WO2015031815A2 - Antibodies and assays for detection of folate receptor 1 - Google Patents
Antibodies and assays for detection of folate receptor 1 Download PDFInfo
- Publication number
- WO2015031815A2 WO2015031815A2 PCT/US2014/053512 US2014053512W WO2015031815A2 WO 2015031815 A2 WO2015031815 A2 WO 2015031815A2 US 2014053512 W US2014053512 W US 2014053512W WO 2015031815 A2 WO2015031815 A2 WO 2015031815A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- folrl
- seq
- antigen
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57515—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the breast
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57545—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the ovaries
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5755—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the uterine cervix, uterine corpus or endometrium
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- the field of this invention generally relates to diagnostic assays and kits for folate receptor 1 -based therapies and antibodies that bind to human folate receptor 1.
- Cancer is one of the leading causes of death in the developed world, with over one million people diagnosed with cancer and 500,000 deaths per year in the United States alone. Overall it is estimated that more than 1 in 3 people will develop some form of cancer during their lifetime. There are more than 200 different types of cancer, four of which— breast, lung, colorectal, and prostate— account for over half of all new cases (Jemal et al., 2003, Cancer J. Clin. 53:5-26).
- FLR1 Folate Receptor 1
- Folate Receptor-alpha also known as Folate Receptor-alpha or Folate
- Binding Protein is an N-glycosylated protein expressed on plasma membrane of cells.
- FOLR1 has a high affinity for folic acid and for several reduced folic acid derivatives.
- FOLR1 mediates delivery of the physiological folate, 5-methyltetrahydrofolate, to the interior of cells.
- FOLR1 is overexpressed in the vast majority of ovarian cancers, as well as in many uterine, endometrial, pancreatic, renal, lung, and breast cancers, while the expression of FOLR1 on normal tissues is restricted to the apical membrane of epithelial cells in the kidney proximal tubules, alveolar pneumocytes of the lung, bladder, testes, choroid plexus, and thyroid (Weitman SD, et al, Cancer Res 52: 3396-3401 (1992); Antony AC, Annu Rev Nutr 16: 501-521 (1996); Kalli KR, et al. Gynecol Oncol 108: 619-626 (2008)). This expression pattern of FOLR1 makes it a desirable target for FOLR1 -directed cancer therapy.
- ovarian cancer is typically asymptomatic until advanced stage, it is often diagnosed at a late stage and has poor prognosis when treated with currently available procedures, typically chemotherapeutic drugs after surgical de-bulking (von Gruenigen V et al, Cancer 112: 2221-2227 (2008); Ayhan A et al, Am J Obstet Gynecol 196: 81 e81-86 (2007); Harry VN et al, Obstet Gynecol Surv 64: 548-560 (2009)).
- Some previous assays used to detect shed FOLR1 are not sufficiently specific to FOLR1.
- FOLR1 and other folate receptor family members FOLR2, 3, & 4
- FBP Frelate Binding Protein
- some assays require that human samples (e.g., plasma) be pre-treated with a light acid wash step to dissociate folic acid from the receptor.
- Some assay results may also have inaccuracies due to competitive effects between the antibody therapy and diagnostic antibody.
- many commercially available kits are traditionally unreliable both in their reagents, and in their lot-to-lot stability. Evaluations of these kits have given very mixed results, and are intended for research use only.
- Anti-FOLRl antibodies and antigen-binding fragments thereof as well as methods for detecting FOLR1, diagnosing FOLR1 -mediated diseases and disorders (such as cancer), monitoring the efficacy of anti-FOLRl therapies, optimizing anti-FOLRl therapies, and stratifying patients are all provided herein.
- the anti-FOLRl antibodies provided herein can have a diagnostic role.
- the anti-FOLRl antibodies provided herein to distinguish between tumor and non- tumor cells or tissues or to identify tumor types, subtypes, or grades.
- an anti-FOLRl antibody provided herein and/or a FOLR1 -detection assay provided herein can be used to distinguish between subtypes of non-small cell lung cancer (NSCLC) including adenocarcinoma and squamous cell carcinoma as described herein.
- NSCLC non-small cell lung cancer
- an anti-FOLRl antibody provided herein and/or a FOLR1 -detection assay provided herein can be used to rule out a type of cancer (e.g., to determine that a cell or tissue is not a type of cancer), for example, sarcoma.
- an antibody or antigen-binding fragment thereof provided herein can specifically bind to an epitope of FOLR1, wherein the epitope comprises at least one, at least two, or three N-glycoslated amino acids. Glycosylation can be critical for membrane localization. See e.g., Yan et al., J. Am. Soc. Nephol. 13: 1385-1389 (2002).
- the antibodies and antigen-binding fragments herein can detect FOLR1 expression on cell membranes and detect a clinically relevant dynamic range of FOLRl .
- the more discreet staining obtained with the antibodies and antigen-binding fragments provided herein allows for discrimination among samples all grouped together as high expression levels (with a score of 3) using antibodies that bind to different FOLRl epitopes, lack sufficient specificity, and/or lack sufficient sensitivity.
- an antibody or antigen-binding fragment thereof provided herein can specifically bind to the same FOLRl epitope as an antibody selected from the group consisting of: (a) an antibody comprising the polypeptide of SEQ ID NO:27 and the polypeptide of SEQ ID NO:28; (b) an antibody comprising the polypeptide of SEQ ID NO:29 and the polypeptide of SEQ ID NO:30; (c) an antibody comprising the polypeptide of SEQ ID NO:31 and the polypeptide of SEQ ID NO:32; (d) an antibody comprising the polypeptide of SEQ ID NO:62 and the polypeptide of SEQ ID NO:63 or SEQ ID NO:64; and (e) an antibody comprising the polypeptide of SEQ ID NO:65 and the polypeptide of SEQ ID NO: 66 or SEQ ID NO: 67.
- the epitope comprises an N-glycosylated amino acid.
- an antibody or antigen-binding fragment thereof provided herein can specifically bind to FOLRl, wherein said antibody or fragment thereof competitively inhibits binding to FOLRl of an antibody selected from the group consisting of: (a) an antibody comprising the polypeptide of SEQ ID NO:27 and the polypeptide of SEQ ID NO:28; (b) an antibody comprising the polypeptide of SEQ ID NO:29 and the polypeptide of SEQ ID NO:30; (c) an antibody comprising the polypeptide of SEQ ID NO:31 and the polypeptide of SEQ ID NO:32; (d) an antibody comprising the polypeptide of SEQ ID NO:62 and the polypeptide of SEQ ID NO:63 or SEQ ID NO:64; and (e) an antibody comprising the polypeptide of SEQ ID NO:65 and the polypeptide of SEQ ID NO:66 or SEQ ID NO:67.
- the antibody or antigen-binding fragment thereof comprises the VH CDRl-3 and VL CDRl-3 polypeptide sequences selected from the group consisting of: (a) SEQ ID NOs:3-8, respectively; (b) SEQ ID NOs:9-14, respectively; (c) SEQ ID NOs: 15-20, respectively; (d) SEQ ID NOs:21-26, respectively; (e) SEQ ID NOs: 3-5 and SEQ ID NOs: 59, 7, and 8, respectively; (f) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 6-8, respectively; (g) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs: 6-8, respectively; (h) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 59, 7, and 8, respectively; and (i) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs: 59, 7, and 8, respectively.
- an antibody or antigen-binding fragment thereof provided herein can specifically bind to FOLRl, wherein the antibody or fragment thereof comprises the VH CDRl -3 and VL CDRl -3 polypeptide sequences selected from the group consisting of: (a) SEQ ID NOs:3-8, respectively; (b) SEQ ID NOs:9-14, respectively; (c) SEQ ID NOs: 15-20, respectively; (d) SEQ ID NOs:21-26, respectively; (e) SEQ ID NOs: 3-5 and SEQ ID NOs: 59, 7, and 8, respectively; (f) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 6-8, respectively; (g) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs: 6-8, respectively; (h) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 59, 7, and 8, respectively; (i) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs::
- the antibody or antigen-binding fragment thereof comprises polypeptide sequences that are at least 90%, at least 95%, or at lesast 99%> identical to polypeptide sequences selected from the group consisting of: (a) SEQ ID NO:27 and SEQ ID NO:28; (b) SEQ ID NO:29 and SEQ ID NO:30; (c) SEQ ID NO:31 and SEQ ID NO:32; (d) SEQ ID NO:62 and SEQ ID NO:63 or SEQ ID NO:64; (e) SEQ ID NO:65 and SEQ ID NO:66 or SEQ ID NO:67; (f) SEQ ID NO:68 and SEQ ID NO:69.
- the polypeptide sequences comprise, consist essentially of, or consist of the amino acids of sequences selected from the group consisting of: (a) SEQ ID NO:27 and SEQ ID NO:28; (b) SEQ ID NO:29 and SEQ ID NO:30; (c) SEQ ID NO:31 and SEQ ID NO:32; (d) SEQ ID NO:62 and SEQ ID NO:63 or SEQ ID NO:64; (e) SEQ ID NO:65 and SEQ ID NO:66 or SEQ ID NO:67; (f) SEQ ID NO:68 and SEQ ID NO:69.
- an antibody or antigen-binding fragment thereof provided herein can specifically bind to FOLRl, wherein the antibody or fragment thereof comprises a humanized heavy chain variable region comprising CDRl, CDR2, and CDR3 regions comprising the amino acids of SEQ ID NO:51, SEQ ID NO:52 or 53, and SEQ ID NO:54, respectively, a humanized light chain variable region comprising CDRl, CDR2, and CDR3 regions comprising the amino acids of SEQ ID NO:48, SEQ ID NO:49, and SEQ ID NO:50, respectively, and a murine constant region.
- the humanized heavy chain variable region comprises the amino acids of SEQ ID NO:45 and the humanized light chain variable region comprises the amino acids of SEQ ID NO:47.
- the antibody or antigen-binding fragment thereof is recombinantly produced.
- the antibody or antigen-binding fragment thereof is murine, non-human, humanized, chimeric, resurfaced, or human.
- the antibody or antigen-binding fragment thereof binds to human FOLRl but not FOLR2 or FOLR3.
- the antibody or antigen-binding fragment thereof is a full length antibody.
- the antibody or antigen-binding fragment thereof is an antigen-binding fragment.
- the antibody or antigen-binding fragment thereof comprises, consists essentiall of, or consist of a Fab, Fab', F(ab')2, Fd, single chain Fv or scFv, disulfide linked Fv, V-NAR domain, IgNar, intrabody, IgGACH2, minibody, F(ab')3, tetrabody, triabody, diabody, single-domain antibody, DVD- Ig, Fcab, mAb2, (scFv)2, or scFv-Fc.
- a polypeptide provided herein can specifically bind
- polypeptide comprises sequences selected from the group consisting of: (a) SEQ ID NOs:3-8, respectively; (b) SEQ ID NOs:9-14, respectively; (c) SEQ ID NOs: 15- 20, respectively; (d) SEQ ID NOs:21-26, respectively; (e) SEQ ID NOs: 3-5 and SEQ ID NOs: 59, 7, and 8, respectively; (f) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 6-8, respectively; (g) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs: 6-8, respectively (h) SEQ ID NOs: 3, 60, and 5 and SEQ ID NOs: 59, 7, and 8, respectively; (i) SEQ ID NOs: 3, 61, and 5 and SEQ ID NOs: 59, 7, and 8, respectively; and j) variants of (a) to (i) comprising 1, 2, 3, or 4 conservative amino acid substitutions.
- the polypeptide comprises sequences that are at least 90%, at least 95%, or at least 99% identical to sequences selected from the group consisting of: (a) SEQ ID NO:27 and SEQ ID NO:28; (b) SEQ ID NO:29 and SEQ ID NO:30; (c) SEQ ID NO:31 and SEQ ID NO:32; (d) SEQ ID NO:62 and SEQ ID NO:63 or SEQ ID NO:64; (e) SEQ ID NO:65 and SEQ ID NO:66 or SEQ ID NO:67; and (f) SEQ ID NO:68 and SEQ ID NO:69.
- the polypeptide comprises the amino acids of (a) SEQ ID NO:27 and SEQ ID NO:28; (b) SEQ ID NO:29 and SEQ ID NO:30; (c) SEQ ID NO:31 and SEQ ID NO:32; (d) SEQ ID NO:62 and SEQ ID NO:63 or SEQ ID NO:64; (e) SEQ ID NO:65 and SEQ ID NO:66 or SEQ ID NO:67; or (f) SEQ ID NO:68 and SEQ ID NO:69.
- the antibody, antigen-binding fragment thereof, or polypeptide binds to FOLRl with a Kd of about 0.5 to about 10 nM. In some embodiments, the antibody, antigen-binding fragment thereof, or polypeptide binds to a human FOLRl with a Kd of about 1.0 iiM or better. In some embodiments, the binding affinity is measured by flow cytometry, Biacore, ELISA, or radioimmunoassay.
- the antibody, antigen-binding fragment thereof, or polypeptide binds to an epitope of FOLRl comprising an amino acid that is N-glycosylated.
- the antibody, antigen-binding fragment thereof, or polypeptide is detectably labeled.
- a cell provided herein produces the antibody, antigen- binding fragment thereof, or polypeptide.
- the cell is isolated.
- Methods of making the antibody, antigen-binding fragment thereof, or polypeptide are also provided. The methods can comprise (a) culturing a cell provided herein; and (b) isolating the antibody, antigen-binding fragment thereof, or polypeptide from the cultured cell.
- compositions comprising the antibody, antigen-binding fragment thereof, or polypeptide are also provided.
- the composition comprises the the antibody, antigen-binding fragment thereof, or polypeptide and buffer selected from the group consisting of: a FACS buffer, an IHC buffer, and an ELISA buffer.
- a method of detecting FOLR1 expression in a sample comprises contacting the sample with an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein.
- the antibody or antigen- binding fragment thereof is detectably labeled.
- the label is selected from the group consisting of immunofluorescent label, chemiluminescent label, phosphorescent label, enzyme label, radiolabel, avidin/biotin, colloidal gold particles, colored particles and magnetic particles.
- the FOLR1 expression is determined by radioimmunoassay, Western blot assay, cytometry, immunofluorescent assay, enzyme immunoassay, immunoprecipitation assay, chemiluminescent assay, or immunohistochemical assay.
- the cytometry is flow cytometry.
- the FOLR1 expression is determined by IHC.
- a method for increasing the efficacy of cancer therapy with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof comprises administering the active agent to a subject having cancer, wherein increased expression of FOLR1 has been detected in a cancerous sample from the subject using an antibody, antigen-binding fragment thereof, polypeptide or composition provided herein.
- a method for identifying a cancer likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof comprises: (a) contacting a biological sample comprising cells from the cancer with the antibody, antigen-binding fragment thereof, polypeptide or composition provided herein; (b) detecting binding of the antibody, antibody- fragment, or polypeptide to FOLR1 in the biological sample of (a); (c) assigning a score to the binding of step (b), wherein the score is assigned based on comparison to one or more reference samples; and (d) comparing the score in step (c) to the score of a reference tissue or cell, wherein a score for the cancer FOLR1 level that is greater than the score for a normal or low FOLR1 expressing reference sample or a score for the cancer FOLR1 level that is equal to or greater than the score for a high FOLR1 expressing reference sample identifies the cancer as likely to respond to an anti-FOLRl antibody.
- a method of treating a patient having cancer comprises:(a) determining a FOLR1 expression score from a detection of FOLR1 expression in a cancerous sample obtained from the patient, wherein the detection is performed using an antibody, antigen-binding fragment thereof, polypeptide or composition provided herein; and (b) administering an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the patient if the score indicates the patient will benefit from administration of the active agent.
- a method of treating a patient having cancer comprises
- a method of treating a patient having cancer comprises:
- a method of treating a patient having cancer comprises:
- a method of treating a patient having cancer comprises:
- a method of optimizing a therapeutic regimen with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof for a subject having cancer comprises: (a) administering an increased dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to a subject having cancer wherein an increased expression of FOLRl in the subject has been detected using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; or
- a method of optimizing a therapeutic regimen with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof for a subject having cancer comprises: (a) detecting the level of FOLRl expression in a cancerous sample from the subject using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) determining a FOLRl expression score for the cancerous sample; and (c) administering an increased dose of an active agent comprising an anti- FOLRl antibody or antigen-binding fragment thereof to the subject if the score is low or administering a decreased dose of the active agent to the subject if the score is high.
- a method of decreasing FOLRl -expressing cancer cells in a cancer patient comprises: (a) detecting the FOLRl level in a cancerous sample taken from a patient, compared to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (b) administering to the patient a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof if the patient's FOLRl level is elevated compared to the reference sample; wherein the administration of the active agent decreases the number of FOLRl -expressing cancer cells in the patient.
- a method of treating cancer in a patient comprises: (a) detecting the FOLRl level in a cancerous sample taken from a patient, compared to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (b) administering to the patient a fixed dose of an active agent comprising an anti- FOLRl antibody or antigen-binding fragment thereof if the patient's FOLRl level is elevated compared to the reference sample; wherein the administration of the active agent decreases the size of a FOLRl -expressing tumor or decreases CA125 levels.
- a method of decreasing FOLRl -expressing cancer cells in a cancer patient comprises: (a) administering to a patient having a cancer a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof; (b) detecting the patient's FOLRl level relative to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's FOLRl level is elevated compared to the reference sample; wherein the administration of the active agent decreases the number of FOLRl -expressing cancer cells in the patient.
- a method of treating cancer in a patient comprises: (a) administering to a patient having a cancer a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof; (b) detecting the patient's FOLRl level relative to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's FOLRl level is elevated compared to the reference sample; wherein the administration of the active agent decreases the size of a FOLRl - expressing tumor or decreases CA125 levels.
- a method of monitoring therapeutic efficacy of a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof in a patient comprises: (a) detecting a first FOLRl level in a biological sample from a patient having cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) administering to the patient a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment; (c) detecting a second FOLRl level in a biological sample from the patient following active agent administration, wherein the detecting is performed using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (d) comparing the second FOLRl level to the first FOLRl level; wherein a decrease between the first and second FOLRl level indicates therapeutic efficacy.
- a method of identifying a subject having a cancer as likely to respond to a low dose anti-FOLRl treatment regimen comprises: (a) contacting a biological sample comprising cells from the cancer with an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) detecting binding of the antibody, antigen-binding fragment, or polypeptide to the biological sample of (a); (c) assigning a score to the binding of step (b), wherein the score is assigned based on comparison to one or more reference samples; and (d) comparing the score in step (c) to the score of a reference tissue or cell, wherein a score for the cancer FOLRl level that is greater than the score for a normal or low FOLRl expressing reference sample or a score for the cancer FOLRl level that is equal to or greater than the score for a high FOLRl expressing reference sample identifies the cancer as likely to respond to a low dose anti-FOLRl treatment.
- a method of identifying a cancer as sensitive to treatment with an anti-FOLRl active agent comprises: (a) detecting the level of FOLRl expression in a cancerous sample from the cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein the detecting comprises the use of a method that distinguishes between staining intensity or staining uniformity in a FOLRl expressing cancerous sample as compared to staining intensity or staining uniformity in one or more reference samples; (b) determining a FOLRl staining intensity or staining uniformity score for the cancerous sample; and (c) comparing the FOLRl staining intensity or staining uniformity score determined in step (b) to a relative value determined by measuring FOLRl protein expression in at least one reference sample, wherein the at least one reference sample is a tissue, cell, or cell pellet sample which is not sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof
- a method of identifying a cancer as sensitive to treatment with an anti-FOLRl active agent comprises: (a) detecting the level of FOLRl expression in a cancerous sample from the cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein the detecting comprises the use of a method that specifically stains membrane FOLRl in a FOLRl expressing cancerous sample as compared to membrane FOLRl in one or more reference samples; (b) determining a FOLRl score for the cancerous sample; and (c) comparing the FOLRl score determined in step (b) to a relative value determined by measuring FOLRl in at least one reference sample, wherein the at least one reference sample is a tissue, cell, or cell pellet sample which is not sensitive to treatment with an active agent comprising an anti- FOLRl antibody or antigen-binding fragment thereof and wherein a FOLRl score for the cancerous sample determined in step (b) that is higher than the relative value identifies the cancer as being
- a method of identifying a cancer as sensitive to treatment with an anti-FOLRl active agent comprises: (a) detecting the level of FOLRl expression in a cancerous sample from the cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein the detecting comprises the use of a method that distinguishes between staining intensity or staining uniformity in a FOLRl expressing cancerous sample as compared to staining intensity or staining uniformity in one or more reference samples; (b) determining a FOLRl staining intensity or staining uniformity score for the cancerous sample; and (c) comparing the FOLRl staining intensity or staining uniformity score determined in step (b) to a relative value determined by measuring FOLRl protein expression in at least one reference sample, wherein the at least one reference sample is a tissue, cell, or cell pellet sample which is sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof and
- a method of identifying a cancer as sensitive to treatment with an anti-FOLRl active agent comprises: (a) detecting the level of FOLRl expression in a cancerous sample from the cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein the detecting comprises the use of a method that specifically stains membrane FOLRl in a FOLRl expressing cancerous sample as compared to membrane FOLRl in one or more reference samples; (b) determining a FOLRl score for the cancerous sample; and (c) comparing the FOLRl score determined in step (b) to a relative value determined by measuring FOLRl in at least one reference sample, wherein the at least one reference sample is a tissue, cell, or cell pellet sample which is sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof and wherein a FOLRl score for the cancerous sample determined in step (b) that is greater than or equal to the relative value identifies the cancer
- the method further comprises administering an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the subject from whom the cancerous sample or biological sample was obtained.
- the patient's FOLR1 level is detected in a cancerous sample or biological sample obtained from the patient.
- the cancerous sample or biological sample is a bodily fluid, cell, or tissue sample.
- the cell is a circulating tumor cell.
- the bodily fluid is blood, ascites, urine, plasma, serum, or peripheral blood.
- the FOLR1 is membrane localized FOLR1.
- the FOLR1 is shed FOLR1.
- the detecting is by enzyme linked immunosorbent assay (ELISA).
- ELISA enzyme linked immunosorbent assay
- the detecting is by immunohistochemistry (IHC).
- the IHC is calibrated IHC that can distinguish different levels of FOLR1 expression.
- the IHC produces a range of staining intensity for samples having low cell surface FOLR1 expression, intermediate FOLR1 cell surface expression, or high FOLR1 cell surface expression.
- the IHC distinguishes between staining intensity and staining uniformity in a FOLR1 expressing cancerous sample or biological sample as compared to a reference sample.
- the IHC detects membrane FOLR1.
- the IHC is performed manually. In some embodiments, the IHC is performed using an automated system.
- a FOLR1 score is determined from the IHC.
- a score of at least 1 indicates an increased expression of FOLR1 and identifies the cancer as likely to respond to an active agent comprising an anti- FOLRl antibody or antigen-binding fragment thereof.
- a score of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75% uniformity) identifies the cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity) identifies the cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- an H-score of at least 50 identifies a cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, an H-score of at least 75 identifies an ovarian cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, an H-score of at least 50 identifies an NSCLC as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H-score of at least 50 identifies an endometrial cancer as likely to respond to an active agent comprising na anti-FOLRl antibody or antigen- binding fragment thereof. In one embodiment, an H-score is determined using the FOLR1- 2.1 antibody.
- At least 25% of FOLR1 membrane expression in an ovarian tumor sample with an intensity of at least 3 identifies the ovarian cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an NSCLC sample with an intensity of at least 2 identifies the NSCLC as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an endometrial tumor sample with an intensity of at least 2 identifies the endometrial cancer as likely to respond to an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the expression score is determined using the FOLR1-2.1 antibody.
- a score of at least 1 indicates an increased expression of FOLR1 and that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- a score of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75% uniformity) indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity) indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- an H-score of at least 50 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, an H-score of at least 75 indicates that a patient with ovarian cancer will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, an H-score of at least 50 indicates that a patient with NSCLC will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H-score of at least 50 indicates that a patient with endometrial cancer will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H-score is determined using the FOLR1-2.1 antibody.
- At least 25% of FOLR1 membrane expression in a ovarian tumor sample with an intensity of at least 3 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an NSCLC sample with an intensity of at least 2 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an endometrial tumor sample with an intensity of at least 2 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- the expression score is deteremined using the FOLR 1-2.1 antibody.
- a score of at least 1 indicates an increased expression of FOLR1.
- a score of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75%) uniformity) indicates a decreased dose of the active agent should be administered.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity) indicates a decreased dose of the active agent should be administered.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- a score of at least 1 indicates an increased expression of FOLR1.
- a score of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75% uniformity) identifies the cancer as likely to respond to a low dose anti-FOLRl treatment.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity) identifies the cancer as likely to respond to a low dose anti-FOLRl treatment.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- a score of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75% uniformity) identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity) identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- an H-score of at least 50 identifies a cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- an H-score of at least 75 identifies an ovarian cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H-score of at least 50 identifies an NSCLC as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H- score of at least 50 identifies an endometrial cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- an H-score is determined using the FOLR1-2.1 antibody.
- At least 25% of FOLR1 membrane expression in a ovarian tumor sample with an intensity of at least 3 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an NSCLC sample with an intensity of at least 2 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- at least 25% of FOLR1 membrane expression in an endometrial tumor sample with an intensity of at least 2 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- the expression score is deteremined using the FOLR 1-2.1 antibody.
- the reference sample is a positive reference sample or a negative reference sample.
- the reference sample comprises cells, cell pellets, or tissue.
- the antibody, antigen-binding fragment thereof, or polypeptide of comprises a detection reagent selected from the group consisting of: an enzyme, a fluorophore, a radioactive label, and a luminophore.
- the detection reagent is selected from the group consisting of: biotin, digoxigenin, fluorescein, tritium, and rhodamine.
- the cancer is a FOLR1 positive cancer. In some embodiments, the cancer is selected from the group consisting of ovarian, brain, breast, uterine, endometrial, pancreatic, renal, and lung cancer.
- the lung cancer is non small cell lung cancer or bronchioloalveolar carcinoma.
- the ovarian cancer is epithelial ovarian cancer.
- the ovarian cancer is platinum resistant, relapsed, or refractory.
- FOLR1 expression is detected using at least one additional anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, FOLR1 expression is measured using two anti-FOLRl antibodies or antigen-binding fragments thereof. In some embodiments, at least one antibody or antigen-binding fragment thereof is bound to a solid support. In some embodiments, at least one antibody or antigen- binding fragment thereof is bound to a microtiter plate.
- At least one additional antibody or antigen-binding fragment thereof comprises a detection agent.
- the detection agent is a chromogenic detection agent, a fluorogenic detection agent, an enzymatic detection agent, or an electrochemiluminescent detection agent.
- the detection agent is horseradish peroxidase (HRP).
- the ELISA is a sandwich ELISA.
- the active agent comprises the FOLR1 antibody huMovl9.
- the active agent is an antibody maytansinoid conjugate comprising the FOLR1 antibody huMovl9 (comprising a heavy chain variable region of SEQ ID NO:45 and a light chain variable region of SEQ ID NO:47), the maytansinoid DM4, and the cleavable sulfo-SPDB linker (IMGN853).
- a method for identifying a cancer as likely to respond to treatment with an antibody maytansinoid conjugate comprising the FOLR1 antibody huMovl9, the maytansinoid DM4 and a sulfo-SPDB linker comprises measuring FOLR1 using an antibody comprising a heavy chain comprising the amino acids of SEQ ID NO:27 and a light chain comprising the amino acids of SEQ ID NO:28 in an IHC assay, wherein a score of at least 2 hetero indicates the cancer is likely to responds to the treatment.
- a method for identifying a cancer as likely to respond to treatment with an antibody maytansinoid conjugate comprising the FOLR1 antibody huMovl9, the maytansinoid DM4 and a sulfo-SPDB linker comprises measuring FOLR1 using an antibody comprising a heavy chain comprising the amino acids of SEQ ID NO:27 and a light chain comprising the amino acids of SEQ ID NO:28 in an IHC assay, wherein a score of at least 1 indicates the cancer is likely to responds to the treatment.
- an article of manufacture provided herein comprises a therapeutic active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof described herein, a container, and a package insert or label indicating that the active agent can be used to treat a cancer characterized by the increased expression of FOLRl .
- an article of manufacture provided herein comprises a therapeutic active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof described herein, a container, and a package insert or label indicating that the active agent can be used to treat a cancer characterized by the expression of FOLRl at a level of 2, or 3 measured using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein.
- the anti-FOLRl antibody of the active agent is conjugated to a cytotoxin.
- the package insert or label indicates that the active agent can be used to treat a cancer characterized by the expression of FOLRl at a level of at least 1.
- the package insert or label indicates that the active agent can be used to treat a cancer characterized by the expression of FOLRl at a level of at least 2, at least 2 homo (>75% uniformity), or at least 2 hetero (25-75% uniformity).
- the cancer is lung cancer or endometrial cancer.
- the package insert or label indicates that the active agent can be used to treat a cancer characterized by the expression of FOLRl at a level of at least 3, at least 3 homo (>75% uniformity), or at least 3 hetero (25-75% uniformity).
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- a combination diagnostic and pharmaceutical kit provided herein comprises an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein for use in diagnosis and an active agent comprising an anti- FOLRl antibody or antigen-binding fragment thereof for use in therapy.
- the detection antibody is able to detect FOLRl expression by IHC.
- the detection antibody is able to detect FOLRl expression by ELISA.
- the anti-FOLRl antibody in the active agent is conjugated to a cytotoxin.
- a diagnostic kit provided herein comprises an antibody, antigen-binding fragment thereof or polypeptide provided herein, a reagent for immunohistochemistry (IHC), and one or more standardized reference samples, wherein the standardized reference samples comprise cells, cell pellets, or formalin fixed paraffin embedded tissue samples, and wherein the one or more standardized referenced samples are from non-FOLRl expressing, low-FOLRl expressing, or high FOLR1 expressing cells, cell pellets, or tissues.
- IHC immunohistochemistry
- an immunoassay kit for detecting shed FOLR1 in a sample comprises: (a) an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, and (b) a detection reagent.
- the kit further comprises a solid support for the capture reagent.
- the capture reagent is immobilized on the solid support.
- the capture reagent is coated on a microtiter plate.
- the detection reagent is a second FOLR1 antibody.
- the detection reagent is detected using a species specific antibody.
- the kit further comprises a detection means for the detection reagent.
- the detection means is colorimetric.
- the kit further comprises a FOLR1 polypeptide as an antigen standard.
- the FOLR1 polypeptide is FOLRl-Fc.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, wherein said active agent is administered to a subject having cancer, wherein increased expression of FOLR1 has been detected in a cancerous sample obtained from said subject using an antibody, antigen-binding fragment thereof, polypeptide or composition provided herein.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising: (a) determining a FOLR1 expression score from a detection of FOLR1 expression in a cancerous sample obtained from the patient, wherein the detection is performed using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (b) administering an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the patient if the score indicates the patient will benefit from administration of the active agent.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising: (a) determining a FOLR1 expression score from a detection of FOLR1 expression in a cancerous sample obtained from the patient, wherein the detection is performed using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (b) instructing a healthcare provider to administer an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the patient if the score indicates the patient will benefit from administration of the active agent.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising: (a) submitting a cancerous sample obtained from a patient having cancer for determining a FOLR1 expression score from a detection of FOLR1 expression using the antibody, antigen- binding fragment thereof, polypeptide, or composition provided herein; and (b) administering an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the patient if the score indicates the patient will benefit from administration of the active agent.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising: (a) detecting FOLR1 expression in a cancerous sample obtained from said patient, wherein the detection is performed using the antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) determining a FOLR1 expression score for said cancerous sample; and (c) administering an active agent comprising an anti-FOLRl antibody or antigen- bidning fragment thereof to the patient if the score indicates the patient will benefit from administration of the active agent.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising: (a) administering to a patient a fixed dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof; (b) detecting the FOLR1 expression level in a cancerous sample obtained from the patient relative to the FOLR1 level in a reference sample,wherein the detection is performed using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's FOLR1 level is elevated.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising the step of optimizing the therapeutic regimen of said active agent comprising: (a) administering an increased dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to a subject having cancer wherein an increased expression of FOLR1 in a cancerours sample from said subject has been detected using the antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; or (b) administering a decreased dose of the active agent to a subject having cancer wherein a decreased expression of FOLRl in a cancerous sample from said subject has been detected.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, comprising the step of optimizing the therapeutic regimen of said active agent comprising: (a) detecting the level of FOLRl expression in a cancerous sample from said subject using an antibody, antigen- binding fragment thereof, polypeptide, or composition provided herein; (b) determining a FOLRl expression score for said cancerous sample; and (c) administering an increased dose of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof to the subject if the score is low or administering a decreased dose of the active agent to the subject if the score is high.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, wherein FOLRl - expressing cancer cells in a cancer patient are decreased, wherein: (a) the FOLRl level in a cancerous sample obtained from a patient is detected by comparing it to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (b) a fixed dose of the active agent is administered to the patient if the patient's FOLRl level is elevated; wherein the administration of the active agent decreases the number of FOLRl -expressing cancer cells in the patient.
- an active agent comprises an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for treating cancer, wherein FOLRl - expressing cancer cells in a cancer patient are decreased, wherein: (a) a fixed dose of the active agent is administered to a patient having a cancer; (b) the FOLRl level in a cancerous sample obtained from the patient is detected relative to the FOLRl level in a reference sample using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (c) the amount or frequency of subsequent fixed doses is increased if the patient's FOLRl level is elevated compared to the reference sample; wherein the administration of the active agent decreases the number of FOLRl -expressing cancer cells in the patient.
- an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for monitoring the therapeutic efficacy of a fixed dose of the active agent in a patient comprises: (a) detecting a first FOLRl level in a biological sample from a patient having cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) administering to the patient a fixed dose of the active agent; (c) detecting a second FOLR1 level in a biological sample from the patient following active agent administration, wherein the detecting is performed using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; and (d) comparing the second FOLR1 level to the first FOLR1 level; wherein a decrease between the first and second FOLR1 level indicates therapeutic efficacy.
- an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for diagnosing whether a subject having cancer is likely to respond to a low dose anti-FOLRl treatment regimen comprises: (a) contacting a biological sample comprising cells from said cancer with an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein; (b) detecting binding of said antibody, antigen- binding fragment, or polypeptide to said biological sample of (a); (c) assigning a score to said binding of step (b), wherein said score is assigned based on comparison to one or more reference samples; and (d) comparing said score in step (c) to the score of a reference tissue or cell, wherein a score for said cancer FOLR1 level that is greater than the score for a normal or low FOLR1 expressing reference sample or a score for said cancer FOLR1 level that is equal to or greater than the score for a high FOLR1 expressing reference sample identifies said cancer as likely to respond to a low
- an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for diagnosing whether a cancer is sensitive to treatment with an anti-FOLRl treatment comprises: (a) detecting the level of FOLR1 expression in a cancerous sample from said cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein said detecting comprises the use of a method that distinguishes between staining intensity or staining uniformity in a FOLR1 expressing cancerous sample as compared to staining intensity or staining uniformity in one or more reference samples; (b) determining a FOLR1 staining intensity or staining uniformity score for said cancerous sample; and (c) comparing the FOLR1 staining intensity or staining uniformity score determined in step (b) to a relative value determined by measuring FOLR1 protein expression in at least one reference sample, wherein said at least one reference sample is a tissue, cell, or cell pellet sample which is not sensitive to treatment with an
- an anti-FOLRl antibody or antigen-binding fragment thereof for use in a method for diagnosing whether a cancer is sensitive to treatment with an anti-FOLRl treatment comprising: (a) detecting the level of FOLR1 expression in a cancerous sample from said cancer using an antibody, antigen-binding fragment thereof, polypeptide, or composition provided herein, wherein said detecting comprises the use of a method that distinguishes between staining intensity or staining uniformity in a FOLR1 expressing cancerous sample as compared to staining intensity or staining uniformity in one or more reference samples; (b) determining a FOLR1 staining intensity or staining uniformity score for said cancerous sample; and (c) comparing the FOLR1 staining intensity or staining uniformity score determined in step (b) to a relative value determined by measuring FOLR1 protein expression in at least one reference sample, wherein said at least one reference sample is a tissue, cell, or cell pellet sample which is sensitive to treatment with an
- the use of the active agents or anti-FOLRl antibodies or antigen-binding fragments thereof further comprises administering an active agent comprising an anti-FOLRl antibody or antigen-fragment thereof to the subject from whom the cancerous sample or biological sample was obtained.
- the cancerous sample or biological sample is a bodily fluid, cell, or tissue sample.
- the cell is a circulating tumor cell.
- the bodily fluid is blood, ascites, urine, plasma, serum, or peripheral blood.
- the detecting is by enzyme linked immunosorbent assay (ELISA) and/or by immunohistochemistry (IHC).
- IHC immunohistochemistry
- the IHC is calibrated IHC that can distinguish different levels of FOLR1 expression.
- the IHC produces a range of staining intensity for samples having low cell surface FOLR1 expression, intermediate FOLR1 cell surface expression, or high FOLR1 cell surface expression.
- the IHC distinguishes between staining intensity and staining uniformity in a FOLR1 expressing cancerous sample or biological sample as compared to a reference sample.
- IHC is performed manually.
- the IHC is performed using an automated system.
- a FOLR1 score is determined from the IHC.
- the IHC with an antibody or antigen-binding fragment described herein produces a range of staining for cells that have increased FOLR1 expression, particularly those within the level of staining equal to or greater than 2.
- a score of at least 2 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- a score of at least 3 homo (>75% uniformity) or at least 3 hetero (25-75% uniformity) indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- a score of at least 2 indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof
- a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) indicates that the patient will benefit from administration of an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- the cancer is lung cancer, endometrial cancer, or ovarian cancer.
- a score of at least 2 indicates an a decreased dose of the active agent should be administered.
- a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) indicates an a decreased dose of the active agent should be administered.
- the cancer is lung cancer, endometrial cance, or ovarian cancer.
- a score of at least 2 identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, a score of at least 2 homo (>75% uniformity) or 2 hetero (25-75% uniformity) identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, the cancer is lung cancer or endometrial cancer.
- a score of at least 3 identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, a score of at least 3 homo (>75% uniformity) or at least 3 hetero (25-75% uniformity) identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, the cancer is lung cancer, endometrial cance, or ovarian cancer.
- a score of at least 2 identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) identifies the cancer as likely to respond to a low dose anti-FOLRl treatment. In some embodiments, the cancer is lung cancer, endometrial cance, or ovarian cancer.
- a score of at least 2 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer or endometrial cancer.
- a score of at least 3 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof.
- a score of at least 3 homo (>75% uniformity) or at least 3 hetero (25-75% uniformity) identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof.
- the cancer is lung cancer, endometrial cance, or ovarian cancer.
- a score of at least 2 identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen- binding fragment thereof. In some embodiments, a score of at least 2 homo (>75% uniformity) or at least 2 hetero (25-75% uniformity) identifies the cancer as being sensitive to treatment with an active agent comprising an anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, the cancer is lung cancer, endometrial cance, or ovarian cancer. [0102] In some embodiments, a reference sample is a positive reference sample or a negative reference sample. In some embodiments, the reference sample comprises cells, cell pellets, or tissue.
- the antibody, antigen-binding fragment, or polypeptide provided herein further comprises a detection reagent selected from the group consisting of: an enzyme, a fluorophore, a radioactive label, and a luminophore.
- the detection reagent is selected from the group consisting of: biotin, digoxigenin, fluorescein, tritium, and rhodamine.
- the cancer is a FOLRl positive cancer.
- the cancer is selected from the group consisting of ovarian, brain, breast, uterine, endometrial, pancreatic, renal, and lung cancer.
- the lung cancer is non small cell lung cancer or bronchioloalveolar carcinoma.
- the ovarian cancer is epithelial ovarian cancer.
- the ovarian cancer is platinum resistant, relapsed, or refractory.
- the FOLRl expression is detected using at least one additional anti-FOLRl antibody or antigen-binding fragment thereof. In some embodiments, the FOLRl expression is measured using two anti-FOLRl antibodies or antigen-binding fragments thereof. In some embodiments, at least one antibody or antigen- binding fragment thereof is bound to a solid support. In some embodiments, at least one antibody or antigen-binding fragment thereof is bound to a microtiter plate. In some embodiments, at least one antibody or antigen-binding fragment thereof comprises a detection agent.
- the detection agent is a chromogenic detection agent, a fluorogenic detection agent, an enzymatic detection agent, or an electrochemiluminescent detection agent.
- the detection agent is horseradish peroxidase (HRP).
- the ELISA is a sandwich ELISA.
- the active agent comprises the FOLRl antibody huMovl9 or is the FOLRl antibody huMovl9.
- the active agent is administered as an antibody maytansinoid conjugate further comprising the maytansinoid DM4 and the cleavable sulfo-SPDB linker (IMGN853).
- an antibody, antigen-binding fragment, polypeptide, or composition provided herein is for use as a diagnostic.
- an antibody, antigen-binding fragment, polypeptide, or composition provided herein is for use in a method for diagnosing cancer in a patient suffering therefrom.
- the cancer is associated with elevated levels of FOLR1.
- the binding affinity of an antibody, antigen-binding fragment, or polypeptide is a binding affinity obtained in Example 3 and/or shown in Figure 4, 5, and/or 6.
- Figure 1 provides images of IHC staining of NSCLC and ovarian endometrioid adenocarcinoma samples using the 353.2-1 and 353.9-20 antibodies.
- Figure 2 provides images of IHC staining of normal salivary gland and pancreas samples using the 353.2-1 and 353.9-20 antibodies.
- Figure 3 provides images of Western blots of cell lysates using the 353.9-21
- Figure 4 shows the binding of 353.2-1, 353.3-1, 353.5-7, and 353.9-21 antibodies to denatured KB cells (A) and non-denatured T47D cells (B) using a fluorescence activated cell sorter (FACS).
- A denatured KB cells
- B non-denatured T47D cells
- FACS fluorescence activated cell sorter
- Figure 5 shows the binding of 353.2-1, 353.3-1, 353.5-7, and 353.9-21 antibodies to recombinant human FOLR1 using ELISA.
- Figure 6 shows the binding of an anti-FOLR2 antibody and 353.2-1, 353.3-1,
- Figure 7 shows the binding of anti-FOLRl antibodies 2.1 and huMovl9 to deglycosylated and non-treated recombinant human FOLR1 by ELISA.
- Figure 8 shows the binding of anti-FOLRl antibodies 2.1, huMovl9, and
- Figure 9 shows the relevant amino acids for resurfacing of the anti-FOLRl
- FIG. 10 shows the alignment of murine and humanized FRIHC2-1 antibody sequences for resurfacing.
- the murine heavy and light chain sequences correspond to SEQ ID NO:27 and SEQ ID NO:28, respectively.
- the resurfaced humanized heavy chain sequence corresponds to SEQ ID NO: 62, and the resurfaced human light chain version 1.0 and version 1.1 sequences correspond to SEQ ID NO:63 and SEQ ID NO:64, respectively.
- the leader "S" in the light chain sequence (framework position -1) is not considered for humanization and is not used in the humanized antibody sequence, so it is not shown in the figure.
- Figure 11 shows the relevant amino acids for CDR grafting of the anti-FOLRl
- Figure 12 shows the alignment of murine and humanized FRIHC2-1 sequences for CDR grafting.
- the murine heavy and light chain sequences correspond to SEQ
- the grafted humanized heavy chain sequence corresponds to SEQ ID NO: 65
- the grafted human light chain version 1.0 and version 1.1 sequences correspond to SEQ ID NO:66 and SEQ ID NO:67, respectively.
- the leader "S" in the light chain sequence (framework position -1) is not considered for humanization and is not used in the humanized antibody sequence, so it is not shown in the figure.
- Figure 13 provides images of IHC staining of lung adenocarcinoma tissues using the FOLR1-2.1 (353-2.1) antibody at varying dilutions.
- Figure 14 provides images of IHC staining of positive normal tissue (fallopian tube) (A) and cells (FOLRl transfected cells (B)) and negative cells (untransfected cells (C)) using the FOLR1-2.1 (353-2.1) antibody.
- Figure 15 provides images of IHC staining of ovarian cancer tissue (A) and lung adenocarcinoma tissue (B) samples using the FOLRl -2.1 (353-2.1) antibody.
- Figure 16 shows membrane staining of tumor cells in an endometrial cancer sample with the FOLRl -2.1 assay. The stromal cells are not stained.
- Figure 17 shows a comparison of staining and scoring difference between (A) the FOLRl -2.1 assay and (B) the BN3.2 assay.
- the present disclosure provides methods of detecting human folate receptor 1
- FOLRl including membrane FOLRl, shed FOLRl, and FOLRl on circulating tumor cells, and improving the efficacy of or the likelihood of response to the treatment of cancers characterized by the overexpression of FOLRl .
- the detection methods can detect a clinically relevant dynamic range of FOLRl and therefore can be used for patient stratification, to monitor or determine therapeutic efficacy, or the likelihood of response to the treatment of cancers characterized by the over expression of FOLRl .
- Novel FOLRl -binding polypeptides such as antibodies, that are useful in the FOLRl detection methods (e.g., IHC for membrane bound and cell associated FOLRl) are also disclosed.
- Related polypeptides and polynucleotides, compositions comprising the FOLRl -binding agents, and methods of making the FOLRl -binding agents are also provided.
- human folate receptor 1 refers to any native human FOLRl, unless otherwise indicated. Thus, all of these terms can refer to either a protein or nucleic acid sequence as indicated herein.
- FOLRl encompasses "full-length,” unprocessed FOLRl as well as any form of FOLRl that results from processing within the cell.
- the term also encompasses naturally occurring variants of FOLRl protein or nucleic acid, e.g., splice variants, allelic variants and isoforms.
- FOLRl polypeptides and polynucleotides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
- FOLRl sequences include, but are not limited to NCBI reference numbers P15328, NP_001092242.1, AAX29268.1, AAX37119.1, NP_057937.1 , and NP_057936.1.
- FOLRl protein that is soluble and that is not cell associated. In some embodiments it includes the extracellular domain (ECD) and the glycosylphosphatidyl inositol (GPI) linker. In one embodiment, the shed FOLRl includes only the ECD.
- FOLRl protein includes a signal peptide (amino acids 1-24), the FOLRl protein chain (amino acids 25-233 or 234), and a propeptide which can be cleaved (amino acids 235 to 257). Mature FOLRl protein lacks the signal peptide. Shed FOLRl can include amino acids 1 to 257, 1 to 233, 1 to 234, 25 to 233, 25 to 234. or any other fragments thereof.
- the signal sequence is cleaved.
- the ECD and the GPI portion can be embedded in a membrane (e.g., a soluble lipid raft).
- the shed FOLRl can include amino acids 1-233 or a fragment thereof.
- antibody means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
- antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) mutants, multispecific antibodies such as bispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
- antibody fragments such as Fab, Fab', F(ab')2, and Fv fragments
- scFv single chain Fv mutants
- multispecific antibodies such as bispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
- An antibody can be of any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
- the different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations.
- Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
- an antibody is a non-naturally occurring antibody.
- an antibody is purified from natural components.
- an antibody is recombinantly produced.
- an antibody is produced by a hybridoma.
- a “blocking" antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds, such as FOLRl .
- blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. Desirably, the biological activity is reduced by 10%, 20%, 30%>, 50%>, 70%, 80%, 90%, 95%, or even 100%.
- anti-FOLRl antibody or "an antibody that binds to FOLRl” refers to an antibody that is capable of binding FOLRl with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting FOLRl .
- the extent of binding of an anti-FOLRl antibody to an unrelated, non- FOLR1 protein is less than about 10% of the binding of the antibody to FOLRl as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to FOLRl has a dissociation constant (Kd) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
- the anti-FOLRl antibody does not bind FOLR2, FOLR3, FOLR4, or folic acid.
- FOLRl antibodies are known in the art and are disclosed in U.S. Published Application Nos. 2012/0009181 and 2012/0282175 and U.S. Provisional Application Nos. 61/695,791 and 61/756,254, and PCT publication WO2011/106528, each of which is herein incorporated by reference.
- the sequences of anti-FOLRl antibodies and antigen-binding fragments thereof are provided in Tables 1-8.
- antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody.
- antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
- antigen-binding fragment of an antibody includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by certain fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen-binding fragment" of an antibody include (without limitation): (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains (e.g., an antibody digested by papain yields three fragments: two antigen-binding Fab fragments, and one Fc fragment that does not bind antigen); (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region (e.g., an antibody digested by pepsin yields two fragments: a bivalent antigen-binding F(ab') 2 fragment, and a pFc' fragment that does not bind antigen) and its related F(ab') monovalent unit; (iii) a Fd fragment consisting of the VH and CHI domains (i.e., that portion of the heavy chain which is included in the Fab); (ii
- a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
- the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
- “monoclonal antibody” refers to such antibodies made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
- humanized antibody refers to forms of non-human (e.g., murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
- humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g., mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (Jones et al, 1986, Nature, 321 :522-525; Riechmann et al, 1988, Nature, 332:323-327; Verhoeyen et al, 1988, Science, 239:1534-1536).
- the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and capability.
- the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
- the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pats.
- a "humanized antibody” is a resurfaced antibody. In some embodiments, a "humanized antibody” is a CDR-grafted antibody.
- variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
- the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies.
- CDRs complementarity determining regions
- the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al, Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- amino acid position numbering refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
- the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
- human antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
- chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid eliciting an immune response in that species.
- epitopes or “antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
- the antigen is a polypeptide
- epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
- An epitope typically includes at least 3, and more usually, at least 5 or 8- 10 amino acids in a unique spatial conformation.
- Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd) or the half-maximal effective concentration (EC50). Affinity can be measured by common methods known in the art, including those described herein.
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described herein.
- binding affinity refers to a stronger binding between a molecule and its binding partner.
- Or better when used herein refers to a stronger binding, represented by a smaller numerical Kd value.
- an antibody which has an affinity for an antigen of "0.6 nM or better” the antibody's affinity for the antigen is ⁇ 0.6 nM, i.e., 0.59 nM, 0.58 nM, 0.57 nM etc. or any value less than 0.6 nM.
- the antibody's affinity as determined by a Kd will be between about 10 "3 to about 10 "12 M, between about 10 "6 to about 10 “1 1 M, between about 10 "6 to about 10 “10 M, between about 10 “6 to about 10 “9 M, between about 10 "6 to about 10 “8 M, or between about 10 " 6 to about 10 "7 M.
- the phrase "substantially similar,” or “substantially the same,” as used herein, denotes a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody of the invention and the other associated with a reference/comparator antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristics measured by said values (e.g., Kd values).
- the difference between said two values is less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference/comparator antibody.
- Immunoconjugates can also be defined by the generic formula in reverse order: C- L-A.
- a "linker” is any chemical moiety that is capable of linking a compound, usually a drug, such as a maytansinoid, to a cell-binding agent such as an anti-FOLRl antibody or a fragment thereof in a stable, covalent manner.
- Linkers can be susceptible to or be substantially resistant to acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active.
- Suitable linkers are well known in the art and include, for example, disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Linkers also include charged linkers, and hydrophilic forms thereof as described herein and know in the art.
- isolated is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
- Isolated polypeptides, antibodies, polynucleotides, vectors, cells or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
- an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
- substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
- overexpression of FOLR1 refer to a sample which contains elevated levels of FOLR1 expression.
- the FOLR1 can be elevated, increased, or overexpressed as compared to a control value (e.g., expression level in a biological sample, tissue, or cell from a subject without cancer, a sample or cancer known to express no or low FOLR1, a normal sample, or a cancer that does not have elevated FOLR1 values).
- a sample with increased expression can contain an increase of at least 2-fold, at least 3 -fold, or at least 5 -fold relative to a control values.
- FOLR1 expression can be measured by immunohistochemistry and given a staining intensity score or a staining uniformity score by comparison to calibrated controls exhibiting defined scores (e.g., an intensity score of 3 is given to the test sample if the intensity is comparable to the level 3 calibrated control or an intensity of 2 is given to the test sample if the intensity is comparable to the level 2 calibrated control). For example, a score of 1, 2, or 3 (3+), preferably a score of 2, or 3 (3+), by immunohistochemistry indicates an increased expression of FOLR1.
- a staining uniformity that is heterogeneous or homogeneous is also indicative of FOLR1 expression.
- an increase in FOLRl expression can be determined by detection of an increase of at least 2-fold, at least 3-fold, or at least 5-fold relative to control values (e.g., expression level in a tissue or cell from a subject without cancer or with a cancer that does not have elevated FOLRl values).
- a “reference sample” can be used to correlate and compare the results obtained in the methods of the invention from a test sample.
- Reference samples can be cells (e.g., cell lines, cell pellets) or tissue.
- the FOLRl levels in the “reference sample” can be an absolute or relative amount, a range of amount, a minimum and/or maximum amount, a mean amount, and/or a median amount of FOLRl .
- a “reference sample” can also serve as a baseline of FOLRl expression to which the test sample is compared.
- the "reference sample” can include a prior sample or baseline sample from the same patient, a normal reference with a known level of FOLRl expression, or a reference from a relevant patient population with a known level of FOLRl expression.
- FOLRl levels can also be expressed as values in a standard curve.
- a standard curve is a quantitative method of plotting assay data to determine the concentration of FOLRl in a sample.
- a reference sample is an antigen standard comprising purified FOLRl or FOLRl -Fc.
- the diagnostic methods of the invention can involve a comparison between expression levels of FOLRl in a test sample and a "reference value.”
- the reference value is the expression level of the FOLRl in a reference sample.
- a reference value can be a predetermined value and can also be determined from reference samples (e.g., control biological samples or reference samples) tested in parallel with the test samples.
- a reference value can be a single cut-off value, such as a median or mean or a range of values, such as a confidence interval. Reference values can be established for various subgroups of individuals, such as individuals predisposed to cancer, individuals having early or late stage cancer, male and/or female individuals, or individuals undergoing cancer therapy. Examples of normal reference samples or values and positive reference samples or values are described herein and are also described in Examples 1 and Examples 8-10 of WO 2012/135675 herein incorporated by reference.
- the reference sample is a sample from a healthy tissue, in particular a corresponding tissue which is not affected by cancer or a corresponding tissue which is not affected by a cancer that overexpresses FOLRl or a corresponding healthy tissue that is known not to express detectable levels of FOLR. These types of reference samples are referred to as negative control samples or "normal" reference samples. In other embodiments, the reference sample is a sample from a tumor or healthy tissue that expresses detectable FOLRl . These types of reference samples are referred to as positive control or positive reference samples.
- Positive control samples can also be used as a comparative indicator for the type (hetero versus homo) and/or degree (0, 1, 2, 3) of staining intensity, which correlates with the level of FOLRl expression. Positive control comparative samples are also referred to as calibrated reference samples.
- Low or non-FOLRl expressing references are described herein in the Examples and also include all structures of the esophagus, acinar cells/islets of the pancreas, interalveolar connective tissue of lung, and acinar cells of the salivary gland.
- exemplary non-expressors include BxPC3, Panc-1, and ASPC1.
- Positive FOLRl references are described herein, for example, in the Examples and also include ducts of pancreas, respiratory epithelium of normal lung, and intercalated ducts of the salivary gland.
- positive FOLRl references include ducts of pancreas and intercalated ducts of the salivary gland.
- exemplary high FOLRl expressors are described herein, for example, in the Examples and also include KB, HeLa, 300.19 cells transfected with FOLRl, Igrov-1, and Wish, and exemplary low FOLRl expressors include Ovcar-3, Caov-3, SW620, T47D, and Skov-3.
- Another positive high FOLRl reference is a cell line stably or transiently transfected with FOLRl . Additional positive and negative samples for FOLRl are described in Table 13. Appropriate positive and negative reference levels of FOLRl for a particular cancer can be determined by measuring levels of FOLRl in one or more appropriate subjects, and such reference levels can be tailored to specific populations of subjects (e.g., a reference level can be age-matched so that comparisons can be made between FOLRl levels in samples from subjects of a certain age and reference levels for a particular disease state, phenotype, or lack thereof in a certain age group). Such reference levels can also be tailored to specific techniques that are used to measure levels of FOLRl in biological samples (e.g., immunoassays, etc.).
- immunohistochemistry refers to histochemical and immunologic methods used to analyze, for example, cells or tissues.
- immunohistochemistry refers to histochemical and immunologic methods used to analyze, for example, cells or tissues.
- immunohistochemistry refers to histochemical and immunologic methods used to analyze, for example, cells or tissues.
- immunohistochemistry refers to histochemical and immunologic methods used to analyze, for example, cells or tissues.
- immunohistochemistry refers to histochemical and immunologic methods used to analyze, for example, cells or tissues.
- primary antibody refers to an antibody that binds specifically to the target protein antigen in a sample.
- a primary antibody is generally the first antibody used in an ELISA assay or IHC procedure. In one embodiment, the primary antibody is the only antibody used in an IHC procedure.
- secondary antibody herein refers to an antibody that binds specifically to a primary antibody, thereby forming a bridge or link between the primary antibody and a subsequent reagent, if any.
- the secondary antibody is generally the second antibody used in an immunohistochemical procedure.
- sample or “biological sample” of the present invention is of biological origin, in specific embodiments, such as from eukaryotic organisms.
- the sample is a human sample, but animal samples may also be used.
- Non-limiting sources of a sample for use in the present invention include solid tissue, biopsy aspirates, ascites, fluidic extracts, blood, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, tumors, organs, cell cultures and/or cell culture constituents, for example.
- a "cancerous sample” is a sample that contains a cancerous cell.
- the method can be used to examine an aspect of expression of FOLR1 or a state of a sample, including, but not limited to, comparing different types of cells or tissues, comparing different developmental stages, and detecting or determining the presence and/or type of disease or abnormality.
- a "section" of a tissue sample regards a single part or piece of a tissue sample, e.g. a thin slice of tissue or cells cut from a tissue sample. It is understood that multiple sections of tissue samples may be taken and subjected to analysis according to the present invention.
- the selected portion or section of tissue comprises a homogeneous population of cells.
- the selected portion comprises a region of tissue, e.g. the lumen as a non-limiting example.
- the selected portion can be as small as one cell or two cells, or could represent many thousands of cells, for example.
- the collection of cells is important, and while the invention has been described for use in the detection of cellular components, the method may also be used for detecting non- cellular components of an organism (e.g. soluble components in the blood as a non-limiting example).
- non- cellular components of an organism e.g. soluble components in the blood as a non-limiting example.
- the term "capture reagent” refers to a reagent capable of binding and capturing a target molecule in a sample such that under suitable condition, the capture reagent-target molecule complex can be separated from the rest of the sample.
- the capture reagent is immobilized.
- the capture reagent in a sandwich immunoassay is an antibody or a mixture of different antibodies against a target antigen.
- the term “detectable antibody” refers to an antibody that is capable of being detected either directly through a label amplified by a detection means, or indirectly through, e.g., another antibody that is labeled.
- the antibody is typically conjugated to a moiety that is detectable by some means.
- the detectable antibody is a biotinylated antibody.
- the term “detection means” refers to a moiety or technique used to detect the presence of the detectable antibody and includes detection agents that amplify the immobilized label such as label captured onto a microtiter plate.
- the detection means is a fluorimetric detection agent such as avidin or streptavidin.
- a "sandwich ELISA” employs the following steps: (1) microtiter plate is coated with a capture antibody; (2) sample is added, and any antigen present binds to capture antibody; (3) detecting antibody is added and binds to antigen; (4) enzyme-linked secondary antibody is added and binds to detecting antibody; and (5) substrate is added and is converted by enzyme to detectable form.
- label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a "labeled" antibody.
- the label can be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
- correlate or “correlating” is meant comparing, in any way, the performance and/or results of a first analysis with the performance and/or results of a second analysis. For example, one may use the results of a first analysis in carrying out the second analysis and/or one may use the results of a first analysis to determine whether a second analysis should be performed and/or one may compare the results of a first analysis with the results of a second analysis.
- increased expression of FOLR1 correlates with increased likelihood of effectiveness of a FOLR1 -targeting anti-cancer therapy.
- cancer refers to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth.
- examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
- cancers include cancers of endothelial, mesenchymal, or epithelial origin, such as lung cancer (e.g., squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, mesothelioma, and squamous carcinoma of the lung), cancer of the peritoneum (e.g., primary peritoneal), hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer (serous or endometrioid), liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrioid (e.g., endometrial adenocarcinoma) or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer (e.g.
- lung cancer e.g., squam
- Cancers also encompass cancers which contain cells having elevated FOLR1 expression levels.
- FOLR1 -elevated cancers include, but are not limited to, ovarian, non-small cell lung cancer (adenocarcinoma), uterine, endometrial, pancreatic, renal, lung, and breast cancer.
- Tumor and “neoplasm” refer to any mass of tissue that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions.
- cancer cell refers to the total population of cells derived from a tumor or a pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the tumor cell population, and tumorigenic stem cells (cancer stem cells).
- tumorigenic stem cells cancer stem cells.
- tumorigenic stem cells cancer stem cells
- subject refers to any animal (e.g., a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment.
- subject and patient are used interchangeably herein in reference to a human subject.
- composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- Such formulation can be sterile.
- an “effective amount” of an antibody or immunoconjugate as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
- An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
- the term "therapeutically effective amount” refers to an amount of an antibody or other drug effective to "treat” a disease or disorder in a subject or mammal.
- the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and in a certain embodiment, stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and in a certain embodiment, stop) tumor metastasis; inhibit, to some extent, tumor growth; relieve to some extent one or more of the symptoms associated with the cancer; and/or result in a favorable response such as increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), or, in some cases, stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), a decrease in CA125 in the case of ovarian cancer, or any combination thereof.
- PFS progression-free survival
- DFS disease-free survival
- OS
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- the term "respond favorably” generally refers to causing a beneficial state in a subject.
- cancer treatment the term refers to providing a therapeutic effect on the subject.
- Positive therapeutic effects in cancer can be measured in a number of ways (See, W.A. Weber, J. Nucl. Med. 50: 1S-10S (2009)).
- tumor growth inhibition, molecular marker expression, serum marker expression, and molecular imaging techniques can all be used to assess therapeutic efficacy of an anti-cancer therapeutic.
- a T/C ⁇ 42% is the minimum level of anti-tumor activity.
- a favorable response can be assessed, for example, by increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), or, in some cases, stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), a decrease in CA125 in the case of ovarian cancer or any combination thereof.
- PFS, DFS, and OS can be measured by standards set by the National Cancer
- PFS progression free survival
- RECIST Response Evaluation Criteria in Solid Tumors
- TTP Time to Tumor Progression
- a "complete response” or “complete remission” or “CR” indicates the disappearance of all signs of tumor or cancer in response to treatment. This does not always mean the cancer has been cured.
- a “partial response” or “PR” refers to a decrease in the size or volume of one or more tumors or lesions, or in the extent of cancer in the body, in response to treatment.
- Stable disease refers to disease without progression or relapse. In stable disease there is neither sufficient tumor shrinkage to qualify for partial response nor sufficient tumor increase to qualify as progressive disease.
- Progressive disease refers to the appearance of one more new lesions or tumors and/or the unequivocal progression of existing non-target lesions. Progressive disease can also refer to a tumor growth of more than 20 percent since treatment began, either due to an increases in mass or in spread of the tumor.
- DFS Disease free survival
- OS Global System for Mobile communications
- OS includes a prolongation in life expectancy as compared to naive or untreated individuals or patients.
- Overall survival refers to the situation wherein a patient remains alive for a defined period of time, such as one year, five years, etc., e.g., from the time of diagnosis or treatment.
- a "decrease in CA125 levels” can be assessed according to the Gynecologic
- CA125 levels can be measured prior to treatment to establish a baseline CA125 level.
- CA125 levels can be measured one or more times during or after treatment, and a reduction in the CA125 levels over time as compared to the baseline level is considered a decrease in CA125 levels.
- a subject is successfully "treated” for cancer according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity, tumorigenic frequency, or tumorigenic capacity, of a tumor; reduction in the number or frequency of cancer stem cells in a tumor; differentiation of tumorigenic cells to a non-tumorigenic state; increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), a decrease in CA125 in the case of ova
- Prophylactic or preventative measures refer to therapeutic measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of prophylactic or preventative measures include those prone to have the disorder and those in whom the disorder is to be prevented.
- healthcare provider refers to individuals or institutions which directly interact with and administer to living subjects, e.g., human patients.
- Non-limiting examples of healthcare providers include doctors, nurses, technicians, therapist, pharmacists, counselors, alternative medicine practitioners, medical facilities, doctor's offices, hospitals, emergency rooms, clinics, urgent care centers, alternative medicine clinics/facilities, and any other entity providing general and/or specialized treatment, assessment, maintenance, therapy, medication, and/or advice relating to all, or any portion of, a patient's state of health, including but not limited to general medical, specialized medical, surgical, and/or any other type of treatment, assessment, maintenance, therapy, medication and/or advice.
- a healthcare provider can administer or instruct another healthcare provider to administer a therapy to treat a cancer.
- administering includes prescribing a therapy to a subject as well as delivering, applying, or giving the therapy to a subject.
- a healthcare provider can implement or instruct another healthcare provider or patient to perform the following actions: obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples, administer a therapy or therapeutic agent (e.g., a FOLR1 binding agent), commence the administration of a therapy, cease the administration of a therapy, continue the administration of a therapy, temporarily interrupt the administration of a therapy, increase the amount of an administered therapeutic agent, decrease the amount of an administered therapeutic agent, continue the administration of an amount of a therapeutic agent, increase the frequency of administration of a therapeutic agent, decrease the frequency of administration of a therapeutic agent, maintain the same dosing frequency on
- Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure can be imparted before or after assembly of the polymer.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- Other types of modifications include, for example, "caps," substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, cabamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g
- any of the hydroxyl groups ordinarily present in the sugars can be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or can be conjugated to solid supports.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls can also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'- azido-ribose, carbocyclic sugar analogs, alpha-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages can be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S ("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR * , CO or CH 2 ("formacetal”), in which each R or R is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether ( ⁇ 0 ⁇ ) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- vector means a construct, which is capable of delivering, and expressing, one or more gene(s) or sequence(s) of interest in a host cell.
- vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
- polypeptide polypeptide
- peptide protein
- polymers of amino acids of any length can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- polypeptides of this invention are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains. In some embodiments, a polypeptide, peptide, or protein is non-naturally occurring. In some embodiments, a polypeptide, peptide, or protein is purified from other naturally occurring components. In some embodiments, the polypeptide, peptide, or protein is recombinantly produced.
- nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
- sequence comparison software or algorithms or by visual inspection.
- Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences.
- One such non- limiting example of a sequence alignment algorithm is the algorithm described in Karlin et al, 1990, Proc. Natl. Acad.
- Gapped BLAST can be used as described in Altschul et al, 1997, Nucleic Acids Res. 25:3389-3402.
- BLAST-2 Altschul et al, 1996, Methods in Enzymology, 266:460-480
- ALIGN ALIGN-2
- Megalign Megalign
- the percent identity between two nucleotide sequences is determined using the GAP program in GCG software (e.g., using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 90 and a length weight of 1, 2, 3, 4, 5, or 6).
- the GAP program in the GCG software package which incorporates the algorithm of Needleman and Wunsch (J.
- Mol. Biol. (48):444-453 (1970)) can be used to determine the percent identity between two amino acid sequences (e.g., using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5).
- the percent identity between nucleotide or amino acid sequences is determined using the algorithm of Myers and Miller (CABIOS, 4: 11-17 (1989)).
- the percent identity can be determined using the ALIGN program (version 2.0) and using a PAM120 with residue table, a gap length penalty of 12 and a gap penalty of 4.
- Appropriate parameters for maximal alignment by particular alignment software can be determined by one skilled in the art.
- the default parameters of the alignment software are used.
- the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be longer than the percent identity of the second sequence to the first sequence.
- whether any particular polynucleotide has a certain percentage sequence identity can, in certain embodiments, be determined using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2: 482 489 (1981), to find the best segment of homology between two sequences.
- the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
- two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- identity exists over a region of the sequences that is at least about 10, about 20, about 40-60 residues in length or any integral value therebetween, or over a longer region than 60-80 residues, at least about 90-100 residues, or the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
- a "conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e
- substitution of a phenylalanine for a tyrosine is a conservative substitution.
- conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence, to the antigen(s), i.e., the FOLRl to which the polypeptide or antibody binds.
- Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen-binding are well- known in the art (see, e.g., Brummell et al, Biochem. 32: 1180-1 187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:.412-417 (1997)).
- the present invention provides agents that specifically bind human FOLRl .
- FOLRl binding agents are antibodies, immunoconjugates or polypeptides.
- the amino acid and nucleotide sequences for human FOLRl are known in the art and are also provided herein as represented by SEQ ID NO: l and SEQ ID NO:2.
- the FOLR1 binding agents can bind to an epitope of SEQ ID NO: l .
- an anti-FOLRl antibody can specifically binds to an epitope of FOLR1 (SEQ ID NO: l), wherein epitope comprises an N-glycosylated amino acid.
- FOLR1 SEQ ID NO: l
- epitope comprises an N-glycosylated amino acid.
- Such antibodies will therefore bind to FOLR1 when it is glycosylated and will not bind to FOLR1 when it is not glycosylated. In other words, the binding of these antibodies is glycol- dependent.
- These antibodies are advantageous in that they can be used to distinguish between glycosylated and non-glycosylated forms of FOLR1. Given that glycosylation can be required for membrane localization, the antibodies can advantageously be used for membrane specific staining.
- the anti-FOLRl antibody can specifically bind to an epitope of FOLR1 comprising N-glycosylated amino acid 69 of FOLR1. In some embodiments, the anti-FOLRl antibody can specifically bind to an epitope of FOLR1 comprising N-glycosylated amino acid 161 of FOLR1. In some embodiments, the anti- FOLRl antibody can specifically bind to an epitope of FOLR1 comprising N-glycosylated amino acid 201 of FOLR1.
- the anti-FOLRl antibody is the antibody produced by the hybridoma deposited with the American Type Culture Collection (ATCC), located at 10801 University Boulevard, Manassas, VA 20110 on April 16, 2013 under the terms of the Budapest Treaty and having ATCC deposit no. PTA-120196 ("FOLRl-9.20,” also referred to as "IMGN 353.9-20,” “353.9-20,” or “9.20”).
- the anti-FOLRl antibody is the antibody produced by the hybridoma deposited with the ATCC on April 16, 2013 and having ATCC deposit no.
- the FOLRl -binding agents include FOLRl -binding agents that comprise the heavy and light chain CDR sequences of (i) muFRIHC2-l , which is also known as “FOLRl - 2.1 ,” “IMGN 353.2-1 ,” “353.2-1 ,” or “2.1 “, (ii) muFRIHC5-7, which is also known as “IMGN 353.5-7,” “353.5-7” or “5.7,” (iii) " muFRIHC9-20,” which is also known as “FOLRl -9.20,” “IMGN 353.9-20,” “353.9-20,” or “9.20,” (iv) resurfaced huFRIHC2-l version 1.0 or 1.01 , or (v) CDR grafted huFRIHC2-l version 1.0 or 1.01 , which are provided in Tables 1 and
- the FOLRl binding molecules can be antibodies or antigen binding fragments that specifically bind to FOLRl that comprise the CDRs of antibody 2.1 (i.e., SEQ ID NOs: 3-8), 5.7 (i.e., SEQ ID NOs: 9-14), or 9.20 (i.e., SEQ ID NOs: 15-20), with up to four (i.e., 0, 1, 2, 3, or 4) conservative amino acid substitutions per CDR.
- the FOLRl binding molecules can be antibodies or antigen-binding fragments that specifically bind to FOLRl that comprise the CDRs of the composite sequence shown above (i.e., SEQ ID NOs: 21-26), with up to four (i.e., 0, 1, 2, 3, or 4) conservative amino acid substitutions per CDR.
- the FOLRl binding molecules can be antibodies or antigen-binding fragments that specifically bind to FOLRl that comprise the CDRs of antibody produced by the hybridoma of ATCC deposit no. PTA-120196 or PTA-120197.
- Polypeptides can comprise one of the individual variable light chains or variable heavy chains described herein. Antibodies and polypeptides can also comprise both a variable light chain and a variable heavy chain.
- the variable light chain and variable heavy chain sequences of murine antibodies 2.1, 5.7, and 9.20 and humanized 2.1 are provided in Tables 3 and 4 below.
- polypeptides that comprise: (a) a polypeptide having at least about 90% sequence identity to SEQ ID NOs:27, 29, 31, 62, or 65; and/or (b) a polypeptide having at least about 90%> sequence identity to SEQ ID NOs:28, 30, 32, 63, 64, 66, or 67.
- the polypeptide comprises a polypeptide having at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to SEQ ID NOs:27-32 or 62-67.
- the polypeptide comprises (a) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:27, 29, 31, 62, or 65 and/or (b) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:28, 30, 32, 63, 64, 66, or 67.
- the polypeptide comprises (a) a polypeptide having the amino acid sequence of SEQ ID NOs:27, 29, 31, 62, or 65; and/or (b) a polypeptide having the amino acid sequence of SEQ ID NOs:28, 30, 32, 63, 64, 66, or 67.
- the polypeptide is an antibody and/or the polypeptide specifically binds FOLR1. In certain embodiments, the polypeptide is a murine, chimeric, or humanized antibody that specifically binds FOLR1. In certain embodiments, the polypeptide having a certain percentage of sequence identity to SEQ ID NOs:27-32 or 62-67 differs from SEQ ID NOs:27-32 or 62-67 by conservative amino acid substitutions only.
- polypeptides comprising a variable light chain that is at least about 85%, at least about 90%>, at least about 95%, or at least about 99%, or is identical to the variable light chain sequence of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- polypeptides comprising a variable heavy chain that is at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or is identical to the variable heavy chain sequence of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- variable heavy and variable light chain sequences that are at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or identical to the variable heavy and variable light chain sequences of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- the antibody or antigen-binding fragment is the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or an antigen- binding fragment thereof.
- the antibody or antigen-binding fragment is the antibody produced by the hybridoma having ATCC deposit no. PTA-120197 or an antigen- binding fragment thereof.
- Polypeptides can comprise one of the individual light chains or heavy chains described herein. Antibodies and polypeptides can also comprise both a light chain and a heavy chain. The light chain and heavy chain sequences of antibodies 2.1, 5.7, and 9.20 are provided in Tables 5 and 6 below.
- NTFTCSVLHEGLHNHHTEKSLSHSPGK (SEQ ID NO:35) muFRIHC9-20 QVQLQQSGPDLVKPGASVRISCKASGFTFTNYYIHWVKQRPGQGLE
- NTFTCSVLHEGLHNHHTEKSLSHSPGK (SEQ ID NO:37) muhuMovl9 Q VQL VQ S G AE WKPG AS VKI S CKAS G YTFTG YFMN WVKQ SPGQ SL
- PRLLI YRASNLE AG VPDRFS G SG SKTDFTLTI SP VE AED AAT Y YC QQ SREYPYTFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFL N FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTK DEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO:69)
- polypeptides that comprise: (a) a polypeptide having at least about 90% sequence identity to SEQ ID NOs:33, 35, or 37; and/or (b) a polypeptide having at least about 90%> sequence identity to SEQ ID NOs:34, 36, or 38.
- the polypeptide comprises a polypeptide having at least about 95%, at least about 96%>, at least about 97%), at least about 98%>, or at least about 99% sequence identity to SEQ ID NOs:33- 38.
- the polypeptide comprises (a) a polypeptide having at least about 95%o sequence identity to SEQ ID NOs:33, 35, or 37, and/or (b) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:34, 36, or 38.
- the polypeptide comprises (a) a polypeptide having the amino acid sequence of SEQ ID NOs:33, 35, or 37; and/or (b) a polypeptide having the amino acid sequence of SEQ ID NOs:34, 36, or 38.
- the polypeptide is an antibody and/or the polypeptide specifically binds FOLR1.
- the polypeptide is a murine, chimeric, or humanized antibody that specifically binds FOLR1.
- the polypeptide having a certain percentage of sequence identity to SEQ ID NOs:33-38 differs from SEQ ID NOs:33-38 by conservative amino acid substitutions only.
- polypeptides comprising a light chain that is at least about
- polypeptides comprising a heavy chain that is at least about
- antibodies and antigen-binding fragments thereof comprising heavy and light chain sequences that are at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or identical to the heavy and light chain sequences of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA- 120197.
- the affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method well known in the art, e.g., flow cytometry, enzyme-linked immunoabsorbent assay (ELISA), or radioimmunoassay (RIA), or kinetics (e.g., BIACORETM analysis).
- ELISA enzyme-linked immunoabsorbent assay
- RIA radioimmunoassay
- kinetics e.g., BIACORETM analysis.
- Direct binding assays as well as competitive binding assay formats can be readily employed. (See, for example, Berzofsky, et al., "Antibody-Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, N.Y. (1992); and methods described herein.
- the measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH, temperature).
- affinity and other antigen-binding parameters e.g., KD or Kd, Kon, Koff
- KD or Kd, Kon, Koff are made with standardized solutions of antibody and antigen, and a standardized buffer, as known in the art and such as the buffer described herein.
- binding assays can be performed using flow cytometry on cells expressing the FOLR1 antigen on the surface.
- FOLRl-positve cells such as SKOV3 can be incubated with varying concentrations of anti-FOLRl antibodies using 1 xlO 5 cells per sample in 100 FACS buffer (RPMI-1640 medium supplemented with 2% normal goat serum). Then, the cells can be pelleted, washed, and incubated for 1 h with 100 L of FITC-conjugated goat-anti-mouse or goat-anti-human IgG-antibody (such as is obtainable from, for example Jackson Laboratory, 6 ⁇ g/mL in FACS buffer).
- the cells are then pelleted again, washed with FACS buffer and resuspended in 200 of PBS containing 1% formaldehyde.
- Samples can be acquired, for example, using a FACSCalibur flow cytometer with the HTS multiwell sampler and analyzed using CellQuest Pro (all from BD Biosciences, San Diego, US).
- MFI mean fluorescence intensity for FL1
- a sigmoidal dose-response curve is fitted for binding curves and EC50 values are calculated using programs such as GraphPad Prism v4 with default parameters (GraphPad software, San Diego, CA).
- EC50 values can be used as a measure for the apparent dissociation constant "Kd” or "KD” for each antibody.
- Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro.
- the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
- Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay e.g., radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)
- RIA radioimmunoassay
- ELISA enzyme-linked immunosorbent assay
- the monoclonal antibodies can then be purified from the culture medium or ascites fluid as described for polyclonal antibodies.
- monoclonal antibodies can also be made using recombinant
- the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT- PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
- the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E.
- monoclonal antibodies are generated by the host cells.
- recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et al, 1990, Nature, 348:552-554; Clackson et al, 1991, Nature, 352:624-628; and Marks et al, 1991, J. Mol. Biol, 222:581-597).
- the polynucleotide(s) encoding a monoclonal antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
- the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted 1) for those regions of, for example, a human antibody to generate a chimeric antibody or 2) for a non- immunoglobulin polypeptide to generate a fusion antibody.
- the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
- the monoclonal antibody against the human FOLR1 is a humanized antibody.
- such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
- a humanized, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is non-human, e.g., but not limited to, mouse, rat, rabbit, non-human primate or other mammal. These non-human amino acid residues are replaced by residues that are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence.
- Such imported sequences can be used to reduce immunogenicity or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic, as known in the art.
- the CDR residues are directly and most substantially involved in influencing FOLR1 binding. Accordingly, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids.
- Antibodies can also optionally be humanized, resurfaced, engineered or human antibodies engineered with retention of high affinity for the antigen FOLR1 and other favorable biological properties.
- humanized (or human) or engineered anti-FOLRl antibodies and resurfaced antibodies can be optionally prepared by a process of analysis of the parental sequences and various conceptual humanized and engineered products using three-dimensional models of the parental, engineered, and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences.
- Humanization, resurfacing or engineering of antibodies of the present invention can be performed using any known method, such as but not limited to those described in, Winter (Jones et al, Nature 321 :522 (1986); Riechmann et al, Nature 332:323 (1988); Verhoeyen et al, Science 239: 1534 (1988)), Sims et al, J. Immunol. 151 : 2296 (1993); Chothia and Lesk, J. Mol. Biol. 196:901 (1987), Carter et al, Proc. Natl. Acad. Sci. U.S.A. 89:4285 (1992); Presta et al, J. Immunol.
- the antibody to FOLR1 is a human antibody.
- Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al, 1991, J. Immunol, 147 (l):86-95; and U.S. Patent 5,750,373).
- the human antibody can be selected from a phage library, where that phage library expresses human antibodies, as described, for example, in Vaughan et al, 1996, Nat. Biotech., 14:309- 314, Sheets et al, 1998, Proc. Nat'l. Acad. Sci., 95:6157-6162, Hoogenboom and Winter, 1991, J. Mol. Biol, 227:381, and Marks et al, 1991, J. Mol. Biol, 222:581). Techniques for the generation and use of antibody phage libraries are also described in U.S. Patent Nos.
- Humanized antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016.
- an antibody fragment to, for example, increase tumor penetration.
- Various techniques are known for the production of antibody fragments.
- antibody fragments are produced recombinantly.
- Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
- Such antibody fragments can also be isolated from antibody phage libraries.
- the antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- modified antibodies can comprise any type of variable region that provides for the association of the antibody with the polypeptides of a human FOLR1.
- the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen.
- the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g., cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified immunoglobulins are human.
- variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
- variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
- variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing.
- the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen-binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site.
- the modified antibodies of this invention will comprise antibodies (e.g., full- length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
- the constant region of the modified antibodies will comprise a human constant region.
- Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
- the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL).
- modified constant regions wherein one or more domains are partially or entirely deleted are contemplated.
- the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
- the omitted constant region domain will be replaced by a short amino acid spacer (e.g., 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
- the modified antibodies can be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies.
- compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
- Such a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
- amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct.
- any spacer added to the construct will be relatively non-immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified antibodies.
- the antibodies of the present invention can be provided by the partial deletion or substitution of a few or even a single amino acid.
- the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization.
- the constant regions of the disclosed antibodies can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it may be possible to disrupt the activity provided by a conserved binding site (e.g., Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody.
- Certain embodiments can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment. In such embodiments it can be desirable to insert or replicate specific sequences derived from selected constant region domains.
- the present invention further embraces variants and equivalents which are substantially homologous to the chimeric, humanized and human antibodies, or antibody fragments thereof, set forth herein.
- These can contain, for example, conservative substitution mutations, i.e., the substitution of one or more amino acids by similar amino acids.
- conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art.
- polypeptides of the present invention can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, against a human FOLR1. It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect of the structure or function of the protein. Thus, the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against a human folate receptor protein. Such mutants include deletions, insertions, inversions, repeats, and type substitutions.
- polypeptides and analogs can be further modified to contain additional chemical moieties not normally part of the protein.
- Those derivatized moieties can improve the solubility, the biological half life or absorption of the protein.
- the moieties can also reduce or eliminate any desirable side effects of the proteins and the like. An overview for those moieties can be found in REMINGTON'S PHARMACEUTICAL SCIENCES, 20th ed., Mack Publishing Co., Easton, PA (2000).
- the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthetic methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host.
- a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
- the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. See, e.g., Zoeller et al, Proc. Nat'l. Acad. Sci. USA 81 :5662-5066 (1984) and U.S. Pat. No. 4,588,585.
- a DNA sequence encoding a polypeptide of interest would be constructed by chemical synthesis using an oligonucleotide synthesizer.
- Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene.
- a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
- the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
- recombinant expression vectors are used to amplify and express DNA encoding antibodies, or fragments thereof, against human FOLR1.
- Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a polypeptide chain of an anti-FOLRl antibody, or fragment thereof, operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
- a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences.
- Such regulatory elements can include an operator sequence to control transcription.
- the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated.
- DNA regions are operatively linked when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
- signal peptide secretory leader
- a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence
- a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
- Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
- recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
- Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
- Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Escherichia coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single-stranded DNA phages.
- prokaryotes include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include established cell lines of mammalian origin. Cell-free translation systems could also be employed.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985), the relevant disclosure of which is hereby incorporated by reference.
- Suitable mammalian host cell lines include HEK-293 and HEK-293T, the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981), and other cell lines including, for example, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines.
- Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- the proteins produced by a transformed host can be purified according to any suitable method.
- standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
- Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
- Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
- supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
- a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
- the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
- a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
- RP- HPLC reversed-phase high performance liquid chromatography
- hydrophobic RP-HPLC media e.g., silica gel having pendant methyl or other aliphatic groups
- Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps.
- Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
- Methods known in the art for purifying antibodies and other proteins also include, for example, those described in U.S. Patent Publication Nos. 2008/0312425, 2008/0177048, and 2009/0187005, each of which is hereby incorporated by reference herein in its entirety.
- the invention encompasses polynucleotides comprising polynucleotides that encode a polypeptide that specifically binds a human FOLRl receptor or a fragment of such a polypeptide.
- the invention provides a polynucleotide comprising a nucleic acid sequence that encodes an antibody to a human FOLRl or encodes a fragment of such an antibody.
- the polynucleotides of the invention can be in the form of RNA or in the form of DNA.
- DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
- the polynucleotide is a cDNA or a DNA lacking one more endogenous introns.
- a polynucleotide is a non-naturally occurring polynucleotide. In some embodiments, a polynucleotide is recombinantly produced.
- the polynucleotides are isolated. In certain embodiments, the polynucleotides are substantially pure. In some embodiments, a polynucleotide is purified from natural components.
- the invention provides a polynucleotide comprising a polynucleotide encoding a polypeptide comprising a sequence selected from the group consisting of SEQ ID NOs:3-38 and 59-67. Also provided is a polynucleotide encoding a polypeptide having at least about 95%, at least about 96%>, at least about 97%, at least about 98%>, or at least about 99% sequence identity to SEQ ID NOs:3-38 and 59-67.
- the invention further provides a polynucleotide comprising a sequence selected from those shown in Tables 7 and 8 below.
- muFRIHC2-l agtgatgttgttctgacccaaactccactctctgcctgtcaatattggagatcaagcctctatctcttgcaagt cttctaagagtcttctgaatagtgatggattcacttatttggactggtacctgcagaagccaggccagtctcca ("2.1")
- GGAACTAAACTGGAAATCAAAcgtacg (SEQ ID NO:73) huFRIHC2-l v. gaattcgccaccATGGGATGGAGTTGTATTATTCTGTTCTTGGTCGC
- polynucleotide having at least about 95%, at least about
- variable light chain that is at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or is identical to the variable light chain sequence of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- polynucleotides comprising a variable light chain-encoding sequence that is at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or is identical to the variable light chain-encoding sequence that encodes the variable light chain of the antibody produced by the hybridoma having ATCC deposit no. PTA- 120196 or PTA-120197.
- variable heavy chain that is at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or is identical to the variable heavy chain sequence of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- variable heavy chain-encoding sequence that is at least about 85%, at least about 90%, at least about 95%, or at least about 99%, or is identical to the variable heavy chain-encoding sequence that encodes the variable heavy chain of the antibody produced by the hybridoma having ATCC deposit no. PTA-120196 or PTA-120197.
- the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g., a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
- the polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
- the polynucleotides can also encode for a proprotein which is the mature protein plus additional 5' amino acid residues.
- a mature protein having a prosequence is a proprotein and is an inactive form of the protein. Once the prosequence is cleaved an active mature protein remains.
- the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide.
- the marker sequence can be a hexa-histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g., COS-7 cells) is used.
- HA hemagglutinin
- the present invention further relates to variants of the hereinabove described polynucleotides encoding, for example, fragments, analogs, and derivatives.
- the polynucleotide variants can contain alterations in the coding regions, non- coding regions, or both. In some embodiments the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
- Biological samples are often fixed with a fixative. Aldehyde fixatives such as formalin (formaldehyde) and glutaraldehyde are typically used. Tissue samples fixed using other fixation techniques such as alcohol immersion (Battifora and Kopinski, J. Histochem. Cytochem. (1986) 34: 1095) are also suitable. The samples used may also be embedded in paraffin. In one embodiment, the samples are both formalin-fixed and paraffin-embedded (FFPE). In another embodiment, the FFPE block is hematoxylin and eosin stained prior to selecting one or more portions for analysis in order to select specific area(s) for the FFPE core sample.
- FFPE paraffin-embedded
- any intact organ or tissue may be cut into fairly small pieces and incubated in various fixatives (e.g. formalin, alcohol, etc.) for varying periods of time until the tissue is "fixed".
- fixatives e.g. formalin, alcohol, etc.
- the samples may be virtually any intact tissue surgically removed from the body.
- the samples may be cut into reasonably small piece(s) that fit on the equipment routinely used in histopathology laboratories.
- the size of the cut pieces typically ranges from a few millimeters to a few centimeters.
- the biological sample can also be fluidic extracts, blood, plasma, serum, spinal fluid, lymph fluid, and or splenic preparations.
- the antibody maytansinoid conjugate (AMC) IMGN853 comprises the
- FOLR1 -binding monoclonal antibody huMovl9 (M9346A), conjugated to the maytansinoid, DM4 (N(2')-deacetyl-N2'-(4-mercapto-4-methyl-l-oxopentyl)-maytansine), attached via the cleavable sulfo-SPDB (N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate) linker.
- the antibody sequences of IMGN853 (huMovl9) are provided below as SEQ ID NOs: 45 and 47, and IMGN853 and huMovl9 are described in US Appl. Pub. No. 2012/0009181 (now 8,557,966), which is herein incorporated by reference in its entirety.
- IMGN853 is currently in clinical development for various therapeutic indications which include FOLRl positive ovarian cancer, non-small cell lung cancer, endometrioid cancer, renal cancer, and other epithelial malignancies. Ovarian cancers exhibit the greatest FOLRl penetrance and are considered the major indications for treatment with IMGN853 (Antony AC. Ann Rev Nutr 16:501-21 (1996); Yuan Y et al. Hum Pathol 40(10):1453-1460 (2009)). Measuring levels of FOLRl in patient plasma samples can help identify patient populations more likely to respond to AMC treatment.
- the invention provides a method for identifying subjects that are likely to respond favorably to FOLRl -targeting anti-cancer therapies due to elevated expression levels of FOLRl being expressed in the subject, in particular using antibodies and antigen-binding fragments thereof provided herein that can detect a dynamic range of FOLRl expression levels, e.g., in IHC.
- IHC provides a score for FOLRl expression on tumor cells: 0 (no expression) to 3 (or 3+) (very high levels of expression).
- a homogenous staining uniformity or a combination of increased staining with heterogenous staining uniformity can indicate increased FOLRl expression.
- scores of greater than 2 hetero may be used as a patient selection criterion for treatment with a FOLRl therapeutic agent (see e.g., U.S. Published Application No. 2012/0282175, which is herein incorporated by reference in its entirety).
- FOLRl expression analysis also identifies patients in whom decreased levels of a FOLRl -targeting anti-cancer therapy ("low dose therapy") can be effective to cause antitumor responses.
- low dose therapy a FOLRl -targeting anti-cancer therapy
- compounds are generally administered at the smallest dosage that achieves the desired therapeutic response. This is specifically important for therapeutics that cause clinical side effects.
- the ability to recognize those subjects with elevated FOLRl expression levels allows for minimization of the dosage of the FOLRl - targeting therapeutic, thus decreasing possible side effects, while maintaining therapeutic efficacy.
- the antibodies and antigen-binding fragments provided herein are particularly advantageous for use in such methods because they are capable of detecting a dynamic range of FOLRl expression levels, e.g., in IHC.
- the present method for detecting FOLRl in human sourced fluid samples uses a traditional sandwich ELISA format.
- the method uses a capture agent (i.e., antibody) to FOLRl attached to a solid support.
- the solid support is a microtiter plate.
- the sample ascites fluids, plasma, etc.
- a different detection agent a different antibody
- the detection agent is then detected through the use of a secondary detection agent (biotin / streptavidin, anti-human secondary mono or polyclonal antibody, etc.) which can bind more than one time to the first detection agent, thus amplifying the signal of detection.
- the secondary detection agent is then quantified by the use of some other means (e.g., TMB/peroxidase, scintillation counting, fluorescent probes, etc.). Additionally, the assay detects FOLRl and is not negatively impacted by the presence of Movl9, IMGN853, other FOLRl family members, or folic acid.
- the assays of the present invention include assays both to select patients eligible to receive FOLRl -based therapy and assays to monitor patient response. Assays for response prediction are run before therapy selection, and levels of FOLRl may impact therapy decisions. For monitoring patient response, the assay is run at the initiation of therapy to establish baseline (or predetermined) levels of FOLR1 in the sample. The same sample is then assayed and the levels of FOLR1 compared to the baseline or predetermined levels.
- the term "predetermined level” refers generally to an assay cutoff value that is used to assess diagnostic results by comparing the assay results against the predetermined level, and where the predetermined level already has been linked or associated with various clinical parameters (e.g., monitoring whether a subject being treated with a drug has achieved an efficacious blood level of the drug, monitoring the response of a subject receiving treatment for cancer with an anti-cancer drug, monitoring the response of a tumor in a subject receiving treatment for said tumor, etc.).
- the predetermined level may be either an absolute value or a value normalized by subtracting the value obtained from a patient prior to the initiation of therapy.
- a predetermined level that can be used is a baseline level obtained from one or more subjects that may optionally be suffering from one or more diseases or conditions.
- the comparison (or informational analysis) of the level of the assayed biomarker with the baseline or predetermined level can be done by an automated system, such as a software program or intelligence system that is part of, or compatible with, the equipment (e.g., computer platform) on which the assay is carried out. Alternatively, this comparison or informational analysis can be done by a physician. In one embodiment, where the levels remain the same or decrease, the therapy may be effective and can be continued. Where significant increase over baseline level (or predetermined level) occurs, the patient may not be responding. In another embodiment, an increase in shed FOLR1 levels may be indicative of increased cell death and increased release of the shed FOLR1. In this embodiment, an increase in shed FOLR1 is indicative of therapeutic efficacy.
- the assays of the present invention can be performed by any protein assay methods.
- Protein assay methods useful in the invention are well known in the art and include immunoassay methods involving binding of a specific unlabeled or labeled antibody or protein to the expressed protein or fragment of FOLR1.
- Useful immunoassay methods include both solution phase assays conducted using any format known in the art, such as, but not limited to, Biacore, time resolved fluorescence energy transfer (TR-FRET), an ELISA format, (sandwich, forward and reverse competitive inhibition) or a fluorescence polarization format, and solid phase assays such as immunohistochemistry.
- the FOLR1 antibodies and antigen-binding fragments thereof provided herein are particularly useful for these immunoassay methods because, for example, they are able to detect a dynamic range of FOLR1. VII. Circulating Tumor Cell Assays
- CTCs Circulating tumor cells
- CTCs are cells that have shed into the vasculature from a tumor and circulate in the bloodstream. CTCs are present in circulation in extremely low numbers.
- CTCs are enriched from patient blood or plasma by various techniques known in the art.
- CTCs can be stained for specific markers using methods known in the art including, but not limited to, flow cytometry-based methods and IHC-based methods.
- CTCs may be stained for protein markers unique to the tumor cells, which allows for the identification and distinction of CTCs from normal blood cells.
- CTCs can also be stained for FOLR1 using the antibodies provided herein including but not limited to 2.1 , 5.7, and 9.20.
- CTC analysis can also include quantitative analysis of the number of CTCs and/or the number of FOLR1 positive CTCs.
- the FOLR1 antibodies described herein can be used to stain the CTCs isolated from a subject having a cancer to measure the FOLR1 present in the CTCs.
- An increase in FOLR1 expressing CTCs can help identify the subject as having a cancer that is likely to respond to FOLR1 based therapy or allow for optimization of a therapeutic regimen with a FOLR1 antibody or immunoconjugate.
- CTC FOLR1 quantitation can provide information on the stage of tumor, response to therapy and/or disease progression.
- CTCs for FOLR1 can be used as prognostic, predictive or pharmacodynamic biomarker.
- staining of CTCs for FOLR1 using the antibodies provided herein can be used as a liquid biopsy either alone or in combination with additional tumor marker analysis of solid biopsy samples.
- the present invention further provides antibodies against FOLR1, generally of the monoclonal type, that are linked to at least one agent to form a detection antibody conjugate.
- at least one agent to form a detection antibody conjugate.
- it is conventional to link or covalently bind or complex at least one desired molecule or moiety.
- a molecule or moiety may be, but is not limited to, at least one reporter molecule.
- a reporter molecule is defined as any moiety that may be detected using an assay.
- Non-limiting examples of reporter molecules that have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles and/or ligands, such as biotin.
- Certain examples of antibody conjugates are those conjugates in which the antibody or antigen-binding fragment thereof provided herein is linked to a detectable label.
- Detectable labels are compounds and/or elements that can be detected due to their specific functional properties, and/or chemical characteristics, the use of which allows the antibody or antigen-binding fragment to which they are attached to be detected, and/or further quantified if desired.
- imaging agents are known in the art, as are methods for their attachment to antibodies (see, e.g., U.S. Pat. Nos. 5,021,236; 4,938,948; and 4,472,509, each incorporated herein by reference).
- the imaging moieties used can be paramagnetic ions; radioactive isotopes; fluorochromes; NMR-detectable substances; and/or X-ray imaging, for example.
- Exemplary fluorescent labels contemplated for use as binding agent (e.g., antibody) conjugates include Alexa 350, Alexa 430, Alexa 488, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Dylight 488, Fluorescein Isothiocyanate (FITC), Green fluorescent protein (GFP), HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, Phycoerythrin, REG, Rhodamine Green, Rhodamine Red, tetramethyl rhodamin (TMR) Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, Texas Red, and derivatives of these labels (i.e., halogenated analogues, modified with isothiocynate
- Antibody or antigen-binding fragment detection conjugates contemplated in the present invention include those for use in vitro, where the antibody or fragment is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate.
- the FOLR1 antibodies and antigen-binding fragments thereof provided herein are particularly useful for conjugates methods because, for example, they are able to detect a dynamic range of FOLR1.
- suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase and/or glucose oxidase.
- secondary binding ligands are biotin and/or avidin and streptavidin compounds.
- Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter & Haley, 1983).
- 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al, 1985).
- the 2- and 8- azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; and Dholakia et al., 1989) and can be used as antibody binding agents.
- a metal chelate complex employing, for example, an organic chelating agent such as a diethylenetriaminepentaacetic acid anhydride (DTP A); ethylenetriaminetetraacetic acid; N- chloro-p-toluenesulfonamide; and/or tetrachloro-3a-6a-diphenylglycouril-3 attached to the binding agent (e.g., antibody) (U.S. Pat. Nos. 4,472,509 and 4,938,948, each incorporated herein by reference).
- DTP A diethylenetriaminepentaacetic acid anhydride
- ethylenetriaminetetraacetic acid ethylenetriaminetetraacetic acid
- N- chloro-p-toluenesulfonamide N- chloro-p-toluenesulfonamide
- tetrachloro-3a-6a-diphenylglycouril-3 attached to the binding agent (e.g., antibody)
- Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate.
- a coupling agent such as glutaraldehyde or periodate.
- Protein binding (e.g., antibody) conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate.
- imaging of breast tumors is achieved using monoclonal antibodies, and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N- succinimidyl-3 -(4-hydroxyphenyl)propionate .
- derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin using reaction conditions that do not alter the antibody combining site are contemplated.
- Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference).
- Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al, 1987).
- immunoglobulins are radiolabeled with nuclides such as tritium.
- nuclides such as tritium.
- nanogold particles such as sizes from about 0.5 nm-40 nm
- Quantum Dots (Hayward, Calif.) are employed.
- the detection antibody will be either directly labeled, or detected indirectly by addition (after washing off excess detection antibody) of a molar excess of a second, labeled antibody directed against the first antibody.
- the label used for the detection antibody is any detectable functionality that does not interfere with the binding of the FOLR1 antibodies.
- suitable labels are those numerous labels known for use in immunoassay, including moieties that may be detected directly, such as fluorochrome, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes, that must be reacted or derivatized to be detected. Examples of
- such labels include the radioisotopes P, C, I, H, and I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luciferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No.
- luciferin 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, ⁇ -galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, biotin/streptavidin, biotin/Streptavidin-P-galactosidase with MUG, spin labels, bacteriophage labels, stable free radicals, and the like.
- HRP horseradish peroxidase
- labels herein are fluorescent to increase amplification and sensitivity to 8 pg/ml, more preferably biotin with streptavidin- -galactosidase and MUG for amplifying the signal.
- a colorimetric label is used, e.g., where the detectable antibody is biotinylated and the detection means is avidin or streptavidin- peroxidase and 3,3',5,5'-tetramethyl benzidine.
- the amount of bound antibody is determined by removing excess unbound labeled antibody through washing and then measuring the amount of the attached label using a detection method appropriate to the label, and correlating the measured amount with the amount of shed FOLR1 in the biological sample.
- a detection method appropriate to the label for example, in the case of enzymes, the amount of color developed and measured will be a direct measurement of the amount of shed FOLR1 present.
- HRP is the label
- the color can be detected using the substrate 3,3',5,5'-tetramethyl benzidine at 450 nm absorbance.
- HRP horseradish peroxidase
- HRP is an enzyme that first forms a complex with hydrogen peroxide and then causes it to decompose, resulting in water and atomic oxygen. Like many other enzymes, HRP and some HRP-like activities can be inhibited by excess substrate. The complex formed between HRP and excess hydrogen peroxide is catalytically inactive and in the absence of an electron donor (e.g. chromogenic substance) is reversibly inhibited. It is the excess hydrogen peroxide and the absence of an electron donor that brings about quenching of endogenous HRP activities. When used in assay systems, HRP can also be used to convert a defined substrate into its activated chromagen, thus causing a color change.
- an electron donor e.g. chromogenic substance
- the HRP enzyme can be conjugated to an antibody, peptide, polymer, or other molecule by a number of methods that are known in the art. Adding glutaraldehyde to a solution containing an admixture of HRP and antibody will result in more antibody molecules being conjugated to each other than to the enzyme. In the two-step procedure, HRP reacts with the bifunctional reagents first. In the second stage, only activated HRP is admixed with the antibody, resulting in much more efficient labeling and no polymerization. HRP is also conjugated to (strept)avidin using the two-step glutaraldehyde procedure. This form is used in procedures where LAB and LSAB are substrates, for example.
- Conjugation with biotin also involves two steps, as biotin must first be derivatized to the biotinyl-N-hydroxysuccinimide ester or to biotin hydrazide before it can be reacted with the epsilonamino groups of the HRP enzyme.
- DAB 3,3'-diaminobenzidine
- HRP enzymes
- Oxidation of DAB also causes polymerization, resulting in the ability to react with osmium tetroxide, and thus increasing its staining intensity and electron density.
- gold chloride in combination with silver sulfide appears to be the most successful.
- AEC 3-Amino-9-ethylcarbazole
- HRP enzymes
- oxidation forms a rose-red end product that is alcohol soluble. Therefore, specimens processed with AEC must not be immersed in alcohol or alcoholic solutions (e.g., Harris' hematoxylin). Instead, an aqueous counterstain and mounting medium should be used.
- CN 4-Chloro-l-naphthol
- p-Phenylenediamine dihydrochloride/pyrocatechol is a substrate for enzymes such as HRP that gives a blue-black reaction product that is insoluble in alcohol and other organic solvents. Like polymerized DAB, this reaction product can be osmicated. Varying results have been achieved with Hanker-Yates reagent in immunoperoxidase techniques.
- the chief metal activators for AP are Mg++, Mn++ and Ca++.
- AP had not been used extensively in immunohistochemistry until publication of the unlabeled alkaline phosphatase-anti-alkaline phosphatase (APAAP) procedure.
- the soluble immune complexes utilized in this procedure have molecular weights of approximately 560 kD.
- the major advantage of the APAAP procedure compared to the peroxidase anti-peroxidase (PAP) technique is the lack of interference posed by endogenous peroxidase activity. Endogenous peroxidase can be blocked using a dilute solution of hydrogen peroxide. Because of the potential distraction of endogenous peroxidase activity on PAP staining, the APAAP technique is recommended for use on blood and bone marrow smears.
- Endogenous alkaline phosphatase activity from bone, kidney, liver and some white cells can be inhibited by the addition of 1 mM levamisole to the substrate solution, although 5 mM has been found to be more effective. Intestinal alkaline phosphatases are not adequately inhibited by levamisole.
- the enzyme hydrolyzes naphthol phosphate esters (substrate) to phenolic compounds and phosphates.
- the phenols couple to colorless diazonium salts (chromogen) to produce insoluble, colored azo dyes.
- chromogen colorless diazonium salts
- Naphthol AS-MX phosphate AP substrate can be used in its acid form or as the sodium salt.
- the chromogen substrate Fast Red TR and Fast Blue BB produce a bright red or blue end product, respectively. Both are soluble in alcoholic and other organic solvents, so aqueous mounting media must be used. Fast Red TR is preferred when staining cell smears.
- Additional exemplary substrates include naphthol AS-BI phosphate, naphthol
- AS-TR phosphate and 5-bromo-4-chloro-3-indoxyl phosphate BCIP
- Other possible chromogens include Fast Red LB, Fast Garnet GBC, Nitro Blue Tetrazolium (NBT) and iodonitrotetrazolium Violet (INT), for example.
- the present invention concerns immunodetection methods for binding, purifying, removing, quantifying and/or otherwise generally detecting biological components such as a ligand as contemplated by the present invention.
- the antibodies prepared in accordance with the present invention may be employed.
- Some immunodetection methods include immunohistochemistry, flow cytometry, enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few.
- the immunobinding methods include obtaining a sample suspected of comprising ligand protein, polypeptide and/or peptide, and contacting the sample with a first ligand binding agent (e.g., an anti-ligand antibody) in accordance with the present invention, as the case may be, under conditions effective to allow the formation of immunocomplexes .
- a first ligand binding agent e.g., an anti-ligand antibody
- the biological sample analyzed may be any sample in which it is desirable to detect FOLR1 such as fluidic extract, blood, plasma, serum, spinal fluid, lymph fluid, tissue section or specimen, homogenized tissue extract, biopsy aspirates, a cell, separated and/or purified forms FOLR1 -containing compositions, or any biological fluid.
- FOLR1 such as fluidic extract, blood, plasma, serum, spinal fluid, lymph fluid, tissue section or specimen, homogenized tissue extract, biopsy aspirates, a cell, separated and/or purified forms FOLR1 -containing compositions, or any biological fluid.
- blood, plasma, or lymph samples or extracts are used.
- the anti-ligand antibody employed in the detection may itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined.
- the first antibody that becomes bound within the primary immune complexes may be detected by means of a second binding agent that has binding affinity for the antibody.
- the second binding agent may be linked to a detectable label.
- the second binding agent is itself often an antibody, which may thus be termed a "secondary" antibody.
- the primary immune complexes are contacted with the labeled, secondary binding agent, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes.
- the secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
- Further methods include the detection of primary immune complexes by a two-step approach.
- a second binding agent such as an antibody, that has binding affinity for the antibody is used to form secondary immune complexes, as described herein.
- the secondary immune complexes are contacted with a third binding agent or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes).
- the third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system may provide for signal amplification if this is desired.
- a biotinylated monoclonal or polyclonal antibody is used to detect the target antigen(s), and a second step antibody is then used to detect the biotin attached to the complexed biotin.
- the sample to be tested is first incubated in a solution comprising the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex.
- the antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex.
- the amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution comprising the second step antibody against biotin.
- This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate.
- a conjugate can be produced that is macroscopically visible.
- immunohistochemistry is used for immunological detection.
- detection of FOLR1 in a sample can be achieved by targeting a sample with a probe e.g., an anti-FOLRl antibody.
- the probe can be linked, either directly or indirectly to a detectable label or can be detected by another probe that is linked, either directly or indirectly to a detectable label.
- IHC can distinguish between different levels of protein expression, e.g., calibrated IHC. In some embodiments, the IHC can distinguish staining intensity for samples having low FOLR1, intermediate FOLR1, or high FOLR1 expression.
- immunological detection by immunohistochemistry
- FOLR1 is scored for both intensity and uniformity (percent of stained cells - membrane only). Comparative scales for FOLR1 expression for intensity correlate as 0 - Negative, 0-1
- Score 0 represents that no membrane staining is observed.
- Score 1 represents that a faint/barely perceptible membrane staining is detected.
- Score 2 a weak to moderate complete membrane staining is observed.
- Score 3 represents that moderate to complete membrane staining is observed.
- Those samples with 0 or 1 score for FOLRl expression can be characterized as not having elevated FOLRl expression, whereas those samples with 2 or 3 scores can be characterized as overexpressing or having elevated FOLRl .
- those samples with a 0 score for FOLRl expression can be characterized as not having elevated FOLRl expression, those samples with a 1 score can be characterized as having increased expression of FOLRl, and those samples with 2 or 3 scores can be characterized as overexpressing or having elevated FOLRl .
- Samples overexpressing FOLRl can also be rated by immunohisto chemical scores corresponding to the number of copies of FOLRl molecules expressed per cell, or antibodies bound per cell (ABC), and can been determined biochemically.
- immunological detection by immunohistochemistry
- H-scores combine staining intensity scores (e.g., a score of 0 to 3, wherein 0 represents no staining, and 3 represents strong staining) with the percentage of cells that are positive for membrane staining (i.e., uniformity).
- An H-score can be cacluated as follows:
- H score [0* (percentage of cells staining at intensity 0)] + [1 * (percentage of cells staining at intensity 1)] + [2* (percentage of cells staining at intensity 2)] + [3* (percentage of cells staining at intensity 3)]. Accordingly, an H-score can range from 0 (no cell membranes staining) to 300 (all cell membranse staining at intensity 3).
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 50. In one embodiment, a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 75. In one embodiment, a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 100.
- an anti-FOLRl treatment regimen e.g., IMGN853
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 125.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H- score for FOLR expression in a tumor sample from the subject is at least 150.
- a subject having cancer is identified as a candidate for treatment with an anti- FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 175.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 200.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 225.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 250.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is at least 275.
- a subject having cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in a tumor sample from the subject is 300.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is 75 to 300.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 75.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 100.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 125.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 150.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 175.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 200.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 225.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 250.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is at least 275.
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an ovarian tumor sample from the subject is 300.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is 50 to 300.
- a subject having NSCLC is identified as a candidate for treatment with an anti- FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 50.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 75.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 100.
- a subject having NSCLC is identified as a candidate for treatment with an anti- FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 125.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 150.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 175.
- a subject having NSCLC is identified as a candidate for treatment with an anti- FOLR1 regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 200.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 225.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 250.
- a subject having NSCLC is identified as a candidate for treatment with an anti- FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is at least 275.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an NSCLC tumor sample from the subject is 300.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is 50 to 300.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 50.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 75.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 100.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 125.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 150.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 175.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 200.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 225.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 250.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is at least 275.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl regimen (e.g., IMGN853) when the H-score for FOLR expression in an endometrial tumor sample from the subject is 300.
- an H-score in a subject having ovarian cancer may be as follows:
- an H-score in a subject having endometrial cancer may be as follows:
- the subject could be identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853).
- an anti-FOLRl treatment regimen e.g., IMGN853
- immunological detection by immunohistochemistry
- FOLR1 is scored using percent positivity and intensity across a sample.
- selection for treatment with an anti-FOLRl treatment regimen is based on the percentage of cells in a sample that are found to express membrane FOLR1 at a specified level that reflects both the staining intensity (e.g., 1, 2, or 3) and uniformity (e.g., heterogeneous or homogeneous (see Table 11)). For example, a sample having at least 25% (i.e., 25-75%) or > 75%) of the cells staining for FOLR1 positivity at 3 could be characterized as "3 hetero" and "3 homo” or, collectively, as "at least 25% positive at 3.”
- a subject having ovarian cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when at least 25% of the FOLR1 membrane expression in a tumor sample from the subject has an intensity score of 3 by IHC.
- an anti-FOLRl treatment regimen e.g., IMGN853
- the IHC is performed using the FOLR1-2.1 antibody.
- a subject having endometrial cancer is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when at least 25% of the FOLR membrane expression in a tumor sample from the subject has an intensity score of at least 2 by IHC.
- an anti-FOLRl treatment regimen e.g., IMGN853
- the IHC is performed using the FOLR 1-2.1 antibody.
- a subject having NSCLC is identified as a candidate for treatment with an anti-FOLRl treatment regimen (e.g., IMGN853) when at least 25% of the FOLR membrane expression in a tumor sample from the subject has an intensity score of at least 2 by IHC.
- an anti-FOLRl treatment regimen e.g., IMGN853
- the IHC is peformed using the FOLR1-2.1 antibody for IHC.
- IHC can be performed manually or using an automated system (e.g., using an automated stainer). IHC can be performed on cells, cell pellets, tissues, preparations from blood, plasma, serum, or lymph fluid, etc.
- the samples are fixed samples.
- the samples are paraffin embedded samples. In some embodiments, the samples are formalin fixed and paraffin embedded samples.
- flow cytometry is used for immunological detection.
- the number of antibodies bound per cell can be assessed using flow cytometry.
- a high number of anti-FOLRl antibodies bound per cell can indicate high FOLR1 expression levels and a high likelihood to be susceptible to treatment with an anti- FOLRl antibody or immunoconjugate thereof.
- kits for use in the practice of the present invention as disclosed herein.
- kits may comprise containers, each with one or more of the various reagents (typically in concentrated form) utilized in the methods, including, for example, one or more binding agents (antibodies), already attached to a marker or optionally with reagents for coupling a binding agent to an antibody (as well as the marker itself), buffers, and/or reagents and instrumentation for the isolation (optionally by microdissection) to support the practice of the invention.
- a label or indicator describing, or a set of instructions for use of, kit components in a ligand detection method of the present invention will also be typically included, where the instructions may be associated with a package insert and/or the packaging of the kit or the components thereof.
- the present invention concerns immunodetection kits for use with the immunodetection methods described herein.
- the antibodies are generally used to detect FOLRl, he antibodies will generally be included in the kit.
- the immunodetection kits will thus comprise, in suitable container means, a first antibody that binds to FOLRl and/or optionally, an immunodetection reagent and/or further optionally, a FOLRl protein or cell sample containing FOLRl .
- the immunodetection reagents of the kit may take any one of a variety of forms, including those detectable labels that are associated with and/or linked to the given antibody. Detectable labels that are associated with and/or attached to a secondary binding ligand are also contemplated. Exemplary secondary ligands are those secondary antibodies that have binding affinity for the first antibody.
- suitable immunodetection reagents for use in the present kits include the two-component reagent that comprises a secondary antibody that has binding affinity for the first antibody, along with a third antibody that has binding affinity for the second antibody, the third antibody being linked to a detectable label.
- a number of exemplary labels are known in the art and/or all such labels may be suitably employed in connection with the present invention.
- kits may further comprise a therapeutic agent for the treatment of cancer, such as an anti-FOLRl immunoconjugate.
- a therapeutic agent for the treatment of cancer such as an anti-FOLRl immunoconjugate.
- the kit may further comprise an a FOLRl detection reagent used to measure
- the FOLRl detection reagent comprises a FOLRl binding peptide or anti- FOLRl antibody.
- the kit further comprises a secondary antibody which binds the anti- FOLRl antibody.
- the FOLRl -specific antibody is included at a concentration of about 0.1 to about 20 ⁇ g/mL, about 0.1 to about 15 ⁇ g/mL, about 0.1 to about 10 ⁇ g/mL, about 0.5 to about 20 ⁇ g/mL, about 0.5 to about 15 ⁇ g/mL, about 0.5 to about 10 ⁇ g/mL, about 1 to about 20 ⁇ / ⁇ ,, about 1 to about 15 ⁇ / ⁇ ,, about 1 to about 10 ⁇ / ⁇ , about 2 to about 20 ⁇ / ⁇ ,, about 2 to about 15 ⁇ / ⁇ ,, or about 2 to about 10 ⁇ g/mL.
- the FOLRl -specific antibody is included at a concentration of about 1.5 ⁇ / ⁇ ,, about 2 ⁇ g/mL, about 3 ⁇ g/mL, about 4 ⁇ g/mL, about 5 ⁇ /mL, about 6 ⁇ g/mL, about 7 ⁇ g/mL, about 8 ⁇ g/mL, about 9 ⁇ g/mL, or about 10 ⁇ g/mL.
- the FOLRl -specific antibody is included at a concentration of about 2 ⁇ g/mL.
- the FOLRl -specific antibody is included at a concentration of about 10 ⁇ g/mL.
- the antibody is included in concentrated solution with instructions for dilutions to achieve a final concentration of about 1 to about 20 ⁇ g/mL, about 1 to about 15 ⁇ g/mL, about 1 to about 10 ⁇ g/mL, about 2 to about 20 ⁇ g/mL, about 2 to about 15 ⁇ g/mL, or about 2 to about 10 ⁇ g/mL.
- the antibody is included in concentrated solution with instructions for dilutions to achieve a final concentration of about 1.5 ⁇ g/mL, about 2 ⁇ g/mL, about 3 ⁇ g/mL, about 4 ⁇ g/mL, about 5 ⁇ g/mL, about 6 ⁇ g/mL, about 7 ⁇ g/mL, about 8 ⁇ g/mL, about 9 ⁇ / ⁇ , or about 10 ⁇ g/mL.
- the antibody is included in concentrated solution with instructions for dilutions to achieve a final concentration of about 2 ⁇ g/mL.
- the antibody is included in concentrated solution with instructions for dilutions to achieve a final concentration of about 10 ⁇ .
- the kit further comprises a detection reagent selected from the group consisting of: an enzyme, a fluorophore, a radioactive label, and a luminophore.
- the detection reagent is selected from the group consisting of: biotin, digoxigenin, fluorescein, tritium, and rhodamine.
- the kit can also include instructions for detection and scoring of FOLRl expression.
- the kit can also include control or reference samples.
- control or reference samples include cell pellets or tissue culture cell lines derived from normal (normal control) or tumor (positive control) samples.
- Exemplary cell lines include cell lines stably or transiently transfected with an expression vector that expresses FOLRl . Additional examples include cell pellets and tissue samples described in the Examples.
- a kit is a packaged combination including the basic elements of: (a) capture reagents comprised of the monoclonal antibodies against human FOLRl; and (b) detection reagents which can also comprise FOLRl monoclonal antibodies, but can also comprise detectable (labeled or unlabeled) antibodies that bind to FOLRl . These basic elements are defined herein.
- the kit further comprises a solid support for the capture reagents, which can be provided as a separate element or on which the capture reagents are already immobilized. Hence, the capture antibodies in the kit can be immobilized on a solid support, or they can be immobilized on such support that is included with the kit or provided separately from the kit.
- the capture reagent is coated on a microtiter plate.
- the detection reagent can be labeled antibodies detected directly or unlabeled antibodies that are detected by labeled antibodies directed against the unlabeled antibodies raised in a different species.
- the label is an enzyme
- the kit will ordinarily include substrates and co factors required by the enzyme, and where the label is a fluorophore, a dye precursor that provides the detectable chromophore.
- the detection reagent is unlabeled
- the kit can further comprise a detection means for the detectable antibodies, such as the labeled antibodies directed to the unlabeled antibodies, e.g., in a fluorimetric-detected format.
- the kit will ordinarily include substrates and cofactors required by the enzyme, where the label is a fluorophore, a dye precursor that provides the detectable chromophore, and where the label is biotin, an avidin such as avidin, streptavidin, or streptavidin conjugated to HRP or ⁇ -galactosidase with MUG.
- the capture reagent is the FOLRl antibody 2.1, 5.7, or
- the detection reagent is the FOLRl antibody 2.1, 5.7, or 9.20 or an antibody comprising the sequences of antibody 2.1, 5.7 or 9.20.
- the detection reagent is the FOLRl antibody 2.1, 5.7, or 9.20 or an antibody comprising the sequences of antibody 2.1, 5.7 or 9.20.
- the detection reagent FOLRl antibody 2.1, 5.7, or 9.20 or an antibody comprising the sequences of antibody 2.1, 5.7 or 9.20 is biotinylated.
- the kit also typically contains instructions for carrying out the assay, and/or
- FOLRl protein or fragments thereof (e.g., FOLRl extracellular domain or the FOLRl extracellular domain and all or a part of the GPI linkage domain) as an antigen standard, as well as other additives such as stabilizers, washing and incubation buffers, and the like.
- the FOLRl antigen standard is a FOLRl -Fc immunoadhesin.
- the kit can also include instructions for detection and scoring of FOLRl expression.
- the components of the kit can be provided in predetermined ratios, with the relative amounts of the various reagents suitably varied to provide for concentrations in solution of the reagents that substantially maximize the sensitivity of the assay.
- the reagents can be provided as dry powders, usually lyophilized, including excipients, which on dissolution will provide for a reagent solution having the appropriate concentration for combining with the sample to be tested.
- compositions comprising the antibodies or antigen-binding fragments described herein are also provided.
- a composition comprises an anti- FOLR1 antibody or antigen-binding fragment described herein and a buffer, e.g., a buffer that can be used in a detection assay such as FACS, IHC, or ELISA.
- buffers are known to those of ordinary skill in the art and include diluents.
- FACS buffers are provided herein, e.g., in the working examples.
- FACS buffers can also contain, for example, serum or albumin (such as calf serum, goat serum, or BSA) and/or sodium azide.
- FACS buffers can also contain PBS, EDTA, and/or DNAse or any combination thereof.
- IHC buffers are also provided herein and known to those of ordinary skill in the art.
- IHC buffers can contain, for example, casein serum or albumin (such as calf serum, goat serum, or BSA), Tween or Triton, PBS and/or sodium azide or any combination thereof.
- ELISA buffers are also provided herein and known to those of ordinary skill in the art.
- ELISA buffers can contain, for example, serum or albumin (such as calf serum, goat serum, or BSA), non-fat dry milk, casein, and/or gelatin or any combination thereof.
- Embodiments of the present disclosure can be further defined by reference to the following non-limiting examples, which describe in detail preparation of certain antibodies of the present disclosure and methods for using antibodies of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to materials and methods, can be practiced without departing from the scope of the present disclosure.
- Hybridomas producing anti-human FOLRl monoclonal antibodies that are suitable for immunohistochemistry (IHC) staining were selected from more than 16,000 hybridomas.
- the hybridomas were produced by immunization of wild-type Balb/c mice with different antigens including: formalin fixed 300-19 cells that have been transfected with human FOLRl, human FOLRl -murine IgG2a Fc recombinant protein, and human FOLRl recombinant protein.
- the immunization with fixed 300-19 cells was conducted by subcutaneous injection of transfected 300-19 cells in PBS (5E6 cells/mouse/injection) in the absence of any adjuvant.
- mice were immunized five times with two week intervals before receiving a final boost by intraperitoneal injection of the immunogen three days prior to fusion.
- a total of 16 independent fusions were carried out using spleen cells that originated from the immunized wild-type Balb/c mice and murine myeloma P3X63Ag8.653 cells (P3 cells).
- Cell fusion was conducted using an ECM200 electrofusion machine (BTX Harvard Apparatus) according to standard protocols. Each fusion yielded more than 1,000 hybridomas.
- Antibodies produced by these hybridomas were screened and confirmed by a FACS based method using denatured FOLRl -positive and FOLRl -negative cells. Of the greater than 16,000 hybridomas screened, 14 hybridomas that were positive by FACS screening were discovered. All of the positive hybridomas originated from mice immunized with human FOLRl -murine IgG2a Fc recombinant protein.
- FFPE tissue samples were derived from human tissue blocks obtained from
- FFPE cell samples were derived from the KB cell line supplied by American Tissue Culture Collection. Slides containing sections of samples were prepared from FFPE blocks using a microtome set at 5 ⁇ and were mounted on positively charged slides. These slides were allowed to air dry overnight prior to staining.
- Antibody concentrations in hybridoma supernatants were determined by ELISA using anti-murine L-chain specific polyclonal antibody to capture murine monoclonal antibody from supernatant and anti-murine Fc-specific polyclonal antibody to detect the captured antibody; murine monoclonal IgGl sample with know concentration was used as a standard to calculate IgG concentration.
- Cell culture media undiluted was shown not to interfere with IHC staining methods (no background/non-specific staining was noted when media was used in place of the primary antibody).
- a suitable staining concentration was experimentally determined for each of the five candidate clones as follows: 353.1 (0.7 ⁇ g/mL), 353.2 (2.3 ⁇ g/mL), 353.3 (2.3 ⁇ g/mL), 353.5 (2 ⁇ g/mL and 10 ⁇ g/mL), and 353.9 (2 ⁇ g/mL and 10 ⁇ g/mL).
- 353.1 0.7 ⁇ g/mL
- 353.2 2.3 ⁇ g/mL
- 353.3 2.3 ⁇ g/mL
- 353.5 (2 ⁇ g/mL and 10 ⁇ g/mL
- 353.9 2 ⁇ g/mL and 10 ⁇ g/mL
- Clones 352.1, 352.2, and 354.1 exhibited no visible staining in any samples and clone 354.2 exhibited only apparent non-specific cytoplasmic staining, all considered unacceptable.
- IHC characterization of the subclones was performed using methods described above (Table 9: IHC Reagents and Assay Conditions) at antibody concentrations of 2 and 10 ⁇ g/mL.
- the eight subclones were also sequenced as described in Example 3, below.
- the candidate subclones were further evaluated to identify and rank for optimal membrane staining and specificity as follows: [353.2-1, 353.2-12], [353.9-20, 353.9-21], [353.5-7,353.5-10], and [353.3-8, 353.3-9] and were selected for further characterization (subclones are bracketed together according to sequence identity as described in Example 3).
- both antibodies were used to stain human normal lung, human normal salivary gland, human normal pancreas, patient ovarian cancer biopsies, patient non-small cell lung cancer (NSCLC) biopsies, and patient clear cell renal cell carcinoma biopsies.
- NSCLC non-small cell lung cancer
- both subclones exhibited specific and appropriately sensitive staining in both human normal and patient tumor tissues.
- Ducts of pancreas, respiratory epithelium of normal lung, and intercalated ducts exhibited positive membrane associated staining. Acinar cells/islets of pancreas, interalveolar connective tissue of lung, and acinar cells of salivary gland expected to be negative did not exhibit positive staining with either subclone.
- Tumor cells from ovarian cancer, NSCLC, and clear cell renal cell carcinoma samples expected to be positive exhibited positive membrane associated staining that was localized to the tumor cells.
- Tumor substructures expected to be negative stroma, vessels, and lymphocytes
- Additional staining of normal tissues with 353-2.1 are summarized in Table 13, below and shown in Figure 14.
- the IHC characterization data suggests that 353.2-1 and 353.9-20 are specific to FOLR1 in FFPE tissues (see Figure 1 and Figure 2).
- Example 2 As described above in Example 2, of the fourteen hybridoma clones selected based on primary and confirmation FACS screening, ten primary clones were analyzed by immunohistochemistry (IHC) analysis. Of the ten primary clones (i.e., 352.1, 352.2, 353.1, 353.2, 353.3, 353.5, 353.9, 353.15, 354.1, and 354.2), five were positive by IHC (i.e., 353.1, 353.2, and 353.3, 353.5, and 353.9), and all five were derived from the same fusion (fusion 353). Four of the five were successfully subcloned. One subclone of primary clone 353.2 was chosen and named 353.2-1 ("2.1").
- the cells were centrifuged, washed with PBS and incubated for 40 min with FITC-conjugated goat anti-mouse IgG-antibody. The cells were centrifuged again, washed with PBS and resuspended with 0.2 ml of PBS containing 1% formaldehyde. Cell- associated fluorescence was measured using a FACSCalibur flow cytometer with the HTS multiwell and analyzed using CellQuest Pro (BD Biosciences, San Diego, US). As shown on Figure 4, all anti-FOLRl antibodies bound to both denatured and not denatured cells.
- the binding affinity of the anti-FOLRl antibodies was examined by ELISA where recombinant humanFOLRl -murine Fc2a protein was used as the antigen.
- the recombinant protein was immobilized on microtiter plates, and the antibodies were added at a range of concentrations to the plates. The plates were incubated for two hours at room temperature, washed with PBS supplemented with 0.05% Tween-20, and incubated with hrp- labeled goat anti-murine secondary antibody for one hour at room temperature. The plates were washed with PBS/Tween-20 again, and bound hrp-conjugated antibody was detected by adding the hrp-substrate TMB (Bio-FX). Representative results are shown in Figure 5.
- the anti-FOLRl antibodies had similar affinity to human FOLRl at half-maximal effective concentration (EC50) of 0.5 to 0.9 nM.
- FOLRl is a member of Folate Receptor family. Cross-reactivity of the anti-
- FOLRl antibodies with the other members of the family FOLR2 and FOLR3 was assayed by ELISA.
- Recombinant protein FOLR2-His or FOLR3-His (R&D Systems) was immobilized to Ni-NTA plates (QIAGEN) and the anti-FOLRl antibodies were added to the plates and incubated for 2 hours at room temperature.
- the formed antibody-antigen complexes were detected with hrp-labeled goat anti- murine secondary antibody.
- the anti-FOLRl antibodies of the invention did not bind to FOLR2 or FOLR3; only the control antibodies detected corresponding antigens.
- Human FOLR1 has three potential sites for N-glycosylation at positions 69,
- FOLR1 In order to deglycosylate FOLR1 , recombinant human FOLR1 or lysates of FOLR1 -positive KB or Igrov-1 cells were treated with a mixture of deglycosylation enzymes (Enzymatic DeGlycoMX Kit, QA-bio) according to the Manufacturer's protocol. Then, samples of treated and non-treated FOLR1 were used in ELISA and Western blot analysis. For the ELISA, deglycosylated and non-treated FOLR1 were immobilized to ELISA plates (Immulon), and the anti-FOLRl antibodies FRIHC2-1 ("2.1") or huMovl9 were added.
- deglycosylated and non-treated FOLR1 were immobilized to ELISA plates (Immulon), and the anti-FOLRl antibodies FRIHC2-1 ("2.1") or huMovl9 were added.
- Total cellular RNA was prepared from 5 x 10 6 cells of the FOLR1 hybridomas described in Example 1 using an RNeasy kit (QIAgen) according to the manufacturer's protocol.
- cDNA for the eight subclones clones (2.1, 2.12, 3.8, 3.9, 5.7, 5.10, 9.20, and 9.21) was subsequently synthesized from total RNA using the Superscript II cDNA synthesis kit (Invitrogen).
- variable light chain (VL) and variable heavy chain (VH) sequences were amplified by degenerate primers on the 5 'end and either murine kappa or IgGl constant region specific primers respectively on the 3' end.
- the PCR reactions were then run on a 1% low melt agarose gel, followed by the excision of the 300 to 400 bp amplicon bands that were subsequently purified using Zymo DNA mini columns.
- the purified amplicons were sent to Beckman Coulter Genomics for sequencing utilizing the same 5' and 3' primers of the PCR reactions in order to generate the variable region cDNA sequences from both directions.
- variable regions cDNA sequences obtained for each of the anti-FOLRl antibodies were combined with germline constant region sequences to obtain full length antibody cDNA sequences.
- the molecular weights of the heavy and light chains were then calculated from translations of the cDNA sequences and compared with the molecular weights obtained by LC/MS analyses of the purified murine anti-FOLRl antibodies.
- the LC/MS is done by deglycosylating and reducing the antibody to isolate full chain light and heavy chain peptides.
- the observed molecular weights for each of the heavy chains matched the expected, but each of the light chains was off by approximately 85 Da.
- Light chain CDRs 2 and 3 were identical in each of the antibodies suggesting that these tightly conserved CDRs can provide a consistent structural basis for FOLR1 binding.
- the amino acid substitutions in the remaining CDRs, particularly those in heavy chain CDRs 2 and 3 suggest that these positions are critical for refinement of the affinity and specificity of these antibodies.
- the specific residue substitutions in these CDR positions also provide examples of residues that can be incorporated within engineered versions of these antibodies.
- Table 14 provides a composite CDR sequence listing compiled from the anti-FOLRl antibodies of the invention. The composite CDRs identified herein can be used for the design of recombinant antibodies that would be expected to preserve the functional attributes of the anti-FOLRl antibodies of the present invention.
- CDR2 LVSNHFS (SEQ ID NO:25)
- CDR2 WIYP[G/E][S/N][F/V/L]N[V/T][E/R/Q]YN[E/D]KFKA (SEQ ID NO:
- the FRIHC2-1 antibody was humanized following resurfacing methods previously described, such as, for example in Roguska et al, Proc. Natl. Acad. Sci., USA, 91(3):969-973 (1994) and Roguska et al, Protein Eng. 9(10):895-904 (1996), which are incorporated in their entirety herein by reference. Resurfacing involves identification of the variable region framework surface residues in both the light and heavy chains and replacing them with human equivalents. The murine CDRs are preserved in the resurfaced antibody. Exemplary CDRs of FRIHC2-1 antibody are defined as indicated in Table 14.
- lysine 24 and lysine 27 in murine FRIHC2-1 antibody light chain CDRl were replaced with arginine for humanized version 1.0 (shown in italic), so both versions of the LC CDRl are given.
- the table provides exemplary Kabat defined heavy chain CDR2s for both the murine and human versions of FRIHC2-1 antibody. The underlined sequence marks the portion of the Kabat heavy chain CDR2 that was not considered a CDR for resurfacing.
- FRIHC2-1 antibody was also humanized following complementary determining region (CDR) grafting technology (Jones et al, Nature 321 : 604-608 (1986) and Verhoeyen et al, Science 239: 1534-1536 (1988)).
- CDR complementary determining region
- the CDR grafting method consists of grafting the CDRs from a naturally evolved murine antibody onto the Fv framework regions (FRs) of a human antibody.
- the Kabat numbering scheme and Kabat CDR definitions were used for CDR grafting of the FRIHC2-1 antibody.
- Exemplary CDRs of FRIHC2-1 for CDR grafting are given in Table 14.
- the human immunoglobulin germline sequence with the highest homology to the murine FRIHC2-1 antibody was identified through the interactive tool, V- QUEST, of the International ImMunoGeneTics information system® (IMGT (http://imgt.cines.fr ) as described in Lefranc, Nucleic Acids Res. 29: 207-209 (2001).
- IMGT International ImMunoGeneTics information system®
- the human germline sequences used as the acceptor frameworks for the VL and VH domains of FRIHC2-1 antibody were IGKV2D-29*02 and IGHV 1-2*02, respectively.
- Example 6 IHC evaluation of 353-2.1 (FOLR1-2.1) antibody using human tumor samples.
- IHC assay utilizes the OptiView DAB Detection Kit on a Ventana BenchMark XT automated slide stainer for semi-quantitative determination of FOLRl protein expression in formalin- fixed paraffin embedded tissue samples.
- the assay has been optimized and validated with respect to specificity, sensitivity, and precision using normal and tumor tissue controls. Under the optimized condition, sharp membranous staining was clearly observed in tumor cellss whereas normal stromal tissues were completely negative. ( Figure 16).
- this assay also achieved a broader dynamic range thereby allowing better discrimination of moderate staining intensity (level 2, medium brown staining, Figure 17) from the strongest staining intensity (level 3, dark brown staining, Figure 17).
- the enhanced dynamic range improves the ability to rank FOLRl positive samples based on staining intensity and enable further identification a sub-popupation of patients with the highest level of FOLRl expression.
- a BN3.2 (Leica) antibody and the FOLRl-2.1 (FOLRl 353-2.1) antibody were compared using an ovarian cancer tissue micro array (TMA).
- TMA ovarian cancer tissue micro array
- FOLRl-2.1 FOLRl 353-2.1
- FOLRl-2.1 assay allowed futher separation of these 16 samples into 2 different categories: 6 in the highest category (level 3 staining intensity on at least 25% tumor cells, Table 17), and the other 10 in the second highest category (level 2 staining intensity on at least 25% tumor cells, Table 17).
- the more discreet staining obtained with the FOLRl-2.1 antibody in the FOLRl-2.1 assay allows for discrimination among samples all grouped together as samples with level 3 expression using the BN3.2 antibody in the BN3.2 assay.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Organic Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Oncology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
Priority Applications (31)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2016002537A MX371496B (es) | 2013-08-30 | 2014-08-29 | Anticuerpos y ensayos para la detección del receptor 1 de folato. |
| IL244061A IL244061B (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for the detection of folate receptor 1 |
| CN201480054040.2A CN105814079B (zh) | 2013-08-30 | 2014-08-29 | 用于检测叶酸受体1的抗体和测定 |
| RS20211028A RS62240B1 (sr) | 2013-08-30 | 2014-08-29 | Antitela i testovi za detekciju folatnog receptora 1 |
| MYPI2016000388A MY176282A (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| UAA201602669A UA120166C2 (uk) | 2013-08-30 | 2014-08-29 | Антитіло, що специфічно зв'язується з folr1, та спосіб виявлення рецептора фолієвої кислоти 1 |
| EP14839399.4A EP3038650B1 (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| SG11201601037YA SG11201601037YA (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| AU2014312086A AU2014312086B2 (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| CA2921975A CA2921975C (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| KR1020237033676A KR102680356B1 (ko) | 2013-08-30 | 2014-08-29 | 엽산 수용체 1의 검출을 위한 항체 및 분석 |
| HK16110619.2A HK1222402B (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| HRP20211317TT HRP20211317T1 (hr) | 2013-08-30 | 2014-08-29 | Antitijela i analize za detekciju folat receptora 1 |
| ES14839399T ES2883191T3 (es) | 2013-08-30 | 2014-08-29 | Anticuerpos y ensayos para la detección del receptor 1 de folato |
| SM20210471T SMT202100471T1 (it) | 2013-08-30 | 2014-08-29 | Anticorpi e saggi per il rilevamento del recettore 1 del folato |
| JP2016537910A JP2016536330A (ja) | 2013-08-30 | 2014-08-29 | 葉酸受容体1の検出用の抗体及びアッセイ |
| EP21175678.8A EP3925980A1 (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| KR1020167008349A KR102428492B1 (ko) | 2013-08-30 | 2014-08-29 | 엽산 수용체 1의 검출을 위한 항체 및 분석 |
| PL14839399T PL3038650T3 (pl) | 2013-08-30 | 2014-08-29 | Przeciwciała i testy do wykrywania receptora folianu 1 |
| IL293871A IL293871B2 (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for the detection of folate receptor 1 |
| DK14839399.4T DK3038650T3 (da) | 2013-08-30 | 2014-08-29 | Antistoffer og assays til detektering af folatreceptor 1 |
| CN202110062804.4A CN113150145B (zh) | 2013-08-30 | 2014-08-29 | 用于检测叶酸受体1的抗体和测定 |
| KR1020227026363A KR102585409B1 (ko) | 2013-08-30 | 2014-08-29 | 엽산 수용체 1의 검출을 위한 항체 및 분석 |
| BR112016003665-4A BR112016003665B1 (pt) | 2013-08-30 | 2014-08-29 | Anticorpo ou fragmento de ligação ao antígeno do mesmo que se liga especificamente a um epítopo do receptor de folato 1, polinucleotídeo, vetor,célula hospedeira procariótica ou de levedura, composição, seus usos e métodos in vitro para detecção da expressão do receptor de folato 1 e identificação de um câncer |
| RU2016109642A RU2725825C2 (ru) | 2013-08-30 | 2014-08-29 | Антитела и методы анализа для обнаружения рецептора фолиевой кислоты 1 |
| SI201431868T SI3038650T1 (sl) | 2013-08-30 | 2014-08-29 | Protitelesa in preiskave za odkrivanje folatnega receptorja 1 |
| NZ717140A NZ717140A (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
| LTEP14839399.4T LT3038650T (lt) | 2013-08-30 | 2014-08-29 | Antikūnai ir foliatų receptoriaus 1 nustatymo testai |
| AU2020203507A AU2020203507B2 (en) | 2013-08-30 | 2020-05-28 | Antibodies and assays for detection of folate receptor 1 |
| CY20211100715T CY1124428T1 (el) | 2013-08-30 | 2021-08-10 | Αντισωματα και προσδιορισμοι για την ανιχνευση του υποδοχεα φυλλικου οξεος 1 |
| AU2023201965A AU2023201965A1 (en) | 2013-08-30 | 2023-03-30 | Antibodies and assays for detection of folate receptor 1 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361872407P | 2013-08-30 | 2013-08-30 | |
| US61/872,407 | 2013-08-30 | ||
| US201361875475P | 2013-09-09 | 2013-09-09 | |
| US61/875,475 | 2013-09-09 | ||
| US201461940184P | 2014-02-14 | 2014-02-14 | |
| US61/940,184 | 2014-02-14 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015031815A2 true WO2015031815A2 (en) | 2015-03-05 |
| WO2015031815A3 WO2015031815A3 (en) | 2015-05-07 |
Family
ID=52587498
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/053512 Ceased WO2015031815A2 (en) | 2013-08-30 | 2014-08-29 | Antibodies and assays for detection of folate receptor 1 |
Country Status (28)
| Country | Link |
|---|---|
| US (6) | US9637547B2 (https=) |
| EP (2) | EP3925980A1 (https=) |
| JP (5) | JP2016536330A (https=) |
| KR (3) | KR102680356B1 (https=) |
| CN (2) | CN113150145B (https=) |
| AU (3) | AU2014312086B2 (https=) |
| BR (1) | BR112016003665B1 (https=) |
| CA (2) | CA2921975C (https=) |
| CY (1) | CY1124428T1 (https=) |
| DK (1) | DK3038650T3 (https=) |
| ES (1) | ES2883191T3 (https=) |
| HR (1) | HRP20211317T1 (https=) |
| HU (1) | HUE055856T2 (https=) |
| IL (2) | IL244061B (https=) |
| LT (1) | LT3038650T (https=) |
| MX (2) | MX371496B (https=) |
| MY (2) | MY201478A (https=) |
| NZ (1) | NZ717140A (https=) |
| PL (1) | PL3038650T3 (https=) |
| PT (1) | PT3038650T (https=) |
| RS (1) | RS62240B1 (https=) |
| RU (1) | RU2725825C2 (https=) |
| SG (3) | SG10201907501QA (https=) |
| SI (1) | SI3038650T1 (https=) |
| SM (1) | SMT202100471T1 (https=) |
| UA (1) | UA120166C2 (https=) |
| WO (1) | WO2015031815A2 (https=) |
| ZA (1) | ZA201907806B (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016036794A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2017049149A1 (en) | 2015-09-17 | 2017-03-23 | Immunogen, Inc. | Therapeutic combinations comprising anti-folr1 immunoconjugates |
| WO2019050935A1 (en) | 2017-09-05 | 2019-03-14 | Immunogen, Inc. | METHODS OF DETECTING FOLATE RECEPTOR 1 IN A SAMPLE FROM A PATIENT |
| US11396543B2 (en) | 2019-04-29 | 2022-07-26 | Immunogen, Inc. | Biparatopic FR-α antibodies and immunoconjugates |
| US20220298260A1 (en) * | 2019-06-06 | 2022-09-22 | Mythic Therapeutics, Inc. | Antigen-binding protein constructs and uses thereof |
| WO2023116911A1 (zh) | 2021-12-24 | 2023-06-29 | 百奥泰生物制药股份有限公司 | 抗FRα抗体及其抗体药物偶联物和用途 |
| US11873335B2 (en) | 2018-03-13 | 2024-01-16 | Phanes Therapeutics, Inc. | Anti-folate receptor 1 antibodies and uses thereof |
| WO2025036307A1 (zh) | 2023-08-11 | 2025-02-20 | 百奥泰生物制药股份有限公司 | 抗frα抗体药物偶联物在治疗疾病中的应用 |
| WO2025094146A1 (en) | 2023-11-02 | 2025-05-08 | Immunogen Switzerland Gmbh | Vasconstrictors for reducing ocular toxicity of antibody-maytansinoid conjugates |
| EP4499697A4 (en) * | 2022-03-25 | 2026-03-18 | Zymeworks Bc Inc | Anti-alpha folate receptor antibodies and methods of use |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103037900B (zh) | 2010-02-24 | 2016-04-06 | 伊缪诺金公司 | 叶酸受体1抗体与免疫缀合物以及其用途 |
| IL281714B2 (en) | 2011-04-01 | 2023-11-01 | Immunogen Inc | Methods for increasing the effectiveness of FOLR1 cancer therapy |
| HUE049693T2 (hu) | 2012-08-31 | 2020-10-28 | Immunogen Inc | Diagnosztikai ASSAY-k és készletek a folát receptor 1 kimutatására |
| AU2014312086B2 (en) | 2013-08-30 | 2020-03-12 | Immunogen, Inc. | Antibodies and assays for detection of folate receptor 1 |
| IL298044B2 (en) * | 2013-10-08 | 2024-11-01 | Immunogen Inc | Dosing regimens of anti-FOLR1 immunoconjugate |
| RS61010B1 (sr) * | 2014-11-20 | 2020-11-30 | Hoffmann La Roche | Bispecifični antigen vezujući molekuli koji aktiviraju t ćelije protiv folr1 i cd3 |
| WO2016172427A1 (en) * | 2015-04-22 | 2016-10-27 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating trop-2-positive cancer cells |
| CN108152189B (zh) * | 2017-12-06 | 2020-06-05 | 浙江大学 | 一种精子表面出云蛋白1的定量检测方法 |
| EA038215B1 (ru) * | 2018-06-09 | 2021-07-26 | Федеральное государственное бюджетное научное учреждение "Федеральный научный центр исследований и разработки иммунобиологических препаратов им. М.П. Чумакова РАН" | Способ количественного определения антигена вируса желтой лихорадки иммуноферментным анализом с использованием специфических желточных антител и детекторных антител, меченных биотином |
| WO2022093800A2 (en) | 2020-10-27 | 2022-05-05 | Elucida Oncology, Inc. | Carrier particle-drug conjugates, self-immolative linkers, and uses thereof |
| CN112794911B (zh) * | 2021-04-14 | 2021-08-03 | 上海偌妥生物科技有限公司 | 人源化抗叶酸受体1抗体及其应用 |
| IL314452A (en) * | 2022-03-11 | 2024-09-01 | Astrazeneca Ab | Scoring method for anti-frα antibody-drug treatment |
| CN117700557B (zh) * | 2024-02-05 | 2024-04-30 | 卡秋(江苏)生物科技有限公司 | 一种特异性结合叶酸受体α的抗体或抗原结合片段 |
| CN117700556B (zh) * | 2024-02-05 | 2024-04-12 | 苏州百道医疗科技有限公司 | 一种抗FRα小鼠单克隆抗体及其应用 |
Family Cites Families (173)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE2031216A1 (de) | 1969-06-19 | 1971-01-14 | Citizen Watch Co Ltd , Tokio | Tag und Datum Stellvorrichtung fur Uhren mit Kalender |
| US3940475A (en) | 1970-06-11 | 1976-02-24 | Biological Developments, Inc. | Radioimmune method of assaying quantitatively for a hapten |
| NL154598B (nl) | 1970-11-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van laagmoleculire verbindingen en van eiwitten die deze verbindingen specifiek kunnen binden, alsmede testverpakking. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4957939A (en) | 1981-07-24 | 1990-09-18 | Schering Aktiengesellschaft | Sterile pharmaceutical compositions of gadolinium chelates useful enhancing NMR imaging |
| US4472509A (en) | 1982-06-07 | 1984-09-18 | Gansow Otto A | Metal chelate conjugated monoclonal antibodies |
| US4588585A (en) | 1982-10-19 | 1986-05-13 | Cetus Corporation | Human recombinant cysteine depleted interferon-β muteins |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| GB2183661B (en) | 1985-03-30 | 1989-06-28 | Marc Ballivet | Method for obtaining dna, rna, peptides, polypeptides or proteins by means of a dna recombinant technique |
| US6492107B1 (en) | 1986-11-20 | 2002-12-10 | Stuart Kauffman | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US4737456A (en) | 1985-05-09 | 1988-04-12 | Syntex (U.S.A.) Inc. | Reducing interference in ligand-receptor binding assays |
| US4938948A (en) | 1985-10-07 | 1990-07-03 | Cetus Corporation | Method for imaging breast tumors using labeled monoclonal anti-human breast cancer antibodies |
| US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| DE3600905A1 (de) | 1986-01-15 | 1987-07-16 | Ant Nachrichtentech | Verfahren zum dekodieren von binaersignalen sowie viterbi-dekoder und anwendungen |
| US5681718A (en) | 1986-03-14 | 1997-10-28 | Celltech Limited | Methods for enhanced production of tissue plasminogen activator in cell culture using alkanoic acids or salts thereof |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1989006692A1 (en) | 1988-01-12 | 1989-07-27 | Genentech, Inc. | Method of treating tumor cells by inhibiting growth factor receptor function |
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| US20040049014A1 (en) | 1988-12-28 | 2004-03-11 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| CA2016842A1 (en) | 1989-05-16 | 1990-11-16 | Richard A. Lerner | Method for tapping the immunological repertoire |
| CA2016841C (en) | 1989-05-16 | 1999-09-21 | William D. Huse | A method for producing polymers having a preselected activity |
| JPH049249A (ja) | 1990-04-27 | 1992-01-14 | Kusuda:Kk | 塗型剤吹き付け機 |
| US6916605B1 (en) | 1990-07-10 | 2005-07-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| ATE300615T1 (de) | 1990-08-29 | 2005-08-15 | Genpharm Int | Transgene mäuse fähig zur produktion heterologer antikörper |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| CA2405246A1 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with alterred binding properties |
| ES2341666T3 (es) | 1991-12-02 | 2010-06-24 | Medimmune Limited | Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos. |
| EP1291360A1 (en) | 1991-12-13 | 2003-03-12 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| EP1306095A3 (en) | 1992-03-05 | 2003-06-25 | Board Of Regents, The University Of Texas System | Methods and compositions for targeting the vasculature of solid tumors |
| US5965132A (en) | 1992-03-05 | 1999-10-12 | Board Of Regents, The University Of Texas System | Methods and compositions for targeting the vasculature of solid tumors |
| US20030148406A1 (en) | 1992-03-17 | 2003-08-07 | David John King | Multivalent antigen-binding proteins |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| AU691811B2 (en) | 1993-06-16 | 1998-05-28 | Celltech Therapeutics Limited | Antibodies |
| US5432930A (en) | 1993-09-30 | 1995-07-11 | Eagle Crest Limited | System for accessing cobol data files by generating a dictionary of NF.sup.2 |
| NL9302194A (nl) | 1993-12-15 | 1995-07-03 | Nidera Handelscompagnie B V | Werkwijze voor het bereiden van een samengevoegd visprodukt, alsmede visprodukt verkregen onder toepassing van deze werkwijze. |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| DE19526926A1 (de) | 1995-07-24 | 1997-01-30 | Bayer Ag | Verfahren zur Herstellung beladener nichtporöser Trägermaterialien |
| US6696248B1 (en) | 1995-08-18 | 2004-02-24 | Morphosys Ag | Protein/(poly)peptide libraries |
| AU725609C (en) | 1995-08-18 | 2002-01-03 | Morphosys Ag | Protein/(poly)peptide libraries |
| AU7378096A (en) | 1995-09-28 | 1997-04-17 | Alexion Pharmaceuticals, Inc. | Porcine cell interaction proteins |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US6596850B1 (en) | 1998-01-30 | 2003-07-22 | Ixsys, Incorporated | Anti-αv3β3 recombinant human antibodies, nucleic acids encoding same |
| WO2000023082A1 (en) | 1998-10-19 | 2000-04-27 | Yeda Research And Development Co. Ltd. | Treatment of systemic lupus erythematosus by down-regulating the autoimmune response to autoantigens |
| US20040031072A1 (en) | 1999-05-06 | 2004-02-12 | La Rosa Thomas J. | Soy nucleic acid molecules and other molecules associated with transcription plants and uses thereof for plant improvement |
| ATE482275T1 (de) | 1999-07-02 | 2010-10-15 | Morphosys Ag | Erzeugung spezifischer bindungspartner die an von genomischen dns-fragmenten oder ests kodierten (poly)peptiden binden |
| IT1307309B1 (it) | 1999-12-30 | 2001-10-30 | Enea Ente Nuove Tec | Peptidi stabilizzanti, polipeptidi ed anticorpi che li comprendono. |
| PL211872B1 (pl) | 2000-03-31 | 2012-07-31 | Purdue Research Foundation | Kompozycja farmaceutyczna |
| DE10037759A1 (de) | 2000-08-03 | 2002-07-04 | Gruenenthal Gmbh | Screeningverfahren |
| MXPA03007316A (es) | 2001-02-19 | 2003-12-04 | Merck Patent Gmbh | Metodo para la identificacion de epitopes de celulas t y el uso para la preparacion de moleculas con inmunogenicidad reducida. |
| AU2002258518A1 (en) | 2001-03-14 | 2002-09-24 | Millennium Pharmaceuticals, Inc. | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
| CA2445826C (en) | 2001-05-02 | 2014-03-25 | Purdue Research Foundation | Treatment and diagnosis of macrophage mediated disease |
| US7314974B2 (en) | 2002-02-21 | 2008-01-01 | Monsanto Technology, Llc | Expression of microbial proteins in plants for production of plants with improved properties |
| WO2003074704A1 (fr) | 2002-03-01 | 2003-09-12 | Japan Envirochemicals, Ltd. | Proteines capables de se lier aux hormones sexuelles feminines et procede de preparation |
| CN1646160A (zh) * | 2002-03-13 | 2005-07-27 | 拜奥根Idec马萨诸塞公司 | 抗αvβ6抗体 |
| AU2003224073C1 (en) | 2002-04-22 | 2010-03-11 | AgroProtect GmbH | Antibodies, recombinant antibodies, recombinant antibody fragments and fusions mediated plant disease resistance against fungi |
| GB0216648D0 (en) | 2002-07-18 | 2002-08-28 | Lonza Biologics Plc | Method of expressing recombinant protein in CHO cells |
| CA2824167C (en) * | 2002-09-06 | 2018-09-25 | Amgen Inc. | Therapeutic human anti-il-1r1 monoclonal antibody |
| WO2004043989A2 (en) | 2002-11-07 | 2004-05-27 | Medarex, Inc. | Human monoclonal antibodies to heparanase |
| EP1481993A1 (en) | 2003-05-28 | 2004-12-01 | Xerion Pharmaceuticals AG | Modulation of the poliovirus receptor function |
| WO2004082463A2 (en) | 2003-03-17 | 2004-09-30 | Medical College Of Ohio | Folate receptor gene modulation for cancer diagnosis and therapy |
| US20050255114A1 (en) | 2003-04-07 | 2005-11-17 | Nuvelo, Inc. | Methods and diagnosis for the treatment of preeclampsia |
| US20050025763A1 (en) | 2003-05-08 | 2005-02-03 | Protein Design Laboratories, Inc. | Therapeutic use of anti-CS1 antibodies |
| CA2525251C (en) | 2003-05-09 | 2015-10-27 | Duke University | Cd20-specific antibodies and methods employing same |
| KR101424624B1 (ko) | 2003-05-14 | 2014-07-31 | 이뮤노젠 아이엔씨 | 약물 콘쥬게이트 조성물 |
| US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
| ZA200510282B (en) | 2003-07-02 | 2007-03-28 | Genentech Inc | Compositions and methods for the diagnosis and treatment of tumor |
| CA2548942C (en) | 2003-12-05 | 2013-10-15 | Her Majesty The Queen In Right Of Canada As Represented By The Minister Of Health | Anti-sars monoclonal antibodies |
| CA2556027C (en) | 2004-02-12 | 2015-11-24 | Morphotek, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| WO2005075514A2 (en) | 2004-03-10 | 2005-08-18 | Lonza Ltd. | Method for producing antibodies |
| CA2562833A1 (en) | 2004-04-27 | 2005-11-03 | Galapagos N.V. | Methods, agents, and compound screening assays for inducing differentiation of undifferentiated mammalian cells into osteoblasts |
| US20080312425A1 (en) | 2004-08-30 | 2008-12-18 | Lonza Biologics Plc. | Ion Exchange Chromatography and Purification of Antibodies |
| US7776869B2 (en) | 2004-10-18 | 2010-08-17 | Amgen Inc. | Heteroaryl-substituted alkyne compounds and method of use |
| US7780963B2 (en) | 2004-10-25 | 2010-08-24 | Merck & Co., Inc. | Anti-ADDL antibodies and uses thereof |
| AU2005337132B2 (en) | 2004-12-21 | 2011-01-20 | Monsanto Technology, Llc | Transgenic plants with enhanced agronomic traits |
| US20090087478A1 (en) | 2004-12-27 | 2009-04-02 | Progenics Pharmaceuticals (Nevada), Inc. | Orally Deliverable and Anti-Toxin Antibodies and Methods for Making and Using Them |
| BRPI0518994A2 (pt) | 2004-12-31 | 2008-12-02 | Biogen Idec Inc | anticorpos ou polipeptÍdeos que se ligam a br3, seus usos e formulaÇÕes lÍquidas |
| US7700738B2 (en) | 2005-01-27 | 2010-04-20 | The Regents Of The University Of California | Therapeutic monoclonal antibodies that neutralize botulinum neurotoxins |
| US7608413B1 (en) | 2005-03-25 | 2009-10-27 | Celera Corporation | Kidney disease targets and uses thereof |
| AU2006230099B2 (en) | 2005-03-25 | 2012-04-19 | Gitr, Inc. | GITR binding molecules and uses therefor |
| ATE460668T1 (de) | 2005-03-30 | 2010-03-15 | Purdue Research Foundation | Verfahren zur prognose von brustkrebs mittels quantifizierung von zellulären folat vitamin rezeptoren |
| EP2172487A1 (en) | 2005-04-22 | 2010-04-07 | Morphotek Inc. | Antibodies with Immune Effector Activity that Internalize in Folate Receptor Alpha-Positive Cells |
| US7786266B2 (en) | 2005-05-12 | 2010-08-31 | Oncotherapy Science, Inc. | Methods for damaging cells using effector function of anti-DSC2 antibody |
| WO2006122822A2 (en) | 2005-05-20 | 2006-11-23 | Lonza Biologics Plc. | High-level expression of recombinant antibody in a mammalian host cell |
| MX2007014673A (es) | 2005-05-24 | 2008-04-08 | Avestha Gengraine Tech Pvt Ltd | Metodo para la produccion de un anticuerpo monoclonal para cd20 para el tratamiento de linfoma de celular b. |
| US20070009434A1 (en) | 2005-07-05 | 2007-01-11 | Low Philip S | Imaging and therapeutic method using monocytes |
| US7521195B1 (en) | 2005-07-21 | 2009-04-21 | Celera Corporation | Lung disease targets and uses thereof |
| CA2619725C (en) | 2005-08-18 | 2016-06-07 | Ramot At Tel Aviv University Ltd. | Single chain antibodies against beta-amyloid peptide |
| JP4938263B2 (ja) * | 2005-08-19 | 2012-05-23 | 独立行政法人農業生物資源研究所 | 一本鎖抗体によるサイトゾルタンパク質の機能阻害法およびその利用 |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| EP3190125A1 (en) | 2005-08-31 | 2017-07-12 | Merck Sharp & Dohme Corp. | Engineered anti-il-23 antibodies |
| AU2006291990B2 (en) | 2005-09-13 | 2012-05-31 | National Research Council Of Canada | Methods and compositions for modulating tumor cell activity |
| CA2625403A1 (en) | 2005-10-17 | 2007-04-26 | Institute For System Biology | Tissue-and serum-derived glycoproteins and methods of their use |
| EP1790664A1 (en) | 2005-11-24 | 2007-05-30 | Ganymed Pharmaceuticals AG | Monoclonal antibodies against claudin-18 for treatment of cancer |
| HRP20130494T1 (en) | 2005-12-20 | 2013-08-31 | Sbi Biotech Co., Ltd. | Anti-ilt7 antibody |
| MX2008012023A (es) | 2006-03-21 | 2008-10-01 | Wyeth Corp | Metodos para prevenir y tratar enfermedades amiloidogenicas. |
| US8486412B2 (en) | 2006-06-01 | 2013-07-16 | Mayo Foundation For Medical Education And Research | Immunity to folate receptors |
| CA2655933C (en) | 2006-06-23 | 2014-09-09 | Alethia Biotherapeutics Inc. | Polynucleotides and polypeptide sequences involved in cancer |
| US7910702B2 (en) | 2006-07-28 | 2011-03-22 | The Governors Of The University Of Alberta | Recombinant antibodies to sclerotinia antigens |
| EP2520935A3 (en) | 2006-08-09 | 2013-02-13 | Homestead Clinical Corporation | Organ-specific proteins and methods of their use |
| CA2914170C (en) * | 2006-09-08 | 2018-10-30 | Abbvie Bahamas Ltd. | Interleukin-13 binding proteins |
| EP1900752A1 (en) | 2006-09-15 | 2008-03-19 | DOMPE' pha.r.ma s.p.a. | Human anti-folate receptor alpha antibodies and antibody fragments for the radioimmunotherapy of ovarian carcinoma |
| MY162056A (en) | 2006-10-12 | 2017-05-31 | Univ Tokyo | Diagnosis and treatment of cancer using anti -ereg antibody |
| JP5632582B2 (ja) | 2006-12-14 | 2014-11-26 | 中外製薬株式会社 | 抗Claudin3モノクローナル抗体およびそれを用いる癌の治療および診断 |
| BRPI0720565A2 (pt) | 2006-12-20 | 2013-09-17 | Mmr Information Systems Inc | anticorpos e mÉtodos para a sua preparaÇço e seu uso |
| US20080227704A1 (en) | 2006-12-21 | 2008-09-18 | Kamens Joanne S | CXCL13 binding proteins |
| US7691980B2 (en) | 2007-01-09 | 2010-04-06 | Bio-Rad Laboratories, Inc. | Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers |
| EP2604284A1 (en) | 2007-02-16 | 2013-06-19 | KTB Tumorforschungsgesellschaft mbH | Receptor And Antigen Targeted Prodrug |
| WO2008101231A2 (en) | 2007-02-16 | 2008-08-21 | Endocyte, Inc. | Methods and compositions for treating and diagnosing kidney disease |
| EP2426145B1 (en) * | 2007-02-23 | 2017-01-18 | Merck Sharp & Dohme Corp. | Engineered anti-il-23p19 antibodies |
| US7915368B2 (en) * | 2007-05-23 | 2011-03-29 | Bridgestone Corporation | Method for making alkoxy-modified silsesquioxanes |
| WO2008145136A1 (en) | 2007-05-30 | 2008-12-04 | Aarhus Universitet | Stat3 inactivation by inhibition of the folate receptor pathway |
| BRPI0812970A2 (pt) | 2007-06-25 | 2019-09-24 | Endocyte Inc | conjugados contendo espaçadores hidrofílicos |
| CN101139613B (zh) | 2007-08-01 | 2011-06-08 | 姜荣锡 | 抗肿瘤二元多肽及其应用与制备方法 |
| EP2231708B1 (en) | 2007-12-12 | 2015-04-08 | Pincell Srl | Remedies for pemphigus containing anti-fas ligand antibodies |
| JP5660900B2 (ja) | 2007-12-21 | 2015-01-28 | ノバルティス アーゲー | 有機化合物 |
| CN101918450A (zh) | 2008-01-11 | 2010-12-15 | 国立大学法人东京大学 | 抗cldn6抗体 |
| EP2275431A3 (en) | 2008-01-18 | 2011-05-25 | Bio-Rad Laboratories, Inc. | Enhanced fractionation of phosphorylated and nonphosphorylated biomolecules by apatite chromotography |
| JP5470817B2 (ja) | 2008-03-10 | 2014-04-16 | 日産自動車株式会社 | 電池用電極およびこれを用いた電池、並びにその製造方法 |
| WO2009132081A2 (en) | 2008-04-24 | 2009-10-29 | The Research Foundation Of State University Of New York | Monoclonal antibody-based targeting of folate receptors |
| EP2276506A4 (en) | 2008-04-30 | 2014-05-07 | Immunogen Inc | EFFICIENT CONJUGATES AND HYDROPHILIC BINDER |
| KR20200058590A (ko) | 2008-04-30 | 2020-05-27 | 이뮤노젠 아이엔씨 | 가교제 및 그 용도 |
| US8383351B2 (en) | 2008-06-11 | 2013-02-26 | Oxford Brookes University | Antibody to inhibin/ activin β-B subunit |
| AU2009293140A1 (en) | 2008-09-17 | 2010-03-25 | Endocyte, Inc. | Folate receptor binding conjugates of antifolates |
| US20100092470A1 (en) | 2008-09-22 | 2010-04-15 | Icb International, Inc. | Antibodies, analogs and uses thereof |
| CN101440130B (zh) | 2008-11-21 | 2011-07-27 | 中国人民解放军第四军医大学 | 一种抗人IL-13Rα2单克隆抗体的重链和轻链的可变区 |
| WO2010080345A1 (en) | 2008-12-19 | 2010-07-15 | Graceway Pharmaceuticals, Llc | Lower dosage strength imiquimod formulations and short dosing regimens for treating actinic keratosis |
| AU2010229924B2 (en) | 2009-03-24 | 2016-07-21 | Plus Therapeutics Inc. | Devices and methods of cell capture and analysis |
| ES2624835T3 (es) | 2009-08-06 | 2017-07-17 | Immunas Pharma, Inc. | Anticuerpos que se unen específicamente a los oligómeros A beta y uso de los mismos |
| WO2011042548A1 (en) | 2009-10-09 | 2011-04-14 | Sanofi-Aventis | Polypeptides for binding to the "receptor for advanced glycation endproducts" as well as compositions and methods involving the same |
| TW201129383A (en) | 2010-02-10 | 2011-09-01 | Immunogen Inc | CD20 antibodies and uses thereof |
| CN103037900B (zh) | 2010-02-24 | 2016-04-06 | 伊缪诺金公司 | 叶酸受体1抗体与免疫缀合物以及其用途 |
| AR080795A1 (es) | 2010-03-24 | 2012-05-09 | Genentech Inc | Anticuerpos anti-lrp6 (proteina relacionada con el receptor ldl tipo 6) |
| US20120164137A1 (en) | 2010-10-20 | 2012-06-28 | Morphotek, Inc. | Anti-folate receptor alpha antibody glycoforms |
| AU2011323124C1 (en) | 2010-11-05 | 2016-09-22 | Eisai Inc. | Folate receptor alpha as a diagnostic and prognostic marker for folate receptor alpha-expressing cancers |
| MX2013011201A (es) | 2011-03-29 | 2013-12-16 | Immunogen Inc | Proceso para la elaboracion de conjugados de mejor homogeneidad. |
| RS58367B1 (sr) | 2011-03-29 | 2019-03-29 | Immunogen Inc | Priprema konjugata antitela i majtanzinoida jednostepenim postupkom |
| IL281714B2 (en) * | 2011-04-01 | 2023-11-01 | Immunogen Inc | Methods for increasing the effectiveness of FOLR1 cancer therapy |
| US20120282282A1 (en) | 2011-04-04 | 2012-11-08 | Immunogen, Inc. | Methods for Decreasing Ocular Toxicity of Antibody Drug Conjugates |
| WO2012145112A2 (en) | 2011-04-18 | 2012-10-26 | Immunogen, Inc. | Novel maytansinoid derivatives with sulfoxide linker |
| EP2524929A1 (en) | 2011-05-17 | 2012-11-21 | Sanofi | Use of anti-CD19 maytansinoid immunoconjugate antibody for the treatment of CD19+ B-cell malignancies syptoms |
| PL2731972T3 (pl) | 2011-07-15 | 2018-06-29 | Eisai R&D Management Co., Ltd. | Przeciwciała skierowane przeciwko receptorowi folianowemu alfa i ich zastosowania |
| HUE049693T2 (hu) | 2012-08-31 | 2020-10-28 | Immunogen Inc | Diagnosztikai ASSAY-k és készletek a folát receptor 1 kimutatására |
| WO2014055842A1 (en) | 2012-10-04 | 2014-04-10 | Immunogen, Inc. | Process for preparing stable antibody maytansinoid conjugates |
| JP6136279B2 (ja) | 2013-01-15 | 2017-05-31 | 株式会社ジェイテクト | 転がり軸受装置 |
| TWI503850B (zh) | 2013-03-22 | 2015-10-11 | Polytronics Technology Corp | 過電流保護元件 |
| CA2911499A1 (en) | 2013-05-14 | 2014-11-20 | Immunogen, Inc. | Anti-folr1 immunoconjugate dosing regimens |
| WO2015026909A2 (en) | 2013-08-23 | 2015-02-26 | Nuclea Biotechnologies, Inc. | Msia-srm assay for biomarker analysis |
| AU2014312086B2 (en) | 2013-08-30 | 2020-03-12 | Immunogen, Inc. | Antibodies and assays for detection of folate receptor 1 |
| TWI510996B (zh) | 2013-10-03 | 2015-12-01 | Acer Inc | 控制觸控面板的方法以及使用該方法的可攜式電腦 |
| IL298044B2 (en) | 2013-10-08 | 2024-11-01 | Immunogen Inc | Dosing regimens of anti-FOLR1 immunoconjugate |
| US20150297744A1 (en) | 2014-03-28 | 2015-10-22 | Immunogen, Inc. | Anti-FOLR1 Immunoconjugate Dosing Regimens |
| CN107110840A (zh) | 2014-07-01 | 2017-08-29 | 爱科谱迅病理研究公司 | 针对化疗靶标的srm测定 |
| CN106999604B (zh) | 2014-09-02 | 2021-08-03 | 伊缪诺金公司 | 用于配制抗体药物缀合物组合物的方法 |
| AU2016323968B2 (en) | 2015-09-17 | 2023-07-06 | Immunogen, Inc. | Therapeutic combinations comprising anti-FOLR1 immunoconjugates |
| ES2716900T3 (es) | 2015-11-06 | 2019-06-17 | Promise Advanced Proteomics | Un método para cuantificar anticuerpos anti-TNF |
| US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
| SG11202001348WA (en) | 2017-09-05 | 2020-03-30 | Immunogen Inc | Methods for detection of folate receptor 1 in a patient sample |
| JP2020534332A (ja) | 2017-09-22 | 2020-11-26 | イミュノジェン, インコーポレイテッド | カチオン交換クロマトグラフィーを使用した三重軽鎖抗体の分離 |
| MA51629A (fr) | 2018-01-12 | 2020-11-18 | Immunogen Inc | Procédés de production, purification et formulation de conjugués anticorps-médicaments |
| WO2020223221A1 (en) | 2019-04-29 | 2020-11-05 | Immunogen, Inc. | Biparatopic fr-alpha antibodies and immunoconjugates |
-
2014
- 2014-08-29 AU AU2014312086A patent/AU2014312086B2/en active Active
- 2014-08-29 KR KR1020237033676A patent/KR102680356B1/ko active Active
- 2014-08-29 RU RU2016109642A patent/RU2725825C2/ru active
- 2014-08-29 CN CN202110062804.4A patent/CN113150145B/zh active Active
- 2014-08-29 CN CN201480054040.2A patent/CN105814079B/zh active Active
- 2014-08-29 CA CA2921975A patent/CA2921975C/en active Active
- 2014-08-29 MY MYPI2019004230A patent/MY201478A/en unknown
- 2014-08-29 SG SG10201907501Q patent/SG10201907501QA/en unknown
- 2014-08-29 CA CA3222465A patent/CA3222465A1/en active Pending
- 2014-08-29 JP JP2016537910A patent/JP2016536330A/ja active Pending
- 2014-08-29 SM SM20210471T patent/SMT202100471T1/it unknown
- 2014-08-29 US US14/473,828 patent/US9637547B2/en active Active
- 2014-08-29 IL IL244061A patent/IL244061B/en unknown
- 2014-08-29 EP EP21175678.8A patent/EP3925980A1/en not_active Withdrawn
- 2014-08-29 RS RS20211028A patent/RS62240B1/sr unknown
- 2014-08-29 PL PL14839399T patent/PL3038650T3/pl unknown
- 2014-08-29 SG SG11201601037YA patent/SG11201601037YA/en unknown
- 2014-08-29 MX MX2016002537A patent/MX371496B/es active IP Right Grant
- 2014-08-29 SI SI201431868T patent/SI3038650T1/sl unknown
- 2014-08-29 ES ES14839399T patent/ES2883191T3/es active Active
- 2014-08-29 SG SG10202100275TA patent/SG10202100275TA/en unknown
- 2014-08-29 MY MYPI2016000388A patent/MY176282A/en unknown
- 2014-08-29 BR BR112016003665-4A patent/BR112016003665B1/pt active IP Right Grant
- 2014-08-29 IL IL293871A patent/IL293871B2/en unknown
- 2014-08-29 UA UAA201602669A patent/UA120166C2/uk unknown
- 2014-08-29 NZ NZ717140A patent/NZ717140A/en unknown
- 2014-08-29 LT LTEP14839399.4T patent/LT3038650T/lt unknown
- 2014-08-29 PT PT148393994T patent/PT3038650T/pt unknown
- 2014-08-29 KR KR1020227026363A patent/KR102585409B1/ko active Active
- 2014-08-29 EP EP14839399.4A patent/EP3038650B1/en active Active
- 2014-08-29 WO PCT/US2014/053512 patent/WO2015031815A2/en not_active Ceased
- 2014-08-29 DK DK14839399.4T patent/DK3038650T3/da active
- 2014-08-29 HR HRP20211317TT patent/HRP20211317T1/hr unknown
- 2014-08-29 KR KR1020167008349A patent/KR102428492B1/ko active Active
- 2014-08-29 HU HUE14839399A patent/HUE055856T2/hu unknown
-
2016
- 2016-02-26 MX MX2020001160A patent/MX2020001160A/es unknown
-
2017
- 2017-03-29 US US15/473,008 patent/US10017578B2/en active Active
-
2018
- 2018-06-07 US US16/002,364 patent/US10544230B2/en active Active
- 2018-12-03 JP JP2018226360A patent/JP6983746B2/ja active Active
-
2019
- 2019-11-21 ZA ZA2019/07806A patent/ZA201907806B/en unknown
- 2019-12-09 US US16/707,940 patent/US11198736B2/en active Active
-
2020
- 2020-05-28 AU AU2020203507A patent/AU2020203507B2/en active Active
- 2020-11-05 JP JP2020185082A patent/JP2021035968A/ja not_active Withdrawn
-
2021
- 2021-08-10 CY CY20211100715T patent/CY1124428T1/el unknown
- 2021-11-10 US US17/523,126 patent/US11932701B2/en active Active
-
2022
- 2022-12-27 JP JP2022210118A patent/JP7554252B2/ja active Active
-
2023
- 2023-03-30 AU AU2023201965A patent/AU2023201965A1/en not_active Abandoned
-
2024
- 2024-02-15 US US18/442,906 patent/US20240360240A1/en active Pending
- 2024-04-11 JP JP2024063894A patent/JP2024095796A/ja active Pending
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11732038B2 (en) | 2014-09-03 | 2023-08-22 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2016036794A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2017049149A1 (en) | 2015-09-17 | 2017-03-23 | Immunogen, Inc. | Therapeutic combinations comprising anti-folr1 immunoconjugates |
| US10172875B2 (en) | 2015-09-17 | 2019-01-08 | Immunogen, Inc. | Therapeutic combinations comprising anti-FOLR1 immunoconjugates |
| US11033564B2 (en) | 2015-09-17 | 2021-06-15 | Immunogen, Inc. | Therapeutic combinations comprising anti-FOLR1 immunoconjugates |
| WO2019050935A1 (en) | 2017-09-05 | 2019-03-14 | Immunogen, Inc. | METHODS OF DETECTING FOLATE RECEPTOR 1 IN A SAMPLE FROM A PATIENT |
| EP3679371A4 (en) * | 2017-09-05 | 2021-06-16 | Immunogen, Inc. | METHOD OF DETECTING FOLATE RECEPTOR 1 IN A PATIENT SAMPLE |
| US11873335B2 (en) | 2018-03-13 | 2024-01-16 | Phanes Therapeutics, Inc. | Anti-folate receptor 1 antibodies and uses thereof |
| US11396543B2 (en) | 2019-04-29 | 2022-07-26 | Immunogen, Inc. | Biparatopic FR-α antibodies and immunoconjugates |
| US11834498B2 (en) | 2019-04-29 | 2023-12-05 | Immunogen, Inc. | Biparatopic FR-alpha antibodies and immunoconjugates |
| US20220298260A1 (en) * | 2019-06-06 | 2022-09-22 | Mythic Therapeutics, Inc. | Antigen-binding protein constructs and uses thereof |
| WO2023116911A1 (zh) | 2021-12-24 | 2023-06-29 | 百奥泰生物制药股份有限公司 | 抗FRα抗体及其抗体药物偶联物和用途 |
| EP4499697A4 (en) * | 2022-03-25 | 2026-03-18 | Zymeworks Bc Inc | Anti-alpha folate receptor antibodies and methods of use |
| WO2025036307A1 (zh) | 2023-08-11 | 2025-02-20 | 百奥泰生物制药股份有限公司 | 抗frα抗体药物偶联物在治疗疾病中的应用 |
| WO2025094146A1 (en) | 2023-11-02 | 2025-05-08 | Immunogen Switzerland Gmbh | Vasconstrictors for reducing ocular toxicity of antibody-maytansinoid conjugates |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11932701B2 (en) | Method for increasing the efficacy of cancer therapy by administering an anti-FOLR1 immunoconjugate | |
| HK40066018A (en) | Antibodies and assays for detection of folate receptor 1 | |
| HK1222402B (en) | Antibodies and assays for detection of folate receptor 1 | |
| NZ756675A (en) | Antibodies and assays for detection of folate receptor 1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14839399 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 244061 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2921975 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016537910 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/002537 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016003665 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2014312086 Country of ref document: AU Date of ref document: 20140829 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201602669 Country of ref document: UA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IDP00201602081 Country of ref document: ID |
|
| ENP | Entry into the national phase |
Ref document number: 20167008349 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2016109642 Country of ref document: RU Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2014839399 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014839399 Country of ref document: EP |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14839399 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112016003665 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160222 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 293871 Country of ref document: IL |