043 |
| RIDGE, J. ET AL., NATURE, vol. 393, 1998, pages 474 - 478 |
| RIKOVA ET AL., CELL, vol. 131, no. 6, 2007, pages 1190 - 203 |
| RINI, B.I. ET AL., J. CLIN. ONCOL., vol. 28, no. 13, 2010, pages 2137 - 2143 |
| ROSENBERG, S.: "ASCO Educational Book Spring", article "Development of Cancer Vaccines", pages: 60 - 62 |
| SAKAGAMI ET AL.: "ASP8273, a novel mutant-selective irreversible EGFR inhibitor, inhibits growth of non-small cell lung cancer (NSCLC) cells with EGFR activating and T790M resistance mutations", AACR; CANCER RES, vol. 74, 2014, pages 1728 |
| SALEH ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 32, 1990, pages 180 - 190 |
| SASAKI ET AL., EUR J CANCER., vol. 46, no. 10, 2010, pages 1773 - 1780 |
| SEAN ET AL., SCIENCE, vol. 332, no. 6030, 2011, pages 687 - 696 |
| SEQUIST ET AL.: "Rociletinib in EGFR-Mutated Non-Small-Cell Lung Cancer", J MED, vol. 372, 2015, pages 1700 - 9 |
| SHARPE, A. H. ET AL., NATURE REV. IMMUNOL., vol. 2, 2002, pages 116 - 126 |
| SHAW ET AL., J CLIN ONCOL., vol. 27, no. 26, 2009, pages 4247 - 4253 |
| SHAW ET AL., J. NATL CANCER INST., vol. 80, 1988, pages 1553 - 1559 |
| SHAW ET AL., N ENGL J MED., vol. 368, no. 25, 2013, pages 2385 - 2394 |
| SHINOHARA T ET AL., GENOMICS, vol. 23, no. 3, 1994, pages 704 - 6 |
| SOCINSKI ET AL., J CLIN ONCOL., vol. 30, no. 17, 2012, pages 2055 - 2062 |
| SODA ET AL., NATURE, vol. 448, no. 7153, 2007, pages 561 - 6 |
| STERN ET AL., J IMMUNOL., vol. 174, no. 11, 1 June 2005 (2005-06-01), pages 6692 - 701 |
| SUN ET AL., PNAS, vol. 84, 1987, pages 214 - 218 |
| SUOT, R; SRIVASTAVA, P, SCIENCE, vol. 269, 1995, pages 1585 - 1588 |
| TAKEUCHI ET AL., CLIN CANCER RES., vol. 14, no. 20, 2008, pages 6618 - 24 |
| TAKEUCHI ET AL., CLIN CANCER RES., vol. 15, no. 9, 2009, pages 3143 - 9 |
| TAMURA, Y. ET AL., SCIENCE, vol. 278, 1997, pages 117 - 120 |
| THERASSE ET AL.: "New Guidelines to Evaluate the Response to Treatment in Solid Tumors", JOURNAL OF NATIONAL CANCER INSTITUTE, vol. 92, 2000, pages 205 - 16 |
| THOMPSON J. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 158, no. 3, 1989, pages 996 - 1004 |
| TRIEBEL ET AL., J. EXP. MED., vol. 171, 1990, pages 1393 - 1405 |
| TUAILLON ET AL., PNAS, vol. 90, 1993, pages 3720 - 3724 |
| VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VIGLIETTA, V. ET AL., NEUROTHERAPEUTICS, vol. 4, 2007, pages 666 - 675 |
| WANG, C. ET AL., CANCER IMMUNOLOGY RESEARCH, vol. 2, 2014, pages 846 - 856 |
| WANG, L. ET AL., J. EXP. MED., vol. 208, no. 3, 7 March 2011 (2011-03-07), pages 577 - 92 |
| WEINBERG, A. ET AL., IMMUNOL, vol. 164, 2000, pages 2160 - 2169 |
| WINNAKER: "From Genes to Clones", 1987, VERLAGSGESELLSCHAFT |
| WONG ET AL., CANCER, vol. 115, no. 8, 15 April 2009 (2009-04-15), pages 1723 - 33 |
| WOO ET AL., CANCER RES., vol. 72, no. 4, 2012, pages 917 - 27 |
| WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449 |
| YANG ET AL., J THORAC ONCOL., vol. 7, no. 1, 2012, pages 90 - 97 |
| YI, Q, CANCER J., vol. 15, no. 6, 2009, pages 502 - 10 |
| ZHENG ET AL., PLOS ONE, vol. 5, no. 9, 2 September 2010 (2010-09-02), pages E12529 |
| ZIMMERMANN W ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 84, no. 9, 1987, pages 2960 - 2964 |
Cited By (147)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11433065B2 (en) | 2008-01-04 | 2022-09-06 | Intellikine Llc | Certain chemical entities, compositions and methods |
| US11390678B2 (en) | 2008-04-09 | 2022-07-19 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| US20170145093A1 (en) | 2008-04-09 | 2017-05-25 | Genentech, Inc. | Novel compositions and methods for the treatment of immune related diseases |
| US9920123B2 (en) | 2008-12-09 | 2018-03-20 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US10653696B2 (en) | 2010-06-03 | 2020-05-19 | Pharmacyclics Llc | Use of inhibitors of bruton's tyrosine kinase (BTK) |
| US11672803B2 (en) | 2010-06-03 | 2023-06-13 | Pharmacyclics Llc | Use of inhibitors of Brutons tyrosine kinase (Btk) |
| US10004745B2 (en) | 2010-06-03 | 2018-06-26 | Pharmacyclics Llc | Use of inhibitors of Bruton'S tyrosine kinase (Btk) |
| US10751342B2 (en) | 2010-06-03 | 2020-08-25 | Pharmacyclics Llc | Use of inhibitors of Bruton's tyrosine kinase (Btk) |
| US10016435B2 (en) | 2010-06-03 | 2018-07-10 | Pharmacyclics Llc | Use of inhibitors of Bruton's tyrosine kinase (Btk) |
| US10004746B2 (en) | 2010-06-03 | 2018-06-26 | Pharmacyclics Llc | Use of inhibitors of Bruton's tyrosine kinase (Btk) |
| US10478439B2 (en) | 2010-06-03 | 2019-11-19 | Pharmacyclics Llc | Use of inhibitors of bruton's tyrosine kinase (Btk) |
| US11312718B2 (en) | 2011-01-10 | 2022-04-26 | Infinity Pharmaceuticals, Inc. | Formulations of (S)-3-(1-(9H-purin-6-ylamino)ethyl)-8-chloro-2-phenylisoquinolin-1(2H)-one |
| US10954567B2 (en) | 2012-07-24 | 2021-03-23 | Pharmacyclics Llc | Mutations associated with resistance to inhibitors of Bruton's Tyrosine Kinase (BTK) |
| US9815897B2 (en) | 2013-05-02 | 2017-11-14 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (PD-1) |
| US10738117B2 (en) | 2013-05-02 | 2020-08-11 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (PD-1) |
| US10626174B2 (en) | 2013-07-16 | 2020-04-21 | Genentech, Inc. | Methods of treating cancer using PD-1 axis binding antagonists and TIGIT inhibitors |
| US10611836B2 (en) | 2013-07-16 | 2020-04-07 | Genentech, Inc. | Methods of treating cancer using PD-1 axis binding antagonists and tigit inhibitors |
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| US11708412B2 (en) | 2013-09-26 | 2023-07-25 | Novartis Ag | Methods for treating hematologic cancers |
| US11365255B2 (en) | 2013-12-12 | 2022-06-21 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | PD-1 antibody, antigen-binding fragment thereof, and medical application thereof |
| US10344090B2 (en) | 2013-12-12 | 2019-07-09 | Shanghai Hangrui Pharmaceutical Co., Ltd. | PD-1 antibody, antigen-binding fragment thereof, and medical application thereof |
| US11827704B2 (en) | 2014-01-24 | 2023-11-28 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US9683048B2 (en) | 2014-01-24 | 2017-06-20 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US10441654B2 (en) | 2014-01-24 | 2019-10-15 | Children's Hospital Of Eastern Ontario Research Institute Inc. | SMC combination therapy for the treatment of cancer |
| US9815898B2 (en) | 2014-01-24 | 2017-11-14 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US10752687B2 (en) | 2014-01-24 | 2020-08-25 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US9884913B2 (en) | 2014-01-31 | 2018-02-06 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US10472419B2 (en) | 2014-01-31 | 2019-11-12 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US9605070B2 (en) | 2014-01-31 | 2017-03-28 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US10981990B2 (en) | 2014-01-31 | 2021-04-20 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US11155620B2 (en) | 2014-01-31 | 2021-10-26 | Novartis Ag | Method of detecting TIM-3 using antibody molecules to TIM-3 |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US9908936B2 (en) | 2014-03-14 | 2018-03-06 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US10711060B2 (en) | 2014-03-14 | 2020-07-14 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US10730951B2 (en) | 2014-03-31 | 2020-08-04 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| US9975957B2 (en) | 2014-03-31 | 2018-05-22 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| US9988452B2 (en) | 2014-10-14 | 2018-06-05 | Novartis Ag | Antibody molecules to PD-L1 and uses thereof |
| US10851165B2 (en) | 2014-10-14 | 2020-12-01 | Novartis Ag | Antibody molecules to PD-L1 and methods of treating cancer |
| US10478494B2 (en) | 2015-04-03 | 2019-11-19 | Astex Therapeutics Ltd | FGFR/PD-1 combination therapy for the treatment of cancer |
| US10544219B2 (en) | 2015-05-28 | 2020-01-28 | Oncomed Pharmaceuticals, Inc. | TIGIT-binding agents and uses thereof |
| US10112997B2 (en) | 2015-05-28 | 2018-10-30 | Oncomed Pharmaceuticals, Inc. | Tight-binding agents and uses thereof |
| US11466092B2 (en) | 2015-05-29 | 2022-10-11 | Bristol-Myers Squibb Company | Antibodies against OX-40 and uses thereof |
| US9644032B2 (en) | 2015-05-29 | 2017-05-09 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| US10683357B2 (en) | 2015-05-29 | 2020-06-16 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| WO2017007658A1 (en) * | 2015-07-07 | 2017-01-12 | Rigel Pharmaceuticals, Inc. | A combination for immune mediated cancer treatment |
| US10844129B2 (en) | 2015-07-23 | 2020-11-24 | Inhibrx, Inc. | Multivalent and multispecific glucocorticoid-induced TNFR-related protein (GITR)-binding single-domain antibody fusion proteins and encoding nucleic acids |
| US10093742B2 (en) | 2015-07-23 | 2018-10-09 | Inhibrx, Inc. | Multispecific GITR-binding fusion proteins and methods of use thereof |
| US12240911B2 (en) | 2015-10-02 | 2025-03-04 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| US11840571B2 (en) | 2015-12-14 | 2023-12-12 | Macrogenics, Inc. | Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4 |
| US10954301B2 (en) | 2015-12-14 | 2021-03-23 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof |
| US20200261573A1 (en) * | 2015-12-17 | 2020-08-20 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| US20210121563A1 (en) * | 2015-12-17 | 2021-04-29 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
| EP3397262A4 (en) * | 2015-12-28 | 2019-06-19 | Syndax Pharmaceuticals Inc. | COMBINATION OF AN HDAC INHIBITOR AND ANTI-PD-L1 ANTIBODY FOR THE TREATMENT OF EGG CANCER |
| WO2017175200A1 (en) * | 2016-04-08 | 2017-10-12 | The Regents Of The University Of California | Modified hyaluronic acid hydrogels and proteins for the time-controlled release of biologic agents |
| US10842743B2 (en) | 2016-04-08 | 2020-11-24 | The Regents Of The University Of California | Modified hyaluronic acid hydrogels and proteins for the time-controlled release of biologic agents |
| JP7033549B2 (ja) | 2016-05-04 | 2022-03-10 | フレッド ハッチンソン キャンサー リサーチ センター | 細胞に基づくネオ抗原ワクチンおよびその使用 |
| US11723962B2 (en) | 2016-05-04 | 2023-08-15 | Fred Hutchinson Cancer Center | Cell-based neoantigen vaccines and uses thereof |
| JP2019514393A (ja) * | 2016-05-04 | 2019-06-06 | フレッド ハッチンソン キャンサー リサーチ センター | 細胞に基づくネオ抗原ワクチンおよびその使用 |
| JP7280821B2 (ja) | 2016-05-05 | 2023-05-24 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | チェックポイント分子を標的とするdnaモノクロナール抗体 |
| JP2019515044A (ja) * | 2016-05-05 | 2019-06-06 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | チェックポイント分子を標的とするdnaモノクロナール抗体 |
| JP2023033329A (ja) * | 2016-05-05 | 2023-03-10 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | チェックポイント分子を標的とするdnaモノクロナール抗体 |
| US12122833B2 (en) | 2016-05-11 | 2024-10-22 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US11535670B2 (en) | 2016-05-11 | 2022-12-27 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US10639368B2 (en) | 2016-05-27 | 2020-05-05 | Agenus Inc. | Anti-TIM-3 antibodies and methods of use thereof |
| US10912828B2 (en) | 2016-05-27 | 2021-02-09 | Agenus Inc. | Anti-TIM-3 antibodies and methods of use thereof |
| US12011481B2 (en) | 2016-05-27 | 2024-06-18 | Agenus Inc. | Anti-TIM-3 antibodies and methods of use thereof |
| US11839653B2 (en) | 2016-05-27 | 2023-12-12 | Agenus Inc. | Anti-TIM-3 antibodies and methods of use thereof |
| US11147818B2 (en) * | 2016-06-24 | 2021-10-19 | Infinity Pharmaceuticals, Inc. | Combination therapies |
| EP3490548A4 (en) * | 2016-08-01 | 2020-04-15 | Molecular Templates, Inc. | ADMINISTRATION OF HYPOXIA-ACTIVATED DRUGS IN COMBINATION WITH IMMUNOMODULATORS FOR THE TREATMENT OF CANCER |
| EP4549467A3 (en) * | 2016-08-01 | 2025-07-23 | ImmunoGenesis, Inc. | Administration of hypoxia activated prodrugs in combination with immune modulatory agents for treating cancer |
| JP2019527236A (ja) * | 2016-08-01 | 2019-09-26 | モレキュラー テンプレーツ,インコーポレイティド | 癌を治療するための免疫調節剤と組み合わせた低酸素活性化型プロドラッグの投与 |
| US11046776B2 (en) | 2016-08-05 | 2021-06-29 | Genentech, Inc. | Multivalent and multiepitopic antibodies having agonistic activity and methods of use |
| WO2018035395A1 (en) * | 2016-08-19 | 2018-02-22 | Irx Therapeutics, Inc. | Uses of pd-1/pd-l1 inhibitors and/or ctla-4 inhibitors with a biologic containing multiple cytokine components to treat cancer |
| EP3500290A4 (en) * | 2016-08-19 | 2020-04-29 | Brooklyn Immunotherapeutics LLC | USE OF PD-1 / PD-L1 INHIBITORS AND / OR CTLA-4 INHIBITORS WITH A BIOLOGICAL WITH SEVERAL CYTOKINE COMPONENTS FOR TREATING CANCER |
| CN109890405A (zh) * | 2016-08-19 | 2019-06-14 | 布鲁克林免疫治疗有限公司 | Pd-1/pd-l1抑制剂和/或ctla-4抑制剂与含有多种细胞因子组分的生物制剂用于治疗癌症的用途 |
| JP2019524851A (ja) * | 2016-08-24 | 2019-09-05 | イグナイタ インコーポレイテッド | がんを治療するための組み合わせ |
| WO2018039275A1 (en) | 2016-08-24 | 2018-03-01 | Ignyta, Inc. | Combinations for the treatment of cancer |
| CN109715157A (zh) * | 2016-08-24 | 2019-05-03 | 亚尼塔公司 | 用于治疗癌症的组合 |
| WO2018049027A1 (en) | 2016-09-07 | 2018-03-15 | Trustees Of Tufts College | Combination therapies using immuno-dash inhibitors and pge2 antagonists |
| US11866500B2 (en) | 2016-10-10 | 2024-01-09 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | Use of combination of anti-PD-1 antibody and VEGFR inhibitor in preparation of drug for treating cancers |
| US20220119528A1 (en) * | 2016-10-10 | 2022-04-21 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | Use of Combination of Anti-PD-1 Antibody and VEGFR Inhibitor in Preparation of Drug for Treating Cancers |
| US11208484B2 (en) * | 2016-10-10 | 2021-12-28 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | Use of combination of anti-PD-1 antibody and VEGFR inhibitor in preparation of drug for treating cancers |
| US12435144B2 (en) | 2016-10-10 | 2025-10-07 | Suzhou Suncadia Biopharmaceuticals Co., Ltd. | Use of combination of anti-PD-1 antibody and VEGFR inhibitor in preparation of drug for treating cancers |
| US11155624B2 (en) | 2016-11-01 | 2021-10-26 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (PD-1) |
| WO2018081897A1 (en) * | 2016-11-03 | 2018-05-11 | Trillium Therapeutics Inc. | Enhancement of cd47 blockade therapy by proteasome inhibitors |
| US11446315B2 (en) | 2016-11-03 | 2022-09-20 | Pf Argentum Ip Holdings Llc | Enhancement of CD47 blockade therapy by proteasome inhibitors |
| WO2018081898A1 (en) * | 2016-11-03 | 2018-05-11 | Trillium Therapeutics Inc. | Improvements in cd47 blockade therapy by hdac inhibitors |
| US11779631B2 (en) | 2016-11-03 | 2023-10-10 | Pfizer Inc. | CD47 blockade therapy by HDAC inhibitors |
| US11136384B2 (en) | 2016-11-30 | 2021-10-05 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| US11230596B2 (en) | 2016-11-30 | 2022-01-25 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| US11407830B2 (en) | 2017-01-09 | 2022-08-09 | Tesaro, Inc. | Methods of treating cancer with anti-PD-1 antibodies |
| US12415855B2 (en) | 2017-01-09 | 2025-09-16 | Tesaro, Inc. | Methods of treating cancer with anti-PD-1 antibodies |
| US12298311B2 (en) | 2017-02-07 | 2025-05-13 | Saitama Medical University | Immunological biomarker for predicting clinical effect of cancer |
| WO2018175179A1 (en) * | 2017-03-20 | 2018-09-27 | Vaccinex, Inc. | Treatment of cancer with a semaphorin-4d antibody in combination with an epigenetic modulating agent |
| US11572408B2 (en) | 2017-03-20 | 2023-02-07 | Vaccinex, Inc. | Treatment of cancer with a semaphorin-4D antibody in combination with an epigenetic modulating agent |
| CN111148518A (zh) * | 2017-03-30 | 2020-05-12 | 丹娜法伯癌症研究院 | 使用cdk4/6抑制剂调控调节性t细胞和免疫应答的方法 |
| WO2018178250A1 (en) | 2017-03-31 | 2018-10-04 | Boehringer Ingelheim International Gmbh | Anticancer combination therapy |
| JP2020515600A (ja) * | 2017-03-31 | 2020-05-28 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | 抗がん併用療法 |
| CN110475567A (zh) * | 2017-03-31 | 2019-11-19 | 勃林格殷格翰国际有限公司 | 抗癌组合疗法 |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| JP2024041874A (ja) * | 2017-04-20 | 2024-03-27 | ザ・ユニバーシティ・オブ・シカゴ | 免疫療法用抗体と連結させたecm親和性ペプチドを用いてがんを処置するための方法および組成物 |
| JP7419070B2 (ja) | 2017-04-20 | 2024-01-22 | ザ・ユニバーシティ・オブ・シカゴ | 免疫療法用抗体と連結させたecm親和性ペプチドを用いてがんを処置するための方法および組成物 |
| JP2020517658A (ja) * | 2017-04-20 | 2020-06-18 | ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago | 免疫療法用抗体と連結させたecm親和性ペプチドを用いてがんを処置するための方法および組成物 |
| US11574747B2 (en) | 2017-04-20 | 2023-02-07 | The University Of Chicago | Methods of treating cancer with placenta growth factor peptide linked to immunotherapeutic antibodies |
| US11517622B2 (en) * | 2017-06-02 | 2022-12-06 | Bayer Healthcare Llc | Combination of regorafenib and PD-1/PD-L1(2) inhibitors for treating cancer |
| RU2774838C2 (ru) * | 2017-06-02 | 2022-06-23 | Байер Хелскеа Ллк | Комбинация регорафениба и ингибиторов pd-1/pd-l1(2) для лечения рака |
| CN110662540A (zh) * | 2017-06-02 | 2020-01-07 | 拜耳股份公司 | 用于治疗癌症的瑞格菲尼和pd-1/pd-l1(2)抑制剂的组合产品 |
| CN110662540B (zh) * | 2017-06-02 | 2024-01-26 | 拜耳医药保健有限责任公司 | 用于治疗癌症的瑞格菲尼和pd-1/pd-l1(2)抑制剂的组合产品 |
| US11951166B2 (en) | 2017-06-02 | 2024-04-09 | Bayer Aktiengesellschaft | Combination of regorafenib and PD-1/PD-L1(2) inhibitors for treating cancer |
| US11407840B2 (en) | 2017-07-27 | 2022-08-09 | Nomocan Pharmaceuticals Llc | Antibodies to M(H)DM2/4 and their use in diagnosing and treating cancer |
| US20230091221A1 (en) * | 2017-09-26 | 2023-03-23 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical composition |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| US12043870B2 (en) | 2017-10-02 | 2024-07-23 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| EP3695408A4 (en) * | 2017-10-02 | 2021-12-15 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| WO2019077132A1 (en) | 2017-10-19 | 2019-04-25 | Debiopharm International S.A. | COMBINATION PRODUCT FOR THE TREATMENT OF CANCER |
| WO2019087087A1 (en) | 2017-11-03 | 2019-05-09 | Aurigene Discovery Technologies Limited | Dual inhibitors of tim-3 and pd-1 pathways |
| WO2019087092A1 (en) | 2017-11-06 | 2019-05-09 | Aurigene Discovery Technologies Limited | Conjoint therapies for immunomodulation |
| EP3728313B1 (en) | 2017-12-21 | 2023-08-02 | Debiopharm International S.A. | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| WO2019122337A1 (en) | 2017-12-21 | 2019-06-27 | Debiopharm International S.A. | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| WO2019122941A1 (en) | 2017-12-21 | 2019-06-27 | Debiopharm International Sa | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| EP4285927A2 (en) | 2017-12-21 | 2023-12-06 | Debiopharm International SA | Combination anti cancer therapy with an iap antagonist and an anti pd-1 molecule |
| EP3768259A2 (en) | 2018-03-14 | 2021-01-27 | Aurigene Discovery Technologies Limited | Method of modulating tigit and pd-1 signalling pathways using 1,2,4-oxadiazole compounds |
| US12103974B2 (en) | 2018-05-23 | 2024-10-01 | Beigene, Ltd. | Anti-OX40 antibodies and methods of use |
| WO2020024932A1 (en) * | 2018-07-31 | 2020-02-06 | Ascentage Pharma (Suzhou) Co., Ltd. | Method for treating cancer by combination of iap inhibitor and modulator of immune checkpoint molecule |
| US12186304B2 (en) | 2018-07-31 | 2025-01-07 | Ascentage Pharma (Suzhou) Co., Ltd. | Method for treating cancer by combination of IAP inhibitor and modulator of immune checkpoint molecule |
| CN112996814A (zh) * | 2018-11-14 | 2021-06-18 | 拜耳公司 | 用于治疗癌症的抗ceacam6和抗pd-1或抗pd-l1抗体的药物组合 |
| WO2020109328A1 (en) | 2018-11-26 | 2020-06-04 | Debiopharm International S.A. | Combination treatment of hiv infections |
| WO2020148447A1 (en) | 2019-01-17 | 2020-07-23 | Debiopharm International S.A. | Combination product for the treatment of cancer |
| CN113573707A (zh) * | 2019-01-17 | 2021-10-29 | 德彪药业国际股份公司 | 用于治疗癌症的组合产品 |
| WO2020159504A1 (en) * | 2019-01-30 | 2020-08-06 | Nomocan Pharmaceuticals Llc | Antibodies to m(h)dm2/4 and their use in diagnosing and treating cancer |
| WO2020165350A1 (en) | 2019-02-14 | 2020-08-20 | Fundación Instituo De Investigación Contra La Leucemia Josep Carreras (Ijc) | Car t-cells for the treatment of cd1a-positive cancer |
| EP3696191A1 (en) | 2019-02-14 | 2020-08-19 | Fundación Instituto de Investigación contra la Leucemia Josep Carreras (IJC) | Car t-cells for the treatment of cd1a-positive cancer |
| US12215158B2 (en) | 2019-02-14 | 2025-02-04 | Fundacíon Instituto De Investigacíon Contra La Leucemia Josep Carreras (Ijc) | CD1a antibody-expressing CAR T-cells for the treatment of CD1a-positive cancer |
| US12442820B2 (en) | 2019-02-20 | 2025-10-14 | Saitama Medical University | Peripheral blood biomarker for evaluating anti-tumor immune effect of radiation therapy |
| US20200319163A1 (en) * | 2019-03-29 | 2020-10-08 | Georgetown University | Methods and compositions overcoming cancer cell immune resistance |
| WO2021023721A1 (en) | 2019-08-02 | 2021-02-11 | Fundacio Clinic Per A La Recerca Biomedica | Car t-cells against bcma for the treatment of multiple myeloma |
| EP4272837A2 (en) | 2019-08-02 | 2023-11-08 | Fundacio de Recerca Clinic Barcelona-Institut d'Investigacions Biomèdiques August Pi I Sunyer | Car t-cells against bcma for the treatment of multiple myeloma |
| WO2021030251A1 (en) | 2019-08-12 | 2021-02-18 | Purinomia Biotech, Inc. | Methods and compositions for promoting and potentiating t-cell mediated immune responses through adcc targeting of cd39 expressing cells |
| WO2021058794A1 (en) | 2019-09-25 | 2021-04-01 | Debiopharm International S.A. | Dosing regimens for treatment of patients with locally advanced squamous cell carcinoma |
| WO2021098757A1 (en) * | 2019-11-21 | 2021-05-27 | Beigene, Ltd. | Methods of cancer treatment using anti-ox40 antibodies in combination with anti-tigit antibodies |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| EP4234582A1 (en) | 2022-02-28 | 2023-08-30 | Onechain Immunotherapeutics SL | Humanized cd1a targeting moiety for the treatment of cd1a-positive cancer |
| WO2023161530A1 (en) | 2022-02-28 | 2023-08-31 | Onechain Immunotherapeutics S.L | HUMANIZED CD1a TARGETING MOIETY FOR THE TREATMENT OF CD1A-POSITIVE CANCER |
| WO2024170627A1 (en) | 2023-02-15 | 2024-08-22 | Fundació Institut De Recerca Contra La Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
| EP4417623A1 (en) | 2023-02-15 | 2024-08-21 | Fundació Institut de Recerca Contra la Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2963281A1 (en) | 2016-04-07 |
| MX2017004360A (es) | 2017-06-26 |
| US20210000951A1 (en) | 2021-01-07 |
| JP2022043060A (ja) | 2022-03-15 |
| US20170209574A1 (en) | 2017-07-27 |
| EP3662903A2 (en) | 2020-06-10 |
| ES2774448T3 (es) | 2020-07-21 |
| EP3200775A2 (en) | 2017-08-09 |
| CN107106687A (zh) | 2017-08-29 |
| JP2017535528A (ja) | 2017-11-30 |
| AU2015327868A1 (en) | 2017-04-20 |
| EP3662903A3 (en) | 2020-10-14 |
| MX378690B (es) | 2025-03-11 |
| KR20170066546A (ko) | 2017-06-14 |
| MX2020005894A (es) | 2020-08-13 |
| EA201790737A1 (ru) | 2017-08-31 |
| BR112017006664A2 (pt) | 2017-12-26 |
| WO2016054555A3 (en) | 2016-06-30 |
| EP3200775B1 (en) | 2019-11-20 |
| AU2021204687A1 (en) | 2021-08-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240075136A1 (en) | Combination therapies | |
| US20210000951A1 (en) | Combination therapies | |
| US20200030442A1 (en) | Combination therapies | |
| WO2017019894A1 (en) | Combination therapies comprising antibody molecules to lag-3 | |
| CN106103485A (zh) | Pd‑1的抗体分子及其用途 | |
| HK40019395A (en) | Combination therapies | |
| HK1242582B (en) | Combination therapies | |
| HK1242582A1 (en) | Combination therapies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15782164 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15515469 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2963281 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017517730 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/004360 Country of ref document: MX |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015782164 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017006664 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015782164 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2015327868 Country of ref document: AU Date of ref document: 20151002 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201790737 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20177012013 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017006664 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170331 |