WO2014208987A1 - 안정성이 개선된 항체-약물 결합체 및 이의 용도 - Google Patents

안정성이 개선된 항체-약물 결합체 및 이의 용도 Download PDF

Info

Publication number
WO2014208987A1
WO2014208987A1 PCT/KR2014/005589 KR2014005589W WO2014208987A1 WO 2014208987 A1 WO2014208987 A1 WO 2014208987A1 KR 2014005589 W KR2014005589 W KR 2014005589W WO 2014208987 A1 WO2014208987 A1 WO 2014208987A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
drug
drug conjugate
mmaf
conjugate
Prior art date
Application number
PCT/KR2014/005589
Other languages
English (en)
French (fr)
Inventor
김영민
고민지
김재용
김주희
문경덕
송대해
엄재현
정진원
Original Assignee
한화케미칼 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한화케미칼 주식회사 filed Critical 한화케미칼 주식회사
Priority to EP14817162.2A priority Critical patent/EP3015116B1/en
Priority to CN201480035895.0A priority patent/CN105377307B/zh
Priority to BR112015032200A priority patent/BR112015032200A2/pt
Priority to AU2014299561A priority patent/AU2014299561B2/en
Priority to JP2016523642A priority patent/JP6208864B2/ja
Priority to RU2016102116A priority patent/RU2670748C9/ru
Priority to CA2916202A priority patent/CA2916202C/en
Priority to US14/898,126 priority patent/US10071170B2/en
Publication of WO2014208987A1 publication Critical patent/WO2014208987A1/ko
Priority to US16/059,761 priority patent/US20180360986A1/en

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6891—Pre-targeting systems involving an antibody for targeting specific cells
    • A61K47/6899—Antibody-Directed Enzyme Prodrug Therapy [ADEPT]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817—Toxins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present invention relates to an antibody-drug conjugate in which a drug is bound to an N-terminal amino acid residue of a heavy or light chain of the antibody, a method for preparing the same, and a use thereof.
  • ADCs antibody-drug conjugates
  • antibody-drug conjugates generally have a disadvantage of lower stability in vivo than natural antibodies, but have been developed to improve the low therapeutic effect, which is a disadvantage of natural antibodies, by combining with drugs.
  • Drugs having specific effects, such as cytotoxins have been developed in various forms, and in particular, methods for inducing cancer cell death by combining cytotoxins with cancer cell specific antibodies are currently commercially available.
  • DAR when the expression level of cancer cell surface antigen is low, in order to maintain high cytotoxicity, DAR should be maintained as high as possible.However, when DAR reaches 8, the half-life in the blood is reduced due to the effect of hydrophobic drugs bound to the antibody. Has the disadvantage of increasing and decreasing in vivo efficacy.
  • the present inventors have made diligent efforts to develop an antibody-drug conjugate which can maintain the antigen-binding ability of the parent antibody equally and exhibit excellent anti-cancer effect while being less toxic by the drug and having excellent in vivo efficacy.
  • the drug when the drug is bound to the N-terminus of the heavy or light chain of the antibody, the present invention was completed by finding out that it has excellent blood stability and anticancer activity while having less toxicity in vivo compared to the previously reported antibody-drug conjugate. It was.
  • One object of the present invention is to provide an antibody-drug conjugate in which a drug is bound to a heavy or light chain N-terminal amino acid residue of the antibody.
  • Another object of the present invention is to provide a method for preparing the antibody-drug conjugate.
  • Still another object of the present invention is to provide a method for treating autoimmune disease, comprising administering the antibody-drug conjugate to a subject suspected of autoimmune disease.
  • Another object of the present invention is to provide a method for selecting an antibody suitable for preparation with the antibody-drug conjugate.
  • the method for preparing the antibody-drug conjugate of the present invention it is possible to prepare the antibody-drug conjugate having higher in vivo efficacy, stability and low toxicity.
  • MMAF Monomethyl Auristatin F
  • Figure 2 is a schematic view showing the structure of the homogeneous non-engineered monoclonal antibody-cytotoxin conjugate, the number and position of the binding.
  • Fig. 3 shows the LC / MS profile of T-N-MMAF.
  • Figure 4 is a diagram showing the results confirmed by peptide mapping the drug binding position in the prepared Trastzumab-N-MMAF (T-N-MMAF conjugate).
  • Figure 5 is a diagram showing the SEC-HPLC chromatogram results of the prepared T-N-MMAF.
  • FIG. 8 is a graph showing the results of comparing PK profiles of total / conjugate for each ADC.
  • Figure 9 shows tumor growth curves formed by HCC1954 cell line in nude rat xenograft models.
  • FIG. 10 is a diagram showing survival curves in a nude rat xenograft model experiment in which tumor size was set as an endpoint.
  • FIG. 11 is a diagram showing changes in body weight and relative changes according to the administration of each ADC.
  • FIG. 12 is a view showing the results of confirming the hepatotoxicity according to the administration of each ADC.
  • FIG. 13 is a diagram showing changes in neutrophils and platelets according to the administration of each ADC.
  • Fig. 14 shows the results of T-N-MMAE LC / MS analysis.
  • Fig. 15 shows the Rat PK profile of T-N-MMAE.
  • Fig. 16 shows the LC / MS profile of Brentuximab-N-MMAF (B-N-MMAF).
  • Fig. 17 shows the results of analyzing the antigen binding ability of B-N-MMAF.
  • Fig. 18 shows the conjugation profile of Lorvotuzumab-N-MMAF (L-N-MMAF).
  • Fig. 19 shows the antigen binding force of L-N-MMAF.
  • the present invention provides antibody-drug conjugates in which the drug is bound to the heavy or light chain N-terminal amino acid residues of the antibody.
  • the term “antibody-drug conjugate (ADC)” refers to a form in which the drug and the antibody are chemically linked without lowering the biological activity of the antibody and the drug.
  • the antibody-drug conjugate is a form in which the drug is bound to the N-terminal amino acid residue of the heavy chain and / or light chain of the antibody, specifically, the drug is attached to the N-terminal ⁇ -amine group of the heavy or / and light chain of the antibody. The combined form.
  • an antibody-drug conjugate formed by a previously reported cysteine bond, an antibody-drug conjugate formed by a thiol bond, and lysine Compared with the antibody-drug conjugate formed by the binding, it is confirmed that both the efficacy and stability in vivo are excellent and less toxic, so that the N-terminus of the heavy or light chain of the antibody has all the advantages of efficacy, stability and low toxicity. It can be identified.
  • a schematic diagram of such an antibody-drug conjugate according to the present invention is shown in FIG. 2.
  • N-terminus refers to the amino terminus, ie, the N-terminus, of the heavy or light chain of an antibody, and refers to a position capable of binding a drug for the purposes of the present invention. Examples include, but are not limited to, the amino acid residues at or near the N-terminus as well as the amino acid residues at the N-terminus, specifically the first amino acid residue of the heavy or light chain of the antibody, and more. Specifically, it refers to the ⁇ -amine group of the first amino acid of the heavy or light chain of the antibody, but is not limited thereto.
  • the antibody-drug conjugates of the present invention may have the advantage of ensuring homogeneity through site specific binding and / or number specific binding of the antibody and drug.
  • the number corresponding to the most optimal drug-antibody ratio (DAR) to the N-terminal amino acid residue for each antibody for example, 1 to 8 drugs can bind.
  • DAR drug-antibody ratio
  • the term “homogeneity” refers to a case where the bonding ratio and the bonding position of two materials are homogeneous in a conjugate formed by combining two materials.
  • the present invention is not limited to the meaning that only the case where the binding ratio and the binding position are exactly the same is included.
  • the conjugate is homogeneous, it becomes homogeneous as a whole and can accurately measure the efficacy according to the dosage, thereby standardizing its dosage, frequency of administration, and the like.
  • antibody refers to a protein molecule that acts as a receptor for an antigen that specifically recognizes an antigen, including an immunoglobulin molecule that is immunologically reactive with a specific antigen.
  • Polyclonal antibodies, monoclonal Antibody fragments include antibodies, full-length antibodies, and antigen binding domains.
  • the full length antibody is a structure having two full length light chains and two full length heavy chains, each of which is linked by a heavy chain and a disulfide bond.
  • the total antibody includes IgA, IgD, IgE, IgM and IgG, and IgG is a subtype, including IgG1, IgG2, IgG3 and IgG4.
  • the antibody fragment refers to a fragment having an antigen binding function, and includes Fab, Fab 'F (ab') 2 , scFv, Fv and the like.
  • the Fab has one antigen binding site in a structure having a variable region of the light and heavy chains, a constant region of the light chain and a first constant region of the heavy chain (CH1).
  • F (ab ') 2 antibodies are produced when the cysteine residues of the hinge region of Fab' form disulfide bonds.
  • Fv (variable fragment) means a minimum antibody fragment having only the heavy chain variable region and light chain variable region.
  • Double-chain Fv is a disulfide bond is linked to the heavy chain variable region and light chain variable region, and short-chain Fv (scFv) is generally covalently linked to the variable region of the heavy chain and the light chain through a peptide linker.
  • Such antibody fragments can be obtained using proteolytic enzymes (e.g., the entire antibody can be restricted to papain and Fabs can be obtained and pepsin can be used to obtain F (ab ') 2 fragments). Can be produced through genetic recombination techniques.
  • the antibodies of the present invention may be native antibodies or recombinant antibodies.
  • a native antibody refers to an antibody that has not been genetically modified, and may have a significantly low risk of immunogenicity that the genetically engineered antibody may have in vivo.
  • Recombinant antibody means a genetically engineered antibody, there is a feature that can add the antigen binding ability or the desired characteristics through genetic engineering.
  • the term "genetic engineering” refers to the act of changing an amino acid sequence, and includes manipulation of a polypeptide having an amino acid sequence that is somewhat different from the original sequence polypeptide encoding the amino acid sequence.
  • Amino acid sequence variants will contain amino acid sequences in which amino acids have been substituted, deleted or externally inserted at specific positions within the amino acid sequence.
  • the antibody of the present invention may be one that specifically recognizes a cell surface antigen that is internalized in the cell when the antibody binds to the antigen.
  • the drug bound to the antibody specifically the cytotoxic drug is introduced into the cell by the properties, the efficacy of the drug may be high, but It is not limited.
  • the antibody of the present invention may specifically bind to a cancer cell surface antigen or a tissue surface antigen from which an autoimmune disease has occurred.
  • cancer cell surface antigen means that a substance that is not produced or is not exposed to the cell surface of the normal cell is more exposed to the surface of the cancer cell than the material or the normal cell that is specifically exposed to the cell surface. It refers to a lot of substances. When the substance is recognized by an antibody, it is expressed as an antigen.
  • the cancer cell surface antigens of the present invention include, without limitation, cancer cell surface substances that antibodies of the present invention can specifically recognize, for example CD19, CD20, CD30, CD33, CD37, CD22, CD56, CD70, CD74, CD138, Muc-16, mesothelin, HER2, HER3, glycoprotein NMB (GPNMB), IGF-1R, B cell maturation antigen (BCMA), prostate-specific membrane antigen (PSMA), epipithelial cell adhesion molecule (EpCAM) and EGFR It may be selected from the group consisting of (epidermal growth factor receptor), more specifically may be selected from the group consisting of HER2, CD30, CD56 and GPNMB. However, it is not limited thereto.
  • Trastuzumab a type of anti-HER2 antibody that recognizes Her2, CD56, and GPNMB, Lorvotuzumab, a type of anti-CD56 antibody, and a type of anti-CD30 antibody
  • Brentuximab and Glembatumumab a type of anti-GPNMB antibody
  • the term "drug” may mean any substance having a specific biological activity in a cell, which includes a compound, DNA, RNA, peptide, and the like. It may be in a form including a reactor capable of reacting and crosslinking with an ⁇ -amine group, and also includes a form in which a linker including a reactor capable of reacting with and reacting with an ⁇ -amine group is linked. In this case, the drug may be specifically linked to the N-terminal amino acid residue of the antibody by a linker, but is not limited thereto.
  • the linker refers to a chemical moiety comprising an atomic chain that covalently binds a drug to an antibody.
  • the linker is prepared in a form linked to the drug, and has a reactor at the linker end that can be linked to the antibody.
  • Examples of the reactor capable of reacting and crosslinking with the ⁇ -amine group are not particularly limited as long as they can be crosslinked by reacting with the N-terminal ⁇ -amine group of the heavy or light chain of an antibody, and are known in the art. All kinds of reactions with groups include but are not limited to isothiocyanate, isocyanates, acyl azides, NHS esters, sulfonyl chlorides, and aldehydes.
  • aldehyde glyoxal, epoxide, oxirane, carbonate, aryl halide, imidoester, carbodiimide, anhydride ( anhydride) and fluorophenyl ester, and the like
  • reactors are aldehyde and NHS ester, but are not particularly limited thereto.
  • Such reactors may be combined with an amine group by an acylation or alkylation reaction, but are not particularly limited thereto.
  • the antibody-drug conjugate of the present invention may be an immunoconjugate in which a drug linked to a linker having an aldehyde reactor is site-specifically and number-specifically bound to an amino acid residue at the N terminus of the antibody.
  • Aldehyde reactors are effective for site-specific binding of drugs to amino acid residues, particularly ⁇ -amines, at the N terminus of antibodies by minimizing nonspecific reactions.
  • the final product resulting from reductive alkylation by aldehyde bonds is much more stable than linked by amide bonds.
  • Aldehydes have the property of selectively reacting with N-terminal ⁇ -amines at low pH.
  • the conjugate of the present invention has homogeneity in which the drug is specifically linked to the N-terminal ⁇ -amine of the antibody. Therefore, the problem of not being able to guarantee uniform drug efficacy and quality caused by heterogeneity of the number and location of the binding of the conjugate of the existing antibody and the drug is not particularly limited thereto.
  • the inventors of the present invention when the reaction is carried out at pH 6.0 or less during the binding reaction to link the site-specific cytotoxic drug to the ⁇ -amine of the antibody, ⁇ that the cytotoxic drug is present in the lysine residue It was found that binding to amines can be minimized.
  • the drug includes all substances capable of causing cell death, cell proliferation, immune activity, activation of specific signaling, including inhibition of immunity, or inhibition of specific signaling, etc., and the drug is particularly cytotoxic. It may be a drug or an immunosuppressant.
  • cytotoxic drug refers to any substance, such as a compound, having a cytotoxic or cytostatic effect.
  • Cytotoxic means an effect of inhibiting or lowering the function of cells to cause cell destruction
  • inhibiting cell proliferation means an effect of limiting cell growth functions, such as restriction of cell growth or cell proliferation.
  • the cytotoxic drug is a microtubulin structure forming inhibitor, a mitosis inhibitor, an RNA polymerase inhibitor, a topoisomerase inhibitor, a DNA intercalators, a DNA alkylator (DNA alkylator), a chemotherapeutic agent capable of functioning as a ribosomal inhibitor, and the like, a protein toxin capable of functioning enzymatically, and a radioisotope.
  • Examples include maytansinoids, mayurisinin, auristatin, dolastatin, tubelysine, tuchelysin, calicheamicin, pyrrolobenzodiazepines, doxorubicin , Duocamycin, carboplatin (paraplatin), cisplatin, cyclophosphamide, ifosfamide, nidran, nitrogen Mustard (mecloethamine hydrochloride) [nitrogen mustar (mechlorethamine HCL)], bleomycin, mitomycin C, cytarabine, flurouracil, gemcitabine, tree Trimetrexate, methotrexate, etoposide, vinpoline, vinblastine, vinorelbine, alimta, altamine, procarbazine (procarbazine), taxol, taxotere, topotecan topotecan, irinotecan, trichothecene, CC1065, alpha-aman
  • immune inhibitor refers to any compound that has the effect of reducing an immune response. This means a substance capable of antagonizing an immune-causing substance or suppressing substances (cytokines such as interleukins) involved in an immune response.
  • cytokines such as interleukins
  • Trastuzumab, Robototuzumab, Brentuximab, and Glembatumumab as representative antibodies are used as model antibodies, and the N-terminal thereof is used as a representative antibody.
  • Monomethyl auristatin F (MMAF) and monomethyl aristatin E (MMAE) were used as representative cytotoxic drugs to bind, respectively (Examples 1 and 2).
  • Trastuzumab was reacted with MMAF or MMAE at a pH of 6.0 to prepare an antibody-drug conjugate in which the drug was bound to its N-terminus, and the antibody-drug conjugate was capable of antigen binding and cytotoxicity of the antibody even after drug binding.
  • the present invention provides a method for producing the antibody-drug conjugate.
  • the antibody-drug conjugate and its components are as described above.
  • the production method includes the step of connecting the drug to the N-terminal ⁇ -amine group of the heavy or light chain of the antibody by reacting the antibody with a drug comprising a reactor capable of reacting and crosslinking the ⁇ -amine group .
  • the preparation method may further comprise the step of separating the antibody-drug conjugate from the reaction product containing the antibody and drug that do not form a conjugate.
  • the antibody and the drug in the preparation method may be connected at pH 4.0 or more and pH 6.5 or less, more specifically, pH 5.5 or more and pH 6.5 or less, and more specifically, at pH 6.0.
  • the low pH has the advantage that the binding between the aldehyde present in the drug or the linker thereof and the N-terminal ⁇ -amine of the antibody can occur specifically.
  • the separation process of the antibody-drug conjugate may be performed through various methods known in the art, for example, may be performed through a chromatography process including size exclusion chromatography, but is not particularly limited thereto.
  • the present invention provides a composition comprising the antibody-drug conjugate.
  • the composition comprises the form of a pharmaceutical composition for treating cancer or autoimmune disease comprising the antibody-drug conjugate.
  • the antibody may specifically bind to a cancer cell surface antigen or a tissue surface antigen from which an autoimmune disease has occurred.
  • the pharmaceutical composition of the present invention may further comprise a pharmaceutically acceptable carrier.
  • the antibodies, drugs, cancer cell surface antigens and tissue surface antigens from which autoimmune diseases have occurred are the same as described above.
  • cancer includes, without limitation, the type of cancer, for example esophageal cancer, stomach cancer, colorectal cancer, rectal cancer, oral cancer, pharyngeal cancer, laryngeal cancer, lung cancer, colon cancer, breast cancer, cervical cancer, endometrial cancer, ovary Cancer, prostate cancer, testicular cancer, bladder cancer, kidney cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin's disease, lymphoma, or multiple myeloma hematoma cancer.
  • the cancer that can be treated can be selected according to the type of antibody specific for the cancer cell surface antigen.
  • autoimmune disease includes any type of autoimmune disease targeted by the antibody-drug conjugate of the present invention, for example, rheumatoid arthritis, systemic scleroderma, systemic lupus erythematosus, atopic dermatitis , Psoriasis, alopecia areata, asthma, Crohn's disease, Bechesi's disease, Sjogren's syndrome, Gilia-Barré syndrome, chronic thyroiditis, multiple sclerosis, multiple myositis, ankylosing spondylitis, fibrous histitis or nodular polyarteritis.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not irritate an organism and does not inhibit the biological activity and properties of the administered compound.
  • Acceptable pharmaceutical carriers in compositions formulated as liquid solutions are sterile and physiologically compatible, including saline, sterile water, Ringer's solution, buffered saline, albumin injectable solutions, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers and bacteriostatic agents may be added as necessary.
  • the carrier is not particularly limited, but oral administration may include a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a dye, a perfume, and the like.
  • a buffer Preservatives, analgesic agents, solubilizers, isotonic agents, stabilizers and the like can be mixed and used.
  • bases, excipients, lubricants, preservatives and the like can be used for topical administration.
  • Formulations of the compositions of the present invention can be prepared in a variety of mixtures with the pharmaceutically acceptable carriers described above.
  • it may be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, they may be prepared in unit dosage ampoules or multiple dosage forms. And other solutions, suspensions, tablets, pills, capsules, sustained release preparations and the like.
  • suitable carriers, excipients and diluents suitable for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl Cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil and the like can be used.
  • fillers, anti-coagulants, lubricants, wetting agents, fragrances, preservatives and the like may be further included.
  • compositions of the present invention are tablets, pills, powders, granules, capsules, suspensions, solvents, emulsions, syrups, sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, and lyophilization according to conventional methods, respectively. It may have any of the formulations selected from the group consisting of formulations and suppositories.
  • composition may be formulated in a unit dosage form suitable for intrabody administration of a patient according to a conventional method in the pharmaceutical field, preferably in the form of a formulation useful for the administration of a peptide medicine, and is commonly used in the art.
  • the conjugate may be used in admixture with a number of carriers (pharmaceutically acceptable) such as saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran (ascorbic acid) to increase stability or absorption.
  • carriers pharmaceutically acceptable
  • carbohydrates such as glucose, sucrose or dextran (ascorbic acid)
  • Antioxidants such as ascorbic acid or glutathione, chelating agents, small molecule proteins or other stabilizers can be used as medicaments.
  • the present invention provides a method of treating cancer or autoimmune disease using the antibody-drug conjugate or the composition.
  • the antibody may be one that specifically binds to a cancer cell surface antigen, and the drug may be a cancer treatment drug.
  • the antibody may specifically bind to a tissue surface antigen from which an autoimmune disease has occurred, and the drug may be an autoimmune disease therapeutic drug.
  • the antibodies and drugs are the same as described above.
  • the method may be a method for treating a cancer or an autoimmune disease comprising administering the pharmaceutical composition to a subject in need thereof, wherein the type of antibody-drug conjugate and carrier used is described above. Same as bar.
  • the composition may be administered in single or multiple amounts in a pharmaceutically effective amount.
  • the composition may be administered in the form of a liquid, powder, aerosol, capsule, enteric skin tablets or capsules or suppositories.
  • Routes of administration include, but are not limited to, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, endothelial administration, oral administration, topical administration, intranasal administration, pulmonary administration, rectal administration, and the like.
  • the antibody which is a protein
  • the pharmaceutical composition may be administered by any device in which the active agent may migrate to the target cell.
  • the pharmaceutical compositions of the present invention may be administered as individual therapeutic agents or in combination with other therapeutic agents and may be administered sequentially or simultaneously with conventional therapeutic agents.
  • compositions comprising the antibody-drug conjugates of the invention are administered in a pharmaceutically effective amount.
  • “Pharmaceutically effective amount” means an amount sufficient to treat or prevent a disease at a reasonable benefit / risk ratio applicable to medical treatment or prevention, wherein an effective dose level is the severity of the disease, the activity of the drug, the age of the patient, Body weight, health, sex, sensitivity to the drug of the patient, time of administration of the composition of the invention used, route of administration and rate of release, duration of treatment, elements including drugs used or combined with the composition of the invention used and other medical fields Can be determined according to well-known factors.
  • the present invention provides a method for selecting an antibody suitable for preparation with the antibody-drug conjugate.
  • the preparation of the antibody-drug conjugate according to the present invention it is possible to search for and select an antibody suitable for effectively preparing the antibody-drug conjugate by binding the drug to the N-terminus of the antibody, specifically, ⁇ -amine.
  • the intra-anti-HER2 antibody which is an anti-HER2 antibody
  • the intra-anti-HER2 antibody is used to confirm that the cytotoxins in which the linker is present bind to the antibody in a site-selective manner.
  • the above antibodies were constructed using expression vector amino acid sequence information, and expressed, cultured, and purified through stable cell line construction or transient expression in CHO cell lines.
  • MMAF Monomethyl Auristatin F
  • XcessBioscience XcessBioscience
  • the antibody was exchanged to 100 mM potassium phosphate pH5.49 buffer solution and concentrated to about 7.1 mg / ml. Thereafter, MMAF (Lego Chem Bioscience, Korea), which is connected to a linker having an aldehyde reactor, was dissolved in 50% DMSO (dimethyl sulfoxide) solvent to obtain 2.5 mg / ml.
  • DMSO dimethyl sulfoxide
  • Control antibody-drug conjugates prepared by conventional techniques include cysteine binding (Cys conjugation, Thiomab (HC-A114C) + Mal-C6-MMAF), thiol binding (Mal-C6-MMAF), and lysine binding (SMCC linker, SH- C6-MMAF).
  • the thiol-binding antibody was reduced to TCEP at pH 8.0 and then reacted at 0 ° C. for 3 hours with Mal-C4-MMAF. After the reaction, cysteine was added to further react, and the reaction was terminated. The reaction was terminated by replacing with 1 ⁇ PBS using a G25 Desalting column (GE healthcare, USA).
  • Cysteine-binding antibody was activated by the cysteine of the purified antibody, followed by conjugation by adding Mal-C6-MMAF to a process similar to thiol-binding antibody.
  • the conjugate of lysine binding antibody was prepared with reference to Immunogen Corporation Patent (WO2005037992). First, the antibody and SMCC linker were reacted, and the unreacted SMCC was removed through buffer exchange. The antibody-SMCC conjugate was reacted with SH-C4-MMAF (Concortis bioscience, USA) containing a thiol group to prepare an antibody-SMCC-MMAF conjugate.
  • SH-C4-MMAF Conscortis bioscience, USA
  • T-N-MMAF The molecular weight of the antibody-drug conjugate (T-N-MMAF) was confirmed by LC-MS analysis. Theoretical value of the molecular weight upon binding of the drug (MMAF) used is 824.54 Da and the molecular weight of trastuzumab is 145 kDa. Therefore, mass spectrometry also confirmed whether the drug bound to the antibody and the number of drugs bound to one molecule of the antibody at the same time.
  • T-N_MMAF conjugate The drug-binding position in the prepared T-N_MMAF conjugate was confirmed through peptide mapping.
  • the T-N-MMAF ADC of DAR 3.2 prepared in Example 3 was denatured to Rapigest (Waters) and then reacted with trypsin (Roche) to make a section.
  • the reaction was separated by ACQUITY UPLC PST (BEH) C18 column and each separated peak was subjected to mass spectrometry using a Waters Synapt G2-S Q / TOF system to determine which sequence it corresponds to and the results are shown in FIG. 4.
  • the purity of the monomer was 98.8%, confirming the purity suitable for the potency test, and no fragmentation or cross-linking was observed.
  • BIAcore TM Biacore TM
  • a surface plasmon resonance surface plasmon resonance
  • a control antibody a natural antibody was used.
  • Antigen (ErbB2) avidity was analyzed using Biacore T200, and each antibody was immobilized on a CM5 sensor chip (GE healthcare) using an amine coupling kit, followed by ErbB2 (R & D systems) 50, 16.67, 5.56, 1.85, 0.62. , Injected at a rate of 30 uL / min at a concentration of 0.21 nM, and measured and analyzed the on / off rate to obtain kD (M).
  • Test 1 (10 -10 M) Test 2 (10 -10 M) Average (10 -10 M) Trastuzumab 1.3 2.2 1.8 TN-MMAF (DAR 1.6) 1.2 0.9 1.1 TN-MMAF (DAR 3.2) 1.1 0.7 0.9 0.9
  • anti-proliferative assays were performed using HER2 expressing tumor cell lines BT474, HCC1954, SKOV-3, and JIMT-1 cell lines. Incubate each cell and suspend at 1 * 10 5 cells / ml and load 100 ⁇ l into a 96 well plate. After 3 hours of incubation in a cell incubator, 100 ⁇ l of antibody-cytotoxin conjugates at various concentrations per well were added and incubated in the cell incubator for 4 days.
  • Table 6 sample Relative content of monoclonal antibody (storage 7 days,%) Relative content of binder (7 days storage,%) Relative content of DAR (7 days retention,%) Trastuzumab 90.0 - - TN-MMAF 89.3 90.5 101.4 TC-MMAF 49.2 32.3 65.6 Thiomab-mmaf 69.9 59.5 85.1
  • Rat Pharmacokinetics Rat PK
  • ADCs T-K-MMAF, T-C-MMAF, T-N-MMAF
  • trastuzumab were intravenously injected into female Sprague-Dawley rats at a 2.5 mg / kg dose. Blood was collected after 0.05 hours, 0.5 hours, 1 hour, 6 hours, 24 hours, 72 hours, 168 hours, 240 hours, and 336 hours after material administration.
  • a total antibody assay for analyzing all antibodies that bind to ErbB2 in the blood and a conjugated antibody assay for analyzing antibodies in which drug binding is maintained were performed by ELISA.
  • Binding antibody assay proceeded in a similar manner to that described above, after coating a 96-well microplate with an anti-MMAF antibody (YoungInfrontier), the sample was placed in a plate and reacted for 1 hour at a temperature of 37 °C. Subsequently, biotinylated ErbB2 (ACROBIOSYSTEMS, USA), streptavidin-HRP, and TMB were sequentially added to determine the concentration of the binding antibody by measuring absorbance at 450 nm. The results are shown in FIGS. 6 to 8 and Table 7 below. Indicated.
  • TNM DAR approximately 1.6 and 3.2
  • TCM DAR approximately 3.7
  • TKM DAR approximately 3.9
  • the antibody according to the present invention was excellent in anticancer effect compared to the control and comparative antibody results.
  • Single-dose toxicity studies were conducted using SD rats to determine whether stability that depends on the manufacturing technique of the ADC affects toxicity.
  • Three ADCs were each administered once intravenously at high doses of 200 mpk.
  • single antibody and MMAF were also administered at the exposure of 200 mpk.
  • Body weight was measured daily from the time of administration of the test substance to the end of the experiment (12 days).
  • Blood and biochemical analyzes were performed 5 days after administration. Measures are AST, ALT, Neutrophil and Platelet for hepatotoxicity and representative hematologic toxicity.
  • T-C-MMAF, T-K-MMAF group showed a significant weight loss compared to the T-N-MMAF group and the rest of the group.
  • the T-C-MMAF-treated group died after 8 days except for one.
  • Blood biochemical analysis was performed on blood collected on day 5 after administration to compare hepatotoxicity. 12 were performed using Au480 (Beckman coulter, USA) chemistry analyzer, AST (Aspartate Aminotransferase) and ALT (Alanine Aminotransferase), which are indicators of hepatotoxicity.
  • the T-N-MMAF group according to the present invention showed a change that does not differ significantly from other controls, including PBS was observed that did not cause acute or severe hepatotoxicity.
  • significant increases were observed in the T-C-MMAF and T-K-MMAF groups, indicating hepatotoxicity due to drug administration.
  • Hematological analysis was performed using Hemavet 950 FS (Drew Scientific Inc., USA) hematology analyzer on blood collected on day 5 after administration, as the major clinical toxicity of currently approved ADCs is shown as hematological characteristics, The result is shown in FIG.
  • the number of neutrophils (Neutrophil), T-N-MMAF group did not show a significant change compared to the control group containing PBS, did not cause acute and severe hematologic toxicity.
  • the T-C-MMAF group showed a significant decrease and the T-K-MMAF group showed a marked increase, which was estimated to decrease immediately after administration and then rise again. Therefore, it could be concluded that the drug administration caused rapid hematological toxicity in these two groups.
  • the T-N-MMAF-administered group was slightly reduced to show a difference compared to other controls including PBS.
  • the T-C-MMAF and T-K-MMAF groups showed a sharp decrease, indicating that rapid toxicity was caused by the administration material.
  • the method of preparing the antibody-drug conjugate of the present invention can be used for various antibody-drug conjugates. To this end, it was intended to confirm the function by applying to various drugs or various antibodies and various antibody forms.
  • Example 3 According to the method of Example 3, a conjugate was made between MMAE (XcessBioscience, USA) and an antibody, and the results of molecular weight analysis by LC / MS to determine DAR are shown in FIG. 14 and Table 8 below.
  • the serum stability of the T-N-MMAE ADC was evaluated.
  • the concentration of ADC in each sample was measured by total antibody assay using ELISA, and the change of DAR was measured by LC / MS.
  • a PK measurement test using an SD rat was performed similarly to Example 6 described above. Briefly, 2.5 mg / pk ADC was administered to female SD rats and blood was drawn after 12, 30, 1, 6, 24, 3, 7, 10, 14, 17 and 21 days. The concentration was determined according to the method described above by dividing the total antibody and binding antibody using the ELISA technique.
  • TN-MMAE showed a profile that is not significantly different from the parent antibody in both the total antibody and the binding antibody, and similar stability to MMAF even when the antibody-drug complex was prepared with MMAE.
  • Table 10 TN-MMAE showed a profile that is not significantly different from the parent antibody in both the total antibody and the binding antibody, and similar stability to MMAF even when the antibody-drug complex was prepared with MMAE.
  • MMAE Similar stability to MMAF even when the antibody-drug complex was prepared with MMAE.
  • the measured IC 50 ranged from 0.33-3.76 nM, which is similar to the activity (0.47 nM) on the BT474 cell line of trastuzumab / MMAE thiol conjugates reported in the literature. Therefore, it can be said that the N-terminal selective binding method using ⁇ -amine according to the present invention can be applied to other types of drugs.
  • N-terminal binding is performed on three anticancer antibodies (Brentuximab, Lorvotuzumab, and Glembatumumab) to measure DAR analysis and in vitro stability. It was.
  • Example 3 Brentusimab-N-MMAF (B-N-MMAF) was prepared according to the method of Example 3 with brentushimab expressed from the CHO cell line.
  • the prepared ADC exhibited an LC / MS profile as shown in FIG. 16 and Table 12 below. Species up to D0-D6 were detected and the DAR was calculated to be 2.90.
  • the binding ability to the antigen was measured and compared by ELISA method.
  • Antigen CD30 R & D systems
  • PBST PBS + 0.05% Tween 20
  • HRP conjugated anti-human kappa light chain antibody was diluted 1000-fold and placed in a plate and reacted at 37 ° C. for 1 hour.
  • TMB TMB (Sigma) was added and developed for 10 minutes.
  • Anti-proliferation assays were performed using Karpas-299, L-540 cell lines, CD30 expressing cell lines, to confirm the in vitro efficacy of the prepared antibody-cytotoxin conjugate.
  • each cell was cultured and suspended at 1 * 10 5 cells / ml and loaded into 100 wells in 96 well plates. After 3 hours of incubation in a cell incubator, 100 ⁇ l of antibody-cytotoxin conjugates at various concentrations per well were added thereto, and the cells were incubated for 4 days in the cell incubator.
  • CCK-8 (Dojindo) was diluted 1:10 and treated in each well, and then wrapped in aluminum foil and reacted in a cell incubator for 2 to 5 hours. Absorbance was measured at 450 nm using a SpectraMax 190 microplate reader, and the results are shown in Table 13 below.
  • Robotuzumab-N-MMAF (L-N-MMAF) was prepared according to the method of Example 3 above with robotuzumab temporarily expressed from CHO cells.
  • the prepared ADC showed a conjugation profile as shown in FIG. 18 and Table 14, and the DAR was determined to be 3.33.
  • Antigen CD56 R & D systems, 2408-NC-050
  • Antigen CD56 R & D systems, 2408-NC-050
  • anti-proliferation assay was performed using OPM-2 cell line. Each cell was cultured and suspended at 1 * 10 5 cells / ml and loaded into 100 ⁇ l into a 96 well plate. After 3 hours of incubation in a cell incubator, 100 ⁇ l of antibody-cytotoxin conjugates of various concentration sections were added per well, and the cells were cultured in a cell incubator for 4 days. CCK-8 (Dojindo) was diluted 1:10 and treated in each well, then wrapped in foil and reacted in a cell incubator for 2-5 hours. Absorbance was measured at 450 nm using a SpectraMax 190 microplate reader, and the results are shown in Table 15.
  • L-N-MMAF antibody according to the present invention showed a cytotoxicity of 42-53nM level.
  • anti-proliferation assay was performed using SK-MEL-2 cell line, a skin cancer cell line. Each cell was cultured and suspended at 1 * 10 5 cells / ml and loaded into 100 ⁇ l into a 96 well plate. After 3 hours of incubation in a cell incubator, 100 ⁇ l of antibody-cytotoxin conjugates at various concentrations per well were added thereto, and the cells were incubated for 4 days in the cell incubator. CCK-8 (Dojindo) was diluted 1:10 and treated in each well, then wrapped in foil and reacted in a cell incubator for 2-5 hours. Absorbance was measured at 450 nm using a SpectraMax 190 microplate reader, and the results are shown in Table 16.
  • G-N-MMAF according to the present invention showed a cytotoxicity of 3-5nM level.

Abstract

본 발명은 항체의 중쇄 또는 경쇄의 N-말단 아미노산 잔기에 약물이 결합된 항체-약물 결합체, 이의 제조방법 및 이의 용도에 관한 것이다.

Description

안정성이 개선된 항체-약물 결합체 및 이의 용도
본 발명은 항체의 중쇄 또는 경쇄의 N-말단 아미노산 잔기에 약물이 결합된 항체-약물 결합체, 이의 제조방법 및 이의 용도에 관한 것이다.
최근 다양한 질환에 대하여 항체를 이용한 진단 또는 치료 방법이 연구되고 있다. 특히, 항체의 표적 특이성 때문에 항체를 이용한 다양한 치료 방법이 개발되고 있으며, 항체를 포함하는 다양한 형태의 의약, 예를 들어 항체-약물 결합체(Antibody-Drug Conjugate, ADC)등이 개발되고 있다. 이에, 항체 또는 항체-약물 결합체에 대하여 생체 내 안정성을 증가시키고, 치료 효과를 극대화하는 방법이 계속적으로 연구되고 있다.
이 중 항체-약물 결합체는 일반적으로 천연 항체에 비해서 생체 내 안정성이 낮은 단점이 있으나, 천연 항체가 가진 단점인 낮은 치료 효과를 약물과의 결합을 통하여 개선하고자 개발되었다. 표적 특이적 항체에 싸이토톡신 등 특정 약효를 가지는 약물이 다양하게 결합한 형태로 개발되고 있으며, 특히 암세포 특이적 항체에는 싸이토톡신을 결합시켜 암세포 사멸을 유도하는 방법은 실제로 현재 상용화된 방법이다.
그러나, 이러한 항체-약물 결합체는 천연 항체에 비하여 생체 내 안정성이 낮아지는 경향이 있으며, 더욱이 치료 효과를 높이기 위해 약물의 결합 비율(Drug Antibody Ratio, DAR)을 높이는 경우, 해결해야 할 다양한 기술적 문제가 존재한다. 먼저, 표적 특이적 치료를 위하여 항체의 항원 결합능 및 Fc 기능을 방해하지 않아야 하며, 항체 대 약물의 결합 비율을 높임으로써 치료 효과도 증대되는 효과가 나타나야 하고, 항체 대 약물의 결합 비율에 따라 항체-약물 결합체의 생체 내 안정성, 즉 혈중 반감기가 감소되지 않도록 해야 한다. 상기의 기술적 문제를 고려하여 최대한 높은 항체 대 약물 비율을 유지하는 것이 현재 항체-약물 결합체 제조 분야의 목표이다. 특히, 암세포 표면 항원의 발현 정도가 낮은 경우를 고려하면 높은 세포 독성을 유지하기 위해서는 최대한 높은 DAR을 유지해야 하나, DAR이 8에 이른 경우, 항체에 결합한 소수성 약물의 영향으로 혈중 반감기가 감소하여 독성은 증가하고 생체 내 효과(in vivo efficacy)가 감소할 수 있는 단점이 있다.
이러한 배경 하에, 본 발명자들은 모 항체의 항원 결합력을 동등하게 유지하고 우수한 항암 효과를 나타내면서도 약물에 의한 독성이 적고 생체 내 효능이 우수한 항체-약물 결합체를 제조할 수 있는 기술을 개발하기 위하여 예의 노력한 결과, 항체의 중쇄 또는 경쇄의 N-말단에 약물을 결합시키는 경우, 기존 보고된 항체-약물 결합체와 비교하여서도 생체 내 독성이 적으면서도 혈중 안정성 및 항암 활성이 우수함을 규명하여, 본 발명을 완성하였다.
본 발명의 하나의 목적은 항체의 중쇄 또는 경쇄 N-말단 아미노산 잔기에 약물이 결합된 항체-약물 결합체를 제공하는 것이다.
본 발명의 다른 목적은 상기 항체-약물 결합체의 제조방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체-약물 결합체를 포함하는 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체-약물 결합체를 암 의심 개체에 투여하는 단계를 포함하는, 암의 치료 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체-약물 결합체를 자가면역질환 의심 개체에 투여하는 단계를 포함하는, 자가면역질환의 치료 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체-약물 결합체로 제조하기에 적합한 항체를 선별하는 방법을 제공하는 것이다.
본 발명의 항체-약물 결합체를 제조하는 방법을 통하여, 보다 높은 생체 내 효능, 안정성 및 낮은 독성을 가지는 항체-약물 결합체를 제조할 수 있다.
도 1은 알데하이드 링커가 말단에 연결된 독소 MMAF(Monomethyl Auristatin F)의 구조식이다.
도 2는 유전자조작 되지 않은 단일클론 항체-싸이토톡신 결합체로서, 결합된 개수와 위치가 동질성을 가지는 구조를 보여주는 모식도이다.
도 3은, T-N-MMAF의 LC/MS 프로파일을 나타낸 도이다.
도 4는, 제조된 Trastzumab-N-MMAF(T-N-MMAF 결합체)에서 약물이 결합된 위치를 펩티드 맵핑으로 확인한 결과를 나타낸 도이다.
도 5는, 제조된 T-N-MMAF의 SEC-HPLC 크로마토그램 결과를 나타낸 도이다.
도 6은, 전체 항체(Total antibody)들의 랫트에서의 시간에 따른 혈중 농도 변화를 확인한 도이다.
도 7은, 결합 항체(Conjugated Antibody)들의 시간에 따른 혈중 농도 변화를 확인한 도이다.
도 8은, 각 ADC별 total/conjugate의 PK 프로파일 서로 비교한 결과를 나타낸 도이다.
도 9는, 누드 랫트 이종이식 모델에서의 HCC1954 세포주에 의해 형성된 종양성장곡선을 나타낸 도이다.
도 10은, 종양 크기를 endpoint로 설정한 누드 랫트 이종이식 모델 실험에서의 생존 곡선을 나타낸 도이다.
도 11은, 각 ADC별 투여에 따른 체중의 변화 및 상대 변화량을 나타낸 도이다.
도 12는, 각 ADC별 투여에 따른 간독성 여부를 확인한 결과를 나타낸 도이다.
도 13은, 각 ADC별 투여에 따른 호중구 및 혈소판의 변화를 나타낸 도이다.
도 14는, T-N-MMAE LC/MS 분석 결과를 나타낸 도이다.
도 15는, T-N-MMAE의 Rat PK 프로파일을 나타낸 도이다.
도 16은, Brentuximab-N-MMAF(B-N-MMAF)의 LC/MS 프로파일을 나타낸 도이다.
도 17은, B-N-MMAF의 항원 결합력을 분석한 결과를 나타낸 도이다.
도 18은, Lorvotuzumab-N-MMAF(L-N-MMAF)의 conjugation profile을 나타낸 도이다.
도 19는, L-N-MMAF의 항원 결합력을 나타낸 도이다.
하나의 양태로서, 본 발명은 항체의 중쇄 또는 경쇄 N-말단 아미노산 잔기에 약물이 결합된 항체-약물 결합체를 제공한다.
본 발명에서 용어, "항체-약물 결합체(antibody-drug conjugate, ADC)"란 항체와 약물의 생물학적 활성을 저하시키지 않으면서 약물과 항체를 화학적으로 연결한 형태를 지칭한다. 본 발명에서 상기 항체-약물 결합체는 항체의 중쇄 또는/및 경쇄의 N-말단의 아미노산 잔기에 약물이 결합된 형태, 구체적으로는 항체의 중쇄 또는/및 경쇄의 N-말단 α-아민기에 약물이 결합된 형태를 말한다. 본 발명에서는, 항체의 여러 부위 중에서도 중쇄 또는 경쇄의 N-말단에 약물을 위치 특이적으로 결합시키는 경우, 기존에 보고된 시스테인 결합으로 형성된 항체-약물 결합체, 티올 결합으로 형성된 항체-약물 결합체 및 라이신 결합으로 형성된 항체-약물 결합체와 비교하였을 때, 생체 내 효능 및 안정성 모두가 우수하고 독성이 적음을 확인하여, 항체의 중쇄 또는 경쇄의 N-말단이 효능, 안정성 및 저독성의 이점을 모두 갖춘 위치가 될 수 있음을 규명하였다. 이러한 본 발명에 따른 항체-약물 결합체에 대한 모식도를 도 2에 나타내었다.
본 발명에서 용어, "N-말단"이란 항체의 중쇄 또는 경쇄의 아미노 말단, 즉 N-말단으로, 본 발명의 목적상 약물과 결합할 수 있는 위치를 말한다. 그 예로 이에 제한되지는 않으나, N-말단의 최말단의 아미노산 잔기뿐 아니라 N-말단 주위의 아미노산 잔기를 모두 포함할 수 있으며, 구체적으로는 항체의 중쇄 또는 경쇄의 첫 번째 아미노산 잔기를 말하며, 더욱 구체적으로는 항체의 중쇄 또는 경쇄의 첫 번째 아미노산의 α-아민기를 말하나, 이에 제한되는 것은 아니다.
본 발명의 항체-약물 결합체는 항체와 약물의 위치 특이적 결합 또는/및 개수 특이적 결합을 통하여 동질성을 보장할 수 있는 장점을 가질 수 있다. 특히, 본 발명의 최적화 과정을 통하여, 각 항체마다 N-말단 아미노산 잔기에 가장 최적의 DAR(drug-antibody ratio)에 해당하는 수, 그 예로 1 내지 8개의 약물이 결합할 수 있다.
본 발명에서 용어, "동질성"은 두 물질이 결합되어 형성되는 결합체에 있어서 두 물질의 결합 비율 및 결합 위치가 균질한 경우를 말한다. 다만, 결합 비율 및 결합 위치가 완전히 동일한 경우만을 포함한다는 의미로 제한 해석되는 것은 아니며, 특정 결합 비율 및 결합 위치가 우세하게 존재하는 경우도 포함한다. 결합체가 동질성을 갖게 되면 전체적으로 균질하게 되고 투여량에 따른 효능을 정확하게 측정할 수 있어 이의 투여량, 투여 횟수 등을 표준화 할 수 있게 된다.
본 발명에서 용어, "항체"는 면역학적으로 특정 항원과 반응성을 가지는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 항원의 수용체 역할을 하는 단백질 분자를 의미하며, 다클론항체, 단일클론항체, 전장(full-length) 항체 및 항원 결합 도메인을 포함하는 항체 단편을 모두 포함한다. 전장 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 상기 전체 항체는 IgA, IgD, IgE, IgM 및 IgG를 포함하며, IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다. 상기 항체 단편은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, Fab' F(ab')2, scFv 및 Fv 등을 포함한다. 상기 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv(variable fragment)는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각을 의미한다. 이중쇄Fv(dsFv)는 디설파이드 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 경쇄의 가변 영역이 공유 결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하며 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 바람직하게는 유전자 재조합 기술을 통하여 제작할 수 있다.
또한, 본 발명의 항체는 천연형 항체 또는 재조합 항체일 수 있다. 천연형 항체란 유전자 조작을 가하지 않은 항체를 뜻하며, 생체 내에서 유전자 조작된 항체가 지닐 수 있는 면역원성(immunogenicity)의 위험성이 현저히 낮을 수 있다. 재조합 항체란 유전자 조작된 항체를 의미하며, 유전자 조작을 통하여 항원 결합력이나 원하는 특징을 추가할 수 있는 특징이 있다.
본 발명에서 용어, "유전자 조작"이란 아미노산 서열을 변화시키는 행위로서, 해당 아미노산 서열을 코딩하는 본래 서열 폴리펩타이드와 어느 정도 상이한 아미노산 서열을 갖는 폴리펩타이드에 대한 조작을 포함한다. 아미노산 서열 변이체는 본래 아미노산 서열 내의 특정 위치에서 아미노산이 치환, 결실되거나 외부 삽입된 아미노산 서열을 함유하게 된다.
본 발명의 항체는 특이적으로 결합하는 항원으로, 항체와 결합시 세포 내로 내재화(internalization)되는 세포 표면 항원을 인식하는 것일 수 있다. 본 발명의 목적상 항원이 항체와의 결합에 의하여 세포 내로 내재화되는 경우에는, 해당 특성에 의하여, 항체에 결합된 약물, 구체적으로 세포독성 약물이 세포 내로 유입되어 약물의 효능이 높을 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명의 항체는 암세포 표면 항원 또는 자가면역 질환이 발생된 조직 표면 항원에 특이적으로 결합하는 것일 수 있다.
본 발명에서 용어, "암세포 표면 항원"이란 정상세포에는 생성되지 않거나 생성되더라도 세포 표면에 노출되어 있지 않은 물질이 암세포에서만 특이적으로 세포 표면에 노출되어 있는 물질 또는 정상세포에 비해 암세포의 표면에 보다 많이 존재하는 물질을 일컫는다. 해당 물질이 항체에 의해 인식되는 경우 이를 항원이라고 표현한다.
구체적으로는, 본 발명의 암세포 표면 항원은 본 발명의 항체가 특이적으로 인식할 수 있는 암세포 표면 물질은 제한없이 포함하나, 그 예로 CD19, CD20, CD30, CD33, CD37, CD22, CD56, CD70, CD74, CD138, Muc-16, mesothelin, HER2, HER3, GPNMB(glycoprotein NMB), IGF-1R, BCMA(B cell maturation antigen), PSMA(prostate-specific membrane antigen), EpCAM(Epithelial cell adhesion molecule) 및 EGFR (epidermal growth factor receptor)로 이루어진 군에서 선택된 것일 수 있으며, 보다 구체적으로 HER2, CD30, CD56 및 GPNMB로 이루어진 군에서 선택된 것일 수 있다. 그러나, 이에 제한되는 것은 아니다. 본 발명의 일 실시예에서는 Her2, CD56, 및 GPNMB를 인식하는 항-HER2 항체의 일종인 트라스투주맙(Trastuzumab), 항-CD56 항체의 일종인 로보투주맙(Lorvotuzumab), 항-CD30 항체의 일종인 브렌투시맙(Brentuximab), 그리고 항-GPNMB 항체의 일종인 글렘바투무맙(Glembatumumab)을 모델 항체로 사용하였다.
본 발명에서 용어, "약물" 이란 세포에 특정 생물학적 활성을 가지는 임의의 물질을 의미할 수 있으며, 이는 화합물, DNA, RNA, 펩타이드 등을 모두 포함하는 개념이다. 이는 α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 형태일 수 있으며, α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 링커가 연결되어 있는 형태 역시 포함한다. 이 경우 링커에 의하여 약물이 상기 항체의 N 말단 아미노산 잔기에 위치 특이적으로 결합할 수 있으나, 이에 제한되지는 않는다.
상기 링커는 항체에 약물을 공유 결합시키는 원자쇄를 포함하는 화학적 부분을 말한다. 링커는 약물과 연결된 형태로 제조되며, 링커 말단에는 항체와 연결시킬 수 있는 반응기를 갖는다.
상기 α-아민기와 반응하여 가교할 수 있는 반응기의 예로는, 항체의 중쇄 또는 경쇄의 N-말단의 α-아민기와 반응하여 가교할 수 있다면 그 종류는 특별히 제한되지 않으며, 당업계에 공지된 아민기와 반응하는 종류를 모두 포함하나, 그 예로 아이소티오시아네이트(isothiocyanate), 아이소시아네이트(isocyanates), 아실 아자이드(acyl azide), NHS 에스터(NHS ester), 설포닐 클로라이드(sulfonyl chloride), 알데하이드(aldehyde), 글리옥살(glyoxal), 에폭사이드(epoxide), 옥시레인(oxirane), 칼보네이트(carbonate), 아릴 할라이드(aryl halide), 이미도에스터(imidoester), 카보이미드(carbodiimide), 안하이드라이드(anhydride) 및 플루오로페닐 에스터(fluorophenyl ester) 등을 들 수 있으며, 보다 바람직한 반응기로는 알데하이드 및 NHS 에스터이나, 특별히 이에 제한되지 않는다. 이러한 반응기들은 아민기와 아실화 또는 알킬화 반응으로 결합될 수 있으나, 특별히 이에 제한되는 것은 아니다.
특히, 본 발명의 항체-약물 결합체는 항체의 N 말단의 아미노산 잔기에, 알데하이드 반응기를 가지는 링커와 연결된 약물을 위치 특이적 및 개수 특이적으로 결합한 면역결합체일 수 있다.
알데하이드 반응기는 비특이적 반응을 최소화하여 항체의 N 말단의 아미노산 잔기, 특히, α-아민에 약물을 위치 특이적으로 결합시키기에 효과적이다. 알데하이드 결합에 의한 환원성 알킬화로 생성된 최종 산물은 아미드 결합으로 연결된 것보다 훨씬 안정적이다. 알데하이드는 낮은 pH에서 N 말단 α-아민과 선택적으로 반응하는 특성을 가진다. 이를 통해, 본 발명의 결합체는 항체의 N-말단 α-아민에 위치 특이적으로 약물이 연결된 동질성을 가지게 된다. 따라서, 기존 항체와 약물의 결합체의 결합의 개수 및 위치의 이질성 때문에 생기는 일률적인 약효 및 질을 담보할 수 없다는 문제점을 극복하였으나, 특별히 이에 제한되는 것은 아니다.
본 발명의 구체적인 일 실시예에서는, 본 발명자들은 항체의 α-아민에 위치 특이적으로 세포독성 약물을 연결하기 위하여 결합 반응 시 pH 6.0 이하로 반응시킬 경우, 세포독성 약물이 라이신 잔기에 존재하는 ε-아민과 결합하는 것을 최소화할 수 있음을 확인하였다.
본 발명에서 약물은 세포에 세포 사멸, 세포 증식, 면역 활성, 면역 억제를 포함하여 특정 신호전달의 활성화, 또는 특정 신호전달의 억제 등을 일으킬 수 있는 물질을 모두 포함하며, 상기 약물은 특히 세포독성 약물 또는 면역 억제제일 수 있다.
본 발명에서 용어, "세포독성 약물"이란 세포독성 또는 세포증식 억제 효과를 갖는 임의의 물질, 예컨대 화합물을 지칭한다. "세포독성"이란 세포의 기능을 억제하거나 저하시켜 세포의 파괴를 야기시키는 효과를 의미하며, "세포증식 억제"란 세포성장 또는 세포 증식의 제한 등과 같이 세포생장 기능을 제한하는 효과를 의미한다.
본 발명에서 세포독성 약물은 마이크로튜불린(microtubulin) 구조 형성 억제제, 유사분열(meiosis) 억제제, RNA 중합효소 억제제, 토포아이소머라아제(topoisomerase) 억제제, DNA 인터컬레이터(DNA intercalators), DNA 알킬레이터(DNA alkylator), 리보솜 억제제 등의 기능을 할 수 있는 화학요법제, 효소적으로 기능할 수 있는 단백질 독소 및 방사선 동위원소를 포함한다. 그 예로, 메이탄시노이드(maytansinoid), 오리스타틴(auristatin), 돌라스타틴(dolastatin), 튜브라이신(tubulysin), 칼리케아미신(calicheamicin), 피롤로벤조디아제피네스(pyrrolobenzodiazepines), 독소루비신(doxorubicin), 듀오카마이신(duocamycin), 카보플라틴(파라플라틴)[Carboplatin(paraplatin)], 시스플라틴(cisplatin), 시클로포스파미드(cyclophosphamide), 이포스파미드(ifosfamide), 니드란(nidran), 질소머스타드(메클로에타민 염산염)[nitrogen mustar(mechlorethamine HCL)], 블레오마이신(bleomycin), 미토마이신 C(mitomycin C), 시타라빈(cytarabine), 플루로우라실(flurouracil), 젬시타빈(gemcitabine), 트리메트렉세이트(trimetrexate), 메토크렉세이트(methotrexate), 에토포시드(etoposide), 빈블라스틴(vinblastine), 비노렐빈(vinorelbine), 알림타(alimta), 알트레타민(altretamine), 프로카바진(procarbazine), 탁솔(taxol), 탁소텔(taxotere), 토포테칸(topotecan), 이리노테칸(irinotecan), 트리코테센(trichothecene), CC1065, 알파-아마니틴(alpha-amanitin), 다른 에네디인 항생제, 균체 외 독소 및 식물 독소일 수 있다. 또한 화합물인 경우 이의 입체이성질체, 유도체의 형태도 포함한다. 또한 상기 오리스타틴은 모노메틸 오리스타틴 E(Monomethyl auristatin E) 또는 모노메틸 오리스타틴 F(Monomethyl auristatin F)일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 용어, "면역 억제제"란 면역 반응을 감소시키는 효과를 갖는 임의의 화합물을 지칭한다. 이는 면역 원인이 되는 물질을 길항하거나, 면역 반응에 관여하는 물질들(인터루킨 등의 사이토카인)을 억제할 수 있는 물질을 의미한다.
본 발명의 실시예에서는, 대표적인 항체로서 트라스투주맙(Trastuzumab), 로보투주맙(Lorvotuzumab), 브렌투시맙(Brentuximab), 및 글렘바투무맙(Glembatumumab)을 모델 항체로 사용하고, 이의 N-말단에 결합시킬 대표적인 세포독성 약물로서 모노메틸 오리스타틴 F(MMAF) 및 모노메틸 오리스타틴 E(MMAE)를 각각 사용하였다(실시예 1 및 2). pH 6.0의 조건에서 트라스투주맙과 MMAF 또는 MMAE를 반응시켜 이의 N-말단에 상기 약물이 결합된 항체-약물 결합체를 제조하였고, 이러한 항체-약물 결합체는 약물 결합 후에도 항체의 항원 결합능 및 세포독성 효능이 유지됨을 확인하였다(실시예 3 내지 5). 특히, 이러한 항체-약물 결합체는 in vitro 인간 혈청에서도 시스테인 결합 또는 라이신 결합을 가진 다른 항체-약물 결합체(비교 결합체)에 비해 안정성이 우수하며, 랫트를 이용한 약물동태학 실험에서도 우수한 약물 동태를 나타내었다(실시예 6). 또한, 항암 동물 모델에서도 다른 비교 결합체에 비하여 항암능이 우수하였고, 반면 체중, 간독성, 혈액 등에서 독성 수치를 검출하였을 때는 독성이 대조군과 유사한 정도로 낮은 독성을 보이는 결과를 나타내었다(실시예 7 및 8). 또한, 이러한 결과는 MMAE와 같은 다른 약물을 사용하거나, 다른 항체, 즉 로보투주맙(Lorvotuzumab), 브렌투시맙(Brentuximab), 및 글렘바투무맙(Glembatumumab)를 사용한 경우에도 항원 결합능, 세포 독성 등의 결과에서 유사한 결과를 나타내어(실시예 9), 항체의 중쇄 또는 경쇄의 N-말단에 약물을 결합시키는 본 발명에 따른 기술이 항체-약물 결합체의 제조에 있어 플랫폼 기술이 될 수 있음을 확인하였다.
또 하나의 양태로서, 본 발명은 상기 항체-약물 결합체의 제조방법을 제공한다.
상기 항체-약물 결합체 및 이의 구성요소에 대해서는 앞서 설명한 바와 같다.
구체적으로, 상기 제조방법은 α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 약물과 항체를 반응시켜, 항체의 중쇄 또는 경쇄의 N-말단의 α-아민기에 약물을 연결시키는 단계를 포함한다.
또한, 상기 제조방법은 추가로 결합체를 형성하지 않은 항체 및 약물을 포함하는 반응 산물로부터 항체-약물 결합체를 분리하는 단계를 포함할 수 있다.
구체적으로 상기 제조방법에서 항체와 약물은 pH 4.0 이상 pH 6.5 이하, 보다 구체적으로는 pH 5.5 이상 pH 6.5 이하에서 연결될 수 있으며, 보다 더 구체적으로는 pH 6.0에서 연결될 수 있다. 상기에서 서술한 바와 같이, 낮은 pH에 의해서 약물, 혹은 이의 링커에 존재하는 알데하이드기와 항체의 N-말단 α-아민 간의 결합이 특이적으로 일어날 수 있는 이점을 가진다.
상기 항체-약물 결합체의 분리 과정은 당업계에 공지된 다양한 방법을 통하여 수행될 수 있으며, 예컨대 크기 배제 크로마토그래피를 포함하는 크로마토그래피 공정을 통하여 수행될 수 있으나, 특별히 이에 제한되는 것은 아니다.
또 하나의 양태로서, 본 발명은 상기 항체-약물 결합체를 포함하는 조성물을 제공한다.
상기 조성물은 상기 항체-약물 결합체를 포함하는 암 또는 자가면역 질환 치료용 약학적 조성물의 형태를 포함한다. 이 경우, 상기 항체는 특히 암세포 표면 항원 또는 자가면역 질환이 발생된 조직 표면 항원에 특이적으로 결합하는 것일 수 있다. 본 발명의 약학적 조성물은 약학적으로 허용가능한 담체를 추가로 포함하는 것일 수 있다.
상기 항체, 약물, 암세포 표면 항원 및 자가면역 질환이 발생된 조직 표면 항원은 상기 설명한 바와 동일하다.
본 발명에서 용어, "암"은 암의 종류를 제한 없이 포함하나, 그 예로 식도암, 위암, 대장암, 직장암, 구강암, 인두암, 후두암, 폐암, 결장암, 유방암, 자궁 경부암, 자궁 내막체암, 난소암, 전립선암, 고환암, 방광암, 신장암, 간암, 췌장암, 골암, 결합 조직암, 피부암, 뇌암, 갑상선암, 백혈병, 호지킨(Hodgkin) 질환, 림프종, 또는 다발성 골수종혈액암일 수 있다. 상기 암세포 표면 항원에 특이적인 항체의 종류에 따라 치료할 수 있는 암을 선택할 수 있다.
본 발명에서 용어, "자가면역질환"은 본 발명의 항체-약물 결합체가 표적으로 하는 자가면역질환이라면 그 종류에 관계없이 포함되나, 그 예로 류마티스성 관절염, 전신성 경피증, 전신 홍반성 낭창, 아토피 피부염, 건선, 원형탈모증, 천식, 크론씨병, 베체시병, 쇼그렌 증후군, 길리아-바레 증후군, 만성 갑상선염, 다발성 경화증, 다발성 근염, 강직성 척추염, 섬유조직염 또는 결절성 다발성 동맥염일 수 있다.
본 발명에서 용어, "약학적으로 허용가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다.
상기 담체는 특별히 이에 제한되지는 않으나, 경구투여시에는 결합제, 활택제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장화제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.
본 발명의 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여시에는 정제, 트로키, 캡슐, 엘릭서, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 환약, 캡슐, 서방형 제제 등으로 제형화할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 방부제 등을 추가로 포함할 수 있다.
또한, 본 발명의 약학적 조성물은 각각 통상의 방법에 따라 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
또한, 상기 조성물은 약학적 분야에서 통상의 방법에 따라 환자의 신체 내 투여에 적합한 단위투여형의 제제, 바람직하게는 펩타이드 의약품의 투여에 유용한 제제 형태로 제형화시켜 당업계에서 통상적으로 사용하는 투여 방법을 이용하여 경구, 또는 피부, 정맥 내, 근육 내, 동맥 내, 골수 내, 수막강 내, 심실 내, 폐, 경피, 피하, 복 내, 비강 내, 소화관 내, 국소, 설하, 질 내 또는 직장 경로를 포함하는 비경구 투여 경로에 의하여 투여될 수 있으나, 이들에 한정되는 것은 아니다.
또한, 상기 결합체는 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 카보하이드레이트, 아스코르브 산 (ascorbic acid) 또는 글루타치온과 같은 항산화제 (antioxidants), 킬레이팅 물질 (chelating agents), 저분자 단백질 또는 다른 안정화제 (stabilizers)들이 약제로 사용될 수 있다.
또 하나의 양태로서, 본 발명은 상기 항체-약물 결합체 또는 상기 조성물을 이용하여 암 또는 자가면역 질환을 치료하는 방법을 제공한다. 상기 항체는 특히 암세포 표면 항원에 특이적으로 결합하는 것일 수 있으며, 상기 약물은 암치료 약물일 수 있다. 또한, 상기 항체는 자가면역 질환이 발생된 조직 표면 항원에 특이적으로 결합하는 것일 수 있으며, 상기 약물은 자가면역 질환치료 약물일 수 있다.
상기 항체 및 약물은 상기 설명한 바와 동일하다.
상기 방법은 치료를 필요로 하는 개체에 상기 약학적 조성물을 투여하는 단계를 포함하는 암 또는 자가면역 질환을 치료하는 방법일 수 있으며, 이때, 사용되는 항체-약물 결합체 및 담체의 종류는 상기에서 설명한 바와 동일하다.
상기 조성물은 약학적으로 유효한 양으로 단일 또는 다중 투여될 수 있다. 이때, 조성물은 액제, 산제, 에어로졸, 캡슐제, 장용피 정제 또는 캡슐제 또는 좌제의 형태로 투여할 수 있다. 투여 경로는 복강내 투여, 정맥내 투여, 근육내 투여, 피하내 투여, 내피 투여, 경구 투여, 국소 투여, 비내 투여, 폐내 투여, 직장내 투여 등을 포함하지만, 이에 제한되지는 않는다. 그러나 경구 투여시, 단백질인 항체는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화 되어야 한다. 또한, 제약 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다. 또한, 본 발명의 약학적 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다.
본 발명의 상기 항체-약물 결합체를 포함하는 조성물은 약제학적으로 유효한 양으로 투여한다. "약제학적으로 유효한 양"이란 의학적 치료 또는 예방에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료 또는 예방하기에 충분한 양을 의미하며, 유효 용량 수준은 질환의 중증도, 약물의 활성, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 사용된 본 발명 조성물의 투여 시간, 투여 경로 및 배출 비율 치료기간, 사용된 본 발명의 조성물과 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다.
또 하나의 양태로서, 본 발명은 상기 항체-약물 결합체로 제조하기에 적합한 항체를 선별하는 방법을 제공한다.
본 발명에 따른 항체-약물 결합체의 제조에 있어서, 항체의 N-말단, 구체적으로는 α-아민에 약물을 결합시켜 항체-약물 결합체를 효과적으로 제조하기에 적합한 항체를 검색하여 선별할 수 있다.
이하, 하기 실시예를 통하여 본 발명을 더욱 상세하게 설명하기로 한다. 이들 실시예는 단지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는다.
실시예 1: 모델 항체의 선정
본 발명의 항체-약물 결합체에 대해 대표적으로 항체-싸이토톡신 결합체를 제조하기 위하여, 링커가 존재하는 싸이토톡신이 위치 선택적(Site selective)으로 항체에 결합하는지 확인하기 위해 항-HER2 항체인 트라스투주맙(Trastuzumab), 항-CD56 항체인 로보투주맙(Lorvotuzumab), 항-CD30 항체인 브렌투시맙(Brentuximab), 및 항-GPNMB(glycoprotein NMB) 항체인 글렘바투무맙(Glembatumumab)을 모델 항체로 사용하였다.
상기의 항체들은 공지의 아미노산 서열 정보를 이용하여 발현 벡터를 구축하고 CHO 세포주에서 stable cell line 구축, 혹은 임시 발현을 통해 발현 시키고 배양, 정제하였다.
실시예 2: 톡신(Toxin)의 합성
알데하이드 링커가 말단에 연결된 모노메틸 오리스타틴 F(Monomethyl Auristatin F, MMAF) 독소를 합성하였다(레고켐바이오사이언스 또는 XcessBioscience)(도 1). 또한, MMAF 외에 다른 종류의 독소에도 본 발명에 따른 N-말단 컨쥬게이션 방법의 적용 가능성을 확인하기 위하여 모노메틸 오리스타틴 E(Monomethyl Auristatin E, MMAE)를 합성하여 비교하였다(XcessBioscience, 미국).
실시예 3: 단일클론 항체-싸이토톡신 결합체 제조
3-1. 본 발명에 따른 단일클론항체-약물 결합체의 제조
항체를 100mM 인산칼륨 pH5.49 완충 용액으로 교환하여 약 7.1mg/ml로 농축하였다. 이후 알데하이드 반응기를 가지는 링커와 연결되어 있는 MMAF(레고켐바이오사이언스, 한국)를 50% DMSO(Dimethyl sulfoxide) 용매에 녹여 2.5mg/ml이 되도록 하였다. 그리고 나서 최종 70mM 인산칼륨 pH6.0, 항체농도 5.0mg/ml, 14% DMSO, MMAF 농도 0.3mg/ml, 항체의 α-아민과 MMAF의 몰비가 약 1:2.3(또는 항체와 MMAF의 몰비가 1:9)가 되도록 준비된 항체 용액과 MMAF 용액을 혼합하였다. 상기 반응 용액에 NaCNBH3(Sigma사, 미국)를 최종 20mM이 되도록 첨가한 후, 4℃에서 12시간 동안 서서히 교반시키면서 반응시켰다. 반응하지 않은 항체 및 링커와 연결된 MMAF를 분리하기 위하여 세파덱스 G-25컬럼(GE 헬스케어, 미국) 또는 리소스페닐컬럼(Resource Phe, GE헬스케어, 미국)을 사용하였다. 이러한 과정으로 항체 한 분자에 약 3개의 MMAF 독소가 항체의 아미노 말단에 선택적으로 결합된 형태를 제조하였다(도 2).
3-2. 대조군 항체-약물 결합체의 제조
기존 기술로 제조한 대조군 항체-약물 결합체는 시스테인 결합(Cys conjugation, Thiomab(HC-A114C) + Mal-C6-MMAF), 티올 결합(Mal-C6-MMAF), 및 라이신 결합(SMCC 링커, SH-C6-MMAF)을 통하여 구현하였다.
티올 결합 항체는 pH 8.0에서 TCEP로 항체를 환원시킨 후 Mal-C4-MMAF를 넣어 0℃에서 3시간 동안 반응시켰다. 반응 후 시스테인을 넣어 추가로 반응시킨 후, 반응을 종결시키고, G25 Desalting 컬럼 (GE healthcare, 미국)을 사용하여 1X PBS로 치환하여 반응을 종료했다.
시스테인 결합 항체는 정제된 항체의 시스테인을 활성화시킨 후, Mal-C6-MMAF를 넣어 티올 결합 항체와 유사한 과정을 수행하여 컨쥬게이션을 수행하였다.
라이신 결합 항체의 결합체는 Immunogen 사 특허(WO2005037992)를 참고하여 제조하였다. 먼저 항체와 SMCC 링커를 반응시키고 반응하지 않은 SMCC를 버퍼교환을 통해 제거하였다. 항체-SMCC 결합체는 다시 티올기를 포함하는 SH-C4-MMAF(Concortis bioscience, 미국)와 반응시켜 항체-SMCC-MMAF 결합체를 제작하였다.
본 발명에 해당하는 α-아민 결합을 통해 제조된 항체-싸이토톡신 결합체를 포함하여 정리하면, 하기 표 1과 같다.
표 1
항체-약물 결합체
결합 종류 결합 조건 결합체 명칭 (Trastuzumab, MMAF 사용 시)
Cys 결합 Thiomab(HC A114C), Mal-C6-MMAF Thiomab-MMAF
Thiol 결합 Mal-C6-MMAF T-C-MMAF
Lys 결합 SMCC 링커, SH-C6-MMAF T-K-MMAF
Amine 결합 ALD-C6-MMAF (약산성 pH 조건) T-N-MMAF
상기 방법을 통하여 제조한 4개의 물질을 분석하여, DAR(Drug antibody ratio) 및 결합 위치를 확인하였다. 이는 LC-MS 및 펩타이드 맵핑을 통하여 확인하였다.
실시예 4: 물리화학적 특성 및 생물학적 활성
4-1. 분자량 분석
항체-약물 결합체(T-N-MMAF)의 분자량을 LC-MS 분석을 통해 확인하였다. 사용한 약물(MMAF)의 결합 시 분자량의 이론값은 824.54 Da이고, 트라스투주맙의 분자량은 145 kDa이다. 따라서, 질량 분석을 통해 약물의 항체 결합 여부와 항체 한 분자에 결합한 약물의 개수도 동시에 확인할 수 있었다.
실시예 3에 따라 제조한 T-N-MMAF에 대해 DAR을 결정하기 위해 LC/MS로 분자량을 분석하였다. 제조된 시료는 PNGaseF로 당사슬을 제거한 후 ACQUITY UPLC BEH 200 SEC 컬럼을 통해 분리 후 Waters Synapt G2-S 시스템에 시료를 주입하여 질량을 분석하였고, 그 결과를 도 3에 나타내었다.
그 결과, 도 3에 나타낸 바와 같이, 약물이 하나도 결합하지 않은 화학종(D0)에서부터 최고 7개가 붙은 화학종(D7)까지 검출이 되었으며 부착된 약물의 개수는 각 피크간 분자량차이가 약물의 분자량과 일치하거나 유사함을 바탕으로 판단하였고, 그 상대함량은 하기 표 2에 나타낸 바와 같았다. DAR는 각 화학종의 가중평균으로 구하였으며 그 값은 DAR=3.2였다.
표 2
No. of bound drug Mass (Da) Relative intensity(%) Da
0 145179.5 1.8 -
1 146005.3 10.7 825.8
2 146833.2 21.2 827.9
3 147661.1 25.4 827.9
4 148488.9 21.0 827.8
5 149317.0 12.5 828.1
6 150145.5 5.0 828.5
7 150964.2 2.3 818.7
DAR 　 3.219
DAR = Sum(Intensity(%) x No. of Drug / 100)Drug moiety mass : 828 Da
4-2. 약물 결합위치
제조된 T-N_MMAF 결합체에서 약물이 결합된 위치는 펩티드 맵핑을 통해 확인하였다. 실시예 3에서 제조한 DAR 3.2의 T-N-MMAF ADC를 Rapigest(Waters)로 변성시킨 후 트립신(Roche)으로 반응시켜 절편을 만들었다. 반응물은 ACQUITY UPLC PST (BEH) C18 컬럼으로 분리하였고 분리된 각 피크는 Waters Synapt G2-S Q/TOF 시스템을 통해 질량 분석하여 어느 서열에 해당되는지 결정하였고, 그 결과를 도 4에 나타내었다.
그 결과, 도 4에 나타낸 바와 같이 컨쥬게이션(conjugation) 되지 않은 모 항체에서는 발견되지 않는 피크들이 크로마토그램에서 검출이 되었다. 질량 분석 결과 해당 절편들은 중쇄 N-말단, 경쇄 N-말단, 중쇄 일부분, 그리고 그 외의 작은 절편들로 확인되었으며 그 비율은 아래 표 3에 나타낸 바와 같다. 따라서 전체 약물 중 75%가 N-말단에 결합되어 있으며 92%가 명확히 정의할 수 있는 세 지점인 N-말단과 중쇄-CH2 영역에 선택적으로 결합되어 있다고 할 수 있다.
표 3
트립신 단편(Trypsin fragment) Ratio
중쇄-N말단 EVQLVESGGGLVQPGGSLR (서열번호 1) 46%
경쇄-N말단 DIQMTQSPSSLSASVGDR (서열번호 2) 29%
중쇄-CH2 THTCPPCPAPELLGGPSVFLFPPKPKDTLMISR (서열번호 3) 17%
그외 - 8%
4-3. 순도 분석
제조한 T-N-MMAF 결합체의 응집체(aggregate) 함량을 확인하기 위해 SE-HPLC 및 SDS-PAGE 분석을 통해 순도 분석을 진행하였다. TSK-Gel3000SWXL 컬럼에 PBS를 이동상으로 하여 크기 배제 크로마토그래피를 수행하였으며 Novex NuPAGE 4-12% 겔을 이용하여 SDS-PAGE를 수행하였다. 크로마토그래피 결과에 대하여 도 5에 나타내었다.
그 결과, 도 5에 나타낸 바와 같이, 단량체의 순도는 98.8%로서 효력시험에 적합한 순도를 확인하였고 단편화나 교차 결합(cross-linking) 등은 관찰되지 않았다.
4-4. 항원결합력
약물 결합 후에도 항원결합력이 유지되는지를 확인하기 위하여, 비아코어TM (BiacoreTM)를 이용한 표면 플라스몬 공명(surface plasmon resonance)을 측정하는 방법으로 약물이 결합된 항체의 항원 결합력을 측정하였다. 대조항체는 천연형 항체를 사용하였다. 항원(ErbB2) 결합력은 비아코어 T200을 이용하여 분석하였으며 CM5 센서 칩(GE healthcare)에 각 항체를 아민 커플링 키트를 이용하여 고정화 시킨 후 ErbB2(R&D systems)를 50, 16.67, 5.56, 1.85, 0.62, 0.21 nM의 농도로 30uL/min 속도로 주입하며 on/off 속도를 측정, 분석하여 kD(M)를 구하였다.
표 4
시료 항원 결합력
Test 1 (10-10 M) Test 2 (10-10 M) 평균 (10-10 M)
트라스투주맙 1.3 2.2 1.8
T-N-MMAF (DAR 1.6) 1.2 0.9 1.1
T-N-MMAF (DAR 3.2) 1.1 0.7 0.9
그 결과, 하기 표 4에 정리된 바와 같이, DAR과 상관없이 약물 결합 후에도 천연형 항체와 유사한 0.1nM 정도의 항원결합력이 유지됨을 확인하였다.
실시예 5: In vitro 세포독성 분석
제조한 항체-싸이토톡신 결합체의 in vitro 효능을 확인하기 위하여 HER2 발현 종양 세포주인 BT474, HCC1954, SKOV-3, JIMT-1 세포주를 이용하여 항-증식 어세이를 수행하였다. 각 세포를 배양하여 1*105 세포/ml로 서스펜션하여 96웰 플레이트에 100 ㎕씩 로딩한다. 세포 배양기에서 3시간 배양 후, 웰 당 다양한 농도구간의 항체-싸이토톡신 결합체를 각각 100 ㎕씩 넣고 세포 배양기에서 4일간 배양한다. CCK-8(Dojindo)를 1:10으로 희석하여 각 웰에 처리 후, 호일에 싸서 세포 배양기에 2~5시간 반응시킨 후 SpectraMax 190 마이크로플레이트 리더 (Molecular Device)를 이용하여 450nm에서 흡광도를 측정하였다.
표 5
Cell line Cytotoxicity (IC50 (pM))
T-N-MMAF(DAR 3.2) T-C-MMAF(DAR 3.6) T-K-MMAF(DAR 3.9)
HCC1954 40 22 45
SKOV-3 104 59 N.D.
JIMT1 253 98 727
BT474 116 49 77
그 결과, 하기 표 5에 나타낸 바와 같이, T-N-MMAF의 세포독성은 총 4종의 암 세포주 모두에서 T-C-MMAF 보다 약간 낮은 세포독성을 보였지만, 생체 내 효력에 영향을 줄 수 있는 의미 있는 세포독성 감소는 없었다.
실시예 6: 안정성 시험
6-1. In vitro 인간 혈청 안정성
실시예 3에서 제조한 T-N-MMAF와 천연형 항체, T-C-MMAF, Thiomab-MMAF 등의 대조구를 사용하여 In vitro 인간 혈청 안정성 시험을 수행하였다. 항체-싸이토톡신 결합체를 1x PBS로 완충액 교환하여 3.33mg/ml로 농축한 후, 항체-싸이토톡신 결합체와 인간 혈청(Sigma사, 미국)의 비율(v/v)을 1:9로 혼합하여 37℃에서 7일간 정치하였다. 7일 후, 보관시료는 MabSelectSure (GE 헬스케어, 미국)을 사용하여 시료에 포함된 항체-싸이토톡신 결합체 이외의 단백질을 제거하여 LC/MS 분석 시 간섭을 최소화하였다. 시험관 조건에서 인간 혈청에서의 안정성은 LC/MS로 분석하여 결과를 아래 표 6에 나타내었다.
표 6
시료 단일클론항체의 상대적 함량(보관 7일, %) 결합체의 상대적 함량(보관 7일, %) DAR의 상대적 함량(보관 7일, %)
Trastuzumab 90.0 - -
T-N-MMAF 89.3 90.5 101.4
T-C-MMAF 49.2 32.3 65.6
Thiomab-MMAF 69.9 59.5 85.1
그 결과, 상기 표 6에 나타낸 바와 같이, 7일 보관 후 대조구인 천연형 항체와 비교해서 T-N-MMAF의 함량 및 DAR 변화가 관찰되지 않았다. 반면, 비교 항체-약물 결합체인 T-C-MMAF 및 Thiomab-MMAF의 경우는 전체 항체 함량 및 DAR이 감소한 것을 확인할 수 있었다.
6-2. 랫트 약물동력학(Rat PK)
랫트 PK 실험을 통해 생체 내 안정성을 비교 및 확인하였다. 3종 ADCs(T-K-MMAF, T-C-MMAF, T-N-MMAF)와 트라스투주맙을 2.5mg/kg 용량으로 암컷 Sprague-Dawley 랫트에 1회 정맥 주사하였다. 물질투여 후 0.05시간, 0.5 시간, 1시간, 6시간, 24시간, 72시간, 168시간, 240시간, 336시간 후에 채혈하였다. 혈액 내 ErbB2에 결합하는 모든 항체를 분석하는 전체 항체(Total antibody) 분석법과 약물 결합이 유지되고 있는 항체를 분석하는 결합 항체(Conjugated antibody) 분석법을 ELISA 방법으로 실시하였다.
전체 항체의 함량은 아래와 같은 ELISA법으로 분석하였다:
96 웰 마이크로플레이트를 ErbB2(R&D systems)로 코팅한 후, 시료를 플레이트에 넣고 37℃의 온도에서 1시간 동안 반응하였다. PBST를 사용하여 고정되지 않는 모든 잔여물을 세척한 후에 HRP 결합된 항-인간 카파 경쇄 항체(HRP-conjugated anti-Human kappa light chain antibody)와 3,3',5,5'-테트라메틸벤지딘 (TMB, Sigma, T0440)을 사용하여 450nm에서 흡광도를 측정하는 방법으로 시료 내 전체 항체 량을 결정하였다.
결합 항체 분석법은 상기 기술한 방법과 유사한 방법으로 진행하여 항-MMAF 항체(영인프론티어)로 96-웰 마이크로플레이트를 코팅한 후, 시료를 플레이트에 넣고 37℃의 온도에서 1시간 동안 반응하였다. 이후 바이오티닐화된 ErbB2 (ACROBIOSYSTEMS, 미국) , 스트렙트아비딘-HRP, TMB를 차례로 넣어 발색 후 450nm에서 흡광도를 측정하여 결합 항체의 농도를 결정하였고, 그 결과를 도 6 내지 8 및 하기 표 7에 나타내었다.
표 7
랫트에 ADC를 2.5mg/kg 용량으로 투여한 다음, 측정한 PK 파라미터
Treatment (n=5, each)2-compartment modeling Total Ab Conjugated Ab
AUC(hr*㎍/ml) T1/2(hr) Cmax(㎍/ml) AUC(hr*㎍/ml) T1/2(hr) Cmax(㎍/ml)
Trastzumab 6964.9 115.7 128.1 - - -
T-N-MMAF 6795.7 122.1 111.2 6813.2 118.3 112.4
T-C-MMAF 5933.5 111.6 94.3 4315.4 84.6 93.7
T-K-MMAF 4324.3 65.1 157.5 3781.7 53.2 190.0
실시예 7: 항암모델동물에서 항암효과 확인실험
서로 다른 기술로 제작된 3종의 ADC의 효력과 약물-항체 비율 (DAR)에 의한 효력차이를 비교하기 위해 누드 랫트를 이용한 유방암 (HCC 1954) 이종이식 모델에서 in vivo 효능 테스트를 수행하였다.
4종의 ADC, 즉 T-N-M (DAR 약 1.6, 3.2), T-C-M(DAR 약 3.7), T-K-M(DAR 약 3.9)를 HCC1954 세포가 이식된 랫트에 각각 1 mg/kg의 용량으로 단회 정맥 투여한 후 각 시험군 간의 이식종양 성장억제 정도를 비교하였고, 그 결과를 하기 도 9 및 10에 나타내었다.
그 결과, 도 9 및 10에 나타낸 바와 같이, 본 발명에 따른 항체는 대조군 및 비교 항체 결과와 비교하여 항암 효과가 우수하였다.
실시예 8: 독성시험
ADC의 제조기법에 따라 달라지는 안정성이 독성에 영향을 주는지 SD 랫트를 이용한 단회 투여 독성 시험을 수행하였다. 세 종류의 ADC를 각각 고용량인 200mpk로 정맥을 통해 단회 투여하였다. 비교군으로 단독항체와 MMAF도 200mpk의 용량의 노출에 맞춰 투여하였다. 체중은 시험물질 투여 시점부터 실험종료 시(12일)까지 매일 측정하였다. 혈액, 생화학 분석은 투여 후 5일에 진행하였다. 측정항목은 간독성과 대표적인 혈액학적 독성 확인을 위해 AST와 ALT, 호중구(Neutrophil), 혈소판(Platelet)이다.
8-1. 체중변화
체중변화에 대한 결과를 도 11에 나타내었다. 그 결과, 도 11에 나타낸 바와 같이, T-C-MMAF, T-K-MMAF군은 T-N-MMAF 군 및 나머지 군에 비해 뚜렷한 체중 감소를 보였다. 특히 T-C-MMAF 투여군은 8일차 이후 한마리를 제외한 모든 개체가 폐사하였다.
8-2. 생화학검사 (간독성)
간독성 유발 여부를 비교해 보기 위해 투여 후 5일차에 채취한 혈액에 대해 혈액 생화학분석을 수행하였다. Au480 (Beckman coulter, 미국) 화학분석기를 이용하여 수행하였으며 그 중 간독성의 지표가 되는 AST(Aspartate Aminotransferase), ALT(Alanine Aminotransferase)의 역가를 도 12에 표시하였다.
그 결과, 도 12에 나타낸 바와 같이, 본 발명에 따른 T-N-MMAF군은 PBS를 포함한 다른 대조군과 크게 차이가 나지 않는 변화를 보여 급격하거나 심각한 간독성을 유발하지 않았음을 관찰할 수 있었다. 그러나 T-C-MMAF, T-K-MMAF 군에서는 상당한 증가가 관찰되어 약물 투여로 인한 간독성의 발생을 관찰할 수 있었다.
8-3. 혈액학검사 (호중구감소증, 혈소판감소증)
현재 허가 받은 ADC들의 주요 임상적 독성이 혈액학적 특성으로 나타나므로, 투여 후 5일차에 채취한 혈액에 대해서 Hemavet 950 FS (Drew Scientific Inc., 미국) 혈액학분석기를 이용하여 혈액학적 분석을 수행하였고, 그 결과를 도 13에 표시하였다.
그 결과, 호중구(Neutrophil)의 숫자의 경우, T-N-MMAF 투여군은 PBS를 포함한 대조군에 비해 두드러진 변화를 보이지는 않아 급격하고 심각한 혈액학적 독성은 유발되지 않았다고 볼 수 있었다. 그러나 T-C-MMAF 군에서는 현저한 감소를 보였고 T-K-MMAF 군의 경우는 현격히 증가된 수치를 보였는데, 투여 직후 감소하였다가 재상승한 것으로 추정되었다. 따라서, 이 두 군에 대해서는 약물 투여로 인해 급격한 혈액학적 독성이 유발되었다고 결론 내릴 수 있었다.
혈소판수치의 경우, T-N-MMAF 투여군은 PBS를 포함한 다른 대조군에 비해 차이를 확인할 수 있는 정도로 소폭 감소하였다. 그러나 T-C-MMAF, T-K-MMAF 군의 경우는 현격한 감소를 보여 투여물질에 의해 급격한 독성이 발생하였음을 보여주었다.
실시예 9: 플랫폼 기능 확인
본 발명의 항체-약물 결합체 제조방법이 다양한 항체-약물 결합체에 사용될 수 있는지 가능성을 확인하였다. 이를 위해, 다양한 약물 또는 다양한 항체 및 다양한 항체 형태에 적용하여 기능을 확인하고자 하였다.
9-1. 약물 종류에 따른 기능 확인
다양한 약물에 대하여 상기 본 발명의 항체-약물 결합체 제조방법이 사용될 수 있는지 확인하기 위하여, 대표적으로 모델 항체로서 트라스투주맙 항체를 이용하여, 다양한 약물로 N 말단 결합을 진행하였다. 구체적으로는 MMAF와 MMAE 2종의 약물을 사용하였으며 MMAF를 사용하여 얻은 결과들은 앞서 여러 실시예에 기술하였다. 실시예 3에서 기술한 방법에 따라 항체-약물 결합체를 제조하였으며 각각 제조한 항체-약물 결합체를 수득하여 DAR 분석 및 in vitro 안정성, Rat PK를 전술한 실시예의 방법에 따라 실시하였다.
9-1-1. T-N-MMAE의 제조
실시예 3의 방법에 따라, MMAE(XcessBioscience, 미국)와 항체 간의 결합체를 만들었고, DAR을 결정하기 위해 LC/MS로 분자량을 분석한 결과를 도 14 및 하기 표 8에 나타내었다.
표 8
T-N-MMAE의 DAR별 화학종 분포도 및 평균 DAR
No. of drug Mass (Da) Relative content (%) Delta mass
D0 N/D N/D
D1 146061.05 6.3
D2 146863.77 14.3 802.72
D3 147672.80 23.3 809.03
D4 148484.33 24.2 811.53
D5 149297.30 16.5 812.97
D6 150112.25 8.6 814.95
D7 150922.84 6.8 810.59
DAR 3.83
9-1-2. T-N-MMAE의 인간 혈청 내 안정성 확인
실시예 6의 방법에 따라, T-N-MMAE ADC의 혈청내 안정성을 평가하였다. 각 시료에서의 ADC의 농도는 ELISA를 이용한 전체 항체 분석법에 따라 측정하였으며 DAR의 변화는 LC/MS를 이용하여 측정하였다.
표 9
μg/ml % DAR %
Day 0 364.8 100% 3.17 100%
Day 3 346.9 95% 3.33 105%
Day 7 294.8 81% 3.28 103%
9-1-3. T-N-MMAE의 Rat PK
제조된 MMAE 결합체의 체 내 안정성을 평가하기 위해서 SD 랫트를 이용한 PK 측정시험을 전술한 실시예 6과 유사하게 수행하였다. 약술하면 2.5mg/pk의 ADC를 암컷 SD 랫트에 투여하였고 12분, 30분, 1시간, 6시간, 24시간, 3일, 7일, 10일, 14일, 17일, 21일 후에 채혈을 하여 그 농도를 ELISA 기법을 사용하여 전체 항체 및 결합 항체로 나누어 전술한 방법에 따라 측정하였다.
표 10
T-N-MMAE 의 rat PK 파라미터.
Group AUC(hr*㎍/ml) Conjugate/Total ratio half-life (hr) Conjugate/Total ratio
trastuzumab 5868.83 169.6
T-N-MMAF (T) 6688.95 191.8
T-N-MMAF (C) 6871.71 103% 203.3 106%
T-N-MMAE (T) 5639.24 173.9
T-N-MMAE (C) 5690.96 101% 163.7 94%
* 시험간 비교를 위해 trastuzumab과 T-N-MMAF를 포함하였다.
그 결과, 도 15 및 상기 표 10에 나타낸 바와 같이, T-N-MMAE는 전체 항체 및 결합 항체 모두 모항체와 차이가 크게 나지 않는 프로파일을 보이고 있어 MMAE로 항체-약물 복합체를 제작하여도 MMAF와 유사한 안정성을 기대할 수 있었다.
9-1-4. T-N-MMAE의 활성
제작된 MMAE의 생물학적 활성을 확인하기 위해서 4종의 종양세포주를 사용하여 그 활성을 측정하였고, 그 결과를 하기 표 11에 나타내었다. 사용한 방법은 실시예 5와 유사하였다.
표 11
Her2 발현 종양 세포주에 대한 T-N-MMAE의 세포 독성
IC50[nM]
#1 #2 Average
HCC1954 0.39 0.26 0.33
SKOV-3 3.04 2.62 2.83
JIMT1 4.00 3.51 3.76
BT474 0.56 0.70 0.63
그 결과, 측정된 IC50는 0.33-3.76nM 범위였으며 이는 문헌상으로 보고된 트라스투주맙/MMAE 티올 결합체의 BT474 세포주에 대한 활성(0.47nM)과 유사하였다. 따라서 본 발명에 따른 α-아민을 이용한 N 말단 선택적 결합 방법이 다른 형태의 약물에도 적용할 수 있다고 할 수 있다.
9-2. 항체 종류에 따른 기능 확인
다양한 항체에 대하여 상기 본 발명의 항체-약물 결합체 제조방법이 사용될 수 있는지 확인하기 위하여, 3종의 항암 항체(Brentuximab, Lorvotuzumab, Glembatumumab)에 N 말단 결합을 진행하여, DAR 분석 및 in vitro 안정성을 측정하였다.
9-2-1. 브렌투시맙(Brentuximab)
9-2-1-1. 브렌투시맙-N-MMAF의 제조
CHO 세포주로부터 발현시킨 브렌투시맙을 가지고 실시예 3의 방법에 따라 브렌투시맙-N-MMAF(B-N-MMAF)를 제조하였다. 제조된 ADC는 도 16 및 하기 표 12와 같은 LC/MS 프로파일을 나타내었으며, D0-D6까지의 화학종이 검출되었고, DAR은 2.90으로 계산되었다.
표 12
No. of bound drug Mass (Da) Relative content (%) Delta mass(Da)
D0 145208.6 3.1
D1 146034.9 14 826.3
D2 146863.3 24.4 828.4
D3 147692 26.4 828.7
D4 148520.7 18.2 828.7
D5 149349.7 9.3 829
D6 150177.5 4.7 827.8
DAR 2.90
9-2-1-2. 리간드 결합 어세이
컨쥬게이션(Conjugation)에 의해 항체의 특성이 변하는지를 판단하기 위해 항원에 대한 결합력을 ELISA 방법으로 측정, 비교하였다. 항원인 CD30(R&D systems)을 96 웰 마이크로플레이트에 100μg 코팅한 후, 1% BSA로 37℃ 1시간 블록킹하였다. 블록킹 용액을 제거한 후 시료를 플레이트에 넣고 37℃ 1시간 반응하였다. PBST (PBS + 0.05% 트윈 20)으로 5번 세척 후 HRP 컨쥬게이션된 항-인간 카파(kappa) 경쇄 항체를 1000배 희석하여 플레이트에 넣고 37℃ 1시간 반응하였다. PBST로 5번 세척 후 TMB(Sigma)를 넣고 10분 발색하였다. 1N H2SO4를 넣어 반응을 정지 시킨 후, 450nm에서 흡광도를 측정하였고, 그 결과를 도 17에 나타내었다. 도 17에서, 동그라미(○)로 표시한 선은 컨쥬게이션을 수행하지 않은 브렌투시맙에 대한 결과, 사각형(◇)으로 표시한 선은 DAR 2.90의 B-N-MMAF에 대한 결과, 그리고 삼각형(△)으로 표시한 선은 DAR 4.22의 B-N-MMAF에 대한 결과를 나타낸 것이다. 결과에서 보여지는 바와 같이 컨쥬게이션 수행 후에도 DAR 값에 상관없이 항원에 대한 결합력은 변하지 않았다.
9-2-1-3. In vitro 세포독성
제조한 항체-싸이토톡신 결합체의 in vitro 효능을 확인하기 위하여 CD30 발현 세포주인 Karpas-299, L-540 세포주를 이용하여 항-증식 어세이를 수행하였다.
구체적으로, 각 세포를 배양하여 1*105 세포/ml로 서스펜션하여 96 웰 플레이트에 100㎕씩 로딩하였다. 세포 배양기에서 3시간 배양 후, 웰당 다양한 농도구간의 항체-싸이토톡신 결합체를 각각 100 ㎕씩 넣고 세포 배양기에서 4일간 배양하였다. CCK-8(Dojindo)를 1:10으로 희석하여 각 웰에 처리 후, 알루미늄호일에 싸서 세포 배양기에 2~5시간 반응하였다. SpectraMax 190 마이크로플레이트 리더를 이용하여 450nm에서 흡광도를 측정하였고, 그 결과를 하기 표 13에 나타내었다.
표 13
Cell line IC50(pM)
Karpas-299 32.2
L-540 37.1
그 결과, Karpas-299, L-540 두 개의 세포 주 모두에서 모두 40pM 미만의 세포독성을 관측하였다.
9-2-2. 로보투주맙(Lorvotuzumab)
9-2-2-1. 로보투주맙-N-MMAF의 제조
CHO 세포로부터 임시발현한 로보투주맙을 가지고 전술한 실시예 3의 방법에 따라 로보투주맙-N-MMAF(L-N-MMAF)를 제조하였다. 그 결과, 제조된 ADC는 도 18 및 하기 표 14와 같은 컨쥬게이션 프로파일을 보였으며, DAR는 3.33으로 결정되었다.
표 14
No. of bound drugs Mass (Da) Relative content (%) Delta mass (Da)
D0 147001.5 3.3
D1 147830.8 10.8 829.3
D2 148657.9 18.6 827.1
D3 149486.6 22.7 828.7
D4 150315.4 20.1 828.8
D5 151144.7 13.7 829.3
D6 151973.5 7 828.8
D7 152803 3.7 829.5
DAR 3.329
9-2-2-2. 리간드 결합 어세이
컨쥬게이션에 의한 항체의 특성변화가 있는지 알아보기 위해 컨쥬게이션 전후 항원에 대한 결합력이 변하는지 ELISA 방법을 이용하여 시험하였다. 항원인 CD56(R&D systems, 2408-NC-050)을 96 웰 마이크로플레이트에 1μg/ml의 농도로 코딩한 후, 1% BSA로 37℃ 1시간 블록킹하였다. 블록킹 용액을 제거한 후 시료를 플레이트에 넣고 37℃의 온도에서 1시간 반응하였다. PBST(PBS +0.05% tween 20)으로 5번 세척 후 HRP 컨쥬게이션된 항-인간 카파 경쇄 항체를 1000배 희석하여 플레이트에 넣고 37℃ 1시간 반응하였다. PBST로 5번 세척 후 TMB (Sigma)를 넣고 10분 발색하였다. 1N H2SO4를 넣어 반응을 정지 시킨 후 450nm에서 흡광도를 측정하였고, 그 결과를 도 19에 나타내었다. 도 19에서 동그라미(○)로 표시한 선은 약물과 컨쥬게이션하지 않은 항체에 대한 결과를, 삼각형(△)으로 표시한 선은 DAR 2.5의 L-N-MMAF에 대한 결과를, 사각형(◇)으로 표시한 선은 DAR 3.3의 L-N-MMAF에 대한 결과를 나타내는 것이다. 그 결과, DAR 정도에 상관없이 그 결합력이 유지되고 있음을 알 수 있었다.
9-2-2-2. In vitro 세포독성
제조한 항체-싸이토톡신 결합체의 in vitro 효능을 확인하기 위하여 OPM-2 세포주를 이용하여 항-증식 어세이를 수행하였다. 각 세포를 배양하여 1*105 세포/ml로 서스펜션하여 96 웰 플레이트에 100 ㎕씩 로딩하였다. 세포 배양기에서 3시간 배양 후, 웰당 다양한 농도 구간의 항체-싸이토톡신 결합체를 각각 100 ㎕씩 넣고 세포 배양기에서 4일간 배양하였다. CCK-8(Dojindo)를 1:10으로 희석하여 각 웰에 처리 후, 호일에 싸서 세포 배양기에 2~5시간 반응하였다. SpectraMax 190 마이크로플레이트 리더기를 이용하여 450nm에서 흡광도를 측정하였고, 그 결과를 표 15에 나타내었다.
표 15
IC50[nM]
OPM-2 L-N-MMAF DAR 2.5 52.9
L-N-MMAF DAR 3.3 41.9
그 결과 상기 표에서 확인할 수 있는 바와 같이 본 발명에 따른 L-N-MMAF 항체는 42-53nM 수준의 세포 독성을 나타내었다.
9-2-3. 글렘바투무맙(Glembatumumab)
9-2-3-1. In vitro 세포독성
제조한 항체-싸이토톡신 결합체의 in vitro 효능을 확인하기 위하여 피부암세포주인 SK-MEL-2 세포주를 이용하여 항-증식 어세이를 수행하였다. 각 세포를 배양하여 1*105 세포/ml로 서스펜션하여 96 웰 플레이트에 100 ㎕씩 로딩하였다. 세포 배양기에서 3시간 배양 후, 웰당 다양한 농도구간의 항체-싸이토톡신 결합체를 각각 100 ㎕씩 넣고 세포 배양기에서 4일간 배양하였다. CCK-8(Dojindo)를 1:10으로 희석하여 각 웰에 처리 후, 호일에 싸서 세포 배양기에 2~5시간 반응하였다. SpectraMax 190 마이크로플레이트 리더기를 이용하여 450nm에서 흡광도를 측정하였고, 그 결과를 표 16에 나타내었다.
표 16
SK-MEL-2 IC50(nM)
G-N-MMAF DAR 2.2 5.47
G-N-MMAF DAR 3.4 3.36
그 결과 상기 표에서 확인할 수 있는 바와 같이 본 발명에 따른 G-N-MMAF는 3-5nM 수준의 세포독성을 나타내었다.
상기와 같은 결과들은 본 발명에서 새롭게 확인한 위치 특이적, 즉 항체의 중쇄 또는 경쇄의 N-말단 아미노산 잔기에 약물을 결합시킨, 새로운 플랫폼의 항체-약물 결합체가 안정성이 높으면서도 항체의 표적 특이성의 저해가 없으며, 또한 결합된 약물에 의해 항체의 치료가 배가될 수 있음을 시사하는 것이다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그 리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범 위에 포함되는 것으로 해석되어야 한다.

Claims (21)

  1. 항체의 중쇄 또는 경쇄의 N-말단 아미노산 잔기에 세포독성 약물(cytotoxic drug)이 결합된, 항체-약물 결합체(antibody-drug conjugate, ADC).
  2. 제1항에 있어서,
    상기 항체의 중쇄 또는 경쇄의 N-말단의 α-아민기에 세포독성 약물이 결합된 것인, 항체-약물 결합체.
  3. 제2항에 있어서,
    α-아민기와 반응하여 가교할 수 있는, 세포독성 약물의 반응기를 통하여 세포독성 약물이 항체에 연결된 형태인 것인, 항체-약물 결합체.
  4. 제3항에 있어서,
    상기 α-아민기와 반응하여 가교할 수 있는 반응기는 아이소티오시아네이트(isothiocyanate), 아이소시아네이트(isocyanates), 아실 아자이드(acyl azide), NHS 에스터(NHS ester), 설포닐 클로라이드(sulfonyl chloride), 알데하이드(aldehyde), 글리옥살(glyoxal), 에폭사이드(epoxide), 옥시레인(oxirane), 칼보네이트(carbonate), 아릴 할라이드(aryl halide), 이미도에스터(imidoester), 카보이미드(carbodiimide), 안하이드라이드(anhydride) 및 플루오로페닐 에스터(fluorophenyl ester)로 이루어진 군에서 선택된 것인, 항체-약물 결합체.
  5. 제1항에 있어서,
    상기 항체는 전장 항체, 또는 항원 결합 도메인을 포함하는 항체 단편 형태인 것인, 항체-약물 결합체.
  6. 제5항에 있어서,
    상기 항체는 IgG, scFv, Fv, Fab, Fab' 및 F(ab')2로 이루어진 군으로부터 선택된 형태를 가지는 것인, 항체-약물 결합체.
  7. 제1항에 있어서,
    상기 세포독성 약물은 마이크로튜불린(microtubulin) 구조 형성 억제제, 유사분열(meiosis) 억제제, RNA 중합효소 억제제, 토포아이소머라아제(topoisomerase) 억제제, DNA 인터컬레이터(DNA intercalators), DNA 알킬레이터(DNA akylator), 리보솜 억제제, 방사선 동위원소 및 독소로 이루어진 군으로부터 선택되는 것인, 항체-약물 결합체.
  8. 제7항에 있어서,
    상기 세포독성 약물은 메이탄시노이드(maytansinoid), 오리스타틴(auristatin), 돌라스타틴(dolastatin), 튜브라이신(tubulysin), 칼리케아미신(calicheamicin), 피롤로벤조디아제피네스(pyrrolobenzodiazepines), 독소루비신(doxorubicin), 듀오카마이신(duocamycin), 카보플라틴(파라플라틴)[Carboplatin(paraplatin)], 시스플라틴(cisplatin), 시클로포스파미드(cyclophosphamide), 이포스파미드(ifosfamide), 니드란(nidran), 질소머스타드(메클로에타민 염산염)[nitrogen mustar(mechlorethamine HCL)], 블레오마이신(bleomycin), 미토마이신 C(mitomycin C), 시타라빈(cytarabine), 플루로우라실(flurouracil), 젬시타빈(gemcitabine), 트리메트렉세이트(trimetrexate), 메토크렉세이트(methotrexate), 에토포시드(etoposide), 빈블라스틴(vinblastine),
    비노렐빈(vinorelbine), 알림타(alimta), 알트레타민(altretamine), 프로카바진(procarbazine), 탁솔(taxol), 탁소텔(taxotere), 토포테칸(topotecan), 이리노테칸(irinotecan), 트리코테센(trichothecene), CC1065, 알파-아마니틴(alpha-amanitin) 균체 외독소 및 식물독소로 이루어진 군으로부터 선택된 것인, 항체-약물 결합체.
  9. 제8항에 있어서,
    상기 오리스타틴은 모노메틸 오리스타틴 E(Monomethyl auristatin E) 또는 모노메틸 오리스타틴 F(Monomethyl auristatin F)인 것인, 항체-약물 결합체.
  10. 제1항에 있어서,
    상기 항체는 암세포 표면 항원에 특이적으로 결합하는 것인, 항체-약물 결합체.
  11. 제10항에 있어서,
    상기 암세포 표면 항원은 CD19, CD20, CD30, CD33, CD37, CD22, CD56, CD70, CD74, CD138, Muc-16, mesothelin, HER2, HER3, GPNMB(glycoprotein NMB), IGF-1R, BCMA(B cell maturation antigen), PSMA(prostate-specific membrane antigen),　EpCAM(Epithelial cell adhesion molecule) 및 EGFR(epidermal growth factor receptor)로 이루어진 군에서 선택된 것인, 항체-약물 결합체.
  12. 제1항에 있어서,
    상기 항체는 항-HER2 항체, 항-CD30 항체, 항-CD56 항체 및 항-GPNMB(glycoprotein NMB) 항체로 이루어진 군으로부터 선택된 것인, 항체-약물 결합체.
  13. 제12항에 있어서,
    상기 항체는 트라스투주맙(Trastuzumab), 로보투주맙(Lorvotuzumab), 브렌투시맙(Brentuximab) 및 글렘바투무맙(Glembatumumab)으로 이루어진 군에서 선택된 것인, 항체-약물 결합체.
  14. 항체의 중쇄 또는 경쇄의 N-말단 아미노산 잔기에 면역억제제가 결합된, 항체-약물 결합체(antibody-drug conjugate, ADC).
  15. α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 세포독성 약물 또는 면역억제제와 항체를 반응시켜, 항체의 중쇄 또는 경쇄의 N-말단의 α-아민기에 세포독성 약물 또는 면역억제제를 연결시키는 단계를 포함하는, 제1항 내지 제14항 중 어느 한 항의 항체-약물 결합체의 제조방법.
  16. 제15항에 있어서,
    상기 제조방법은 추가로 결합체를 형성하지 않은 항체, 및 세포독성 약물 또는 면역 억제제를 포함하는 반응 산물로부터 항체-약물 결합체를 분리하는 단계를 포함하는 것인, 제조방법.
  17. 제15항에 있어서,
    상기 α-아민기와 반응하여 가교할 수 있는 반응기는 아이소티오시아네이트(isothiocyanate), 아이소시아네이트(isocyanates), 아실 아자이드(acyl azide), NHS 에스터(NHS ester), 설포닐 클로라이드(sulfonyl chloride), 알데하이드(aldehyde), 글리옥살(glyoxal), 에폭사이드(epoxide), 옥시레인(oxirane), 칼보네이트(carbonate), 아릴 할라이드(aryl halide), 이미도에스터(imidoester), 카보이미드(carbodiimide), 안하이드라이드(anhydride) 및 플루오로페닐 에스터(fluorophenyl ester)로 이루어진 군에서 선택된 것인 제조방법.
  18. 제1항 내지 제13항 중 어느 한 항의 항체-약물 결합체를 포함하는, 암 치료용 약학적 조성물.
  19. 제14항의 항체-약물 결합체를 포함하는, 자가면역질환의 치료용 약학적 조성물.
  20. 제1항 내지 제13항 중 어느 한 항의 항체-약물 결합체를 암 의심 개체에 투여하는 단계를 포함하는, 암의 치료 방법.
  21. 제14항의 항체-약물 결합체를 자가면역질환 의심 개체에 투여하는 단계를 포함하는, 자가면역질환의 치료 방법.
PCT/KR2014/005589 2013-06-24 2014-06-24 안정성이 개선된 항체-약물 결합체 및 이의 용도 WO2014208987A1 (ko)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP14817162.2A EP3015116B1 (en) 2013-06-24 2014-06-24 Antibody-drug conjugate having improved stability and use thereof
CN201480035895.0A CN105377307B (zh) 2013-06-24 2014-06-24 具有改进的稳定性的抗体-药物缀合物及其用途
BR112015032200A BR112015032200A2 (pt) 2013-06-24 2014-06-24 conjugado anticorpo-droga com estabilidade melhorada, método de preparação, composição farmacêutica e uso do mesmo
AU2014299561A AU2014299561B2 (en) 2013-06-24 2014-06-24 Antibody-drug conjugate having improved stability and use thereof
JP2016523642A JP6208864B2 (ja) 2013-06-24 2014-06-24 安定性が改善された抗体−薬物結合体およびこれの用途
RU2016102116A RU2670748C9 (ru) 2013-06-24 2014-06-24 Конъюгаты антител с лекарственными агентами, обладающие улучшенной стабильностью, и их применение
CA2916202A CA2916202C (en) 2013-06-24 2014-06-24 Antibody-drug conjugate having improved stability and use thereof
US14/898,126 US10071170B2 (en) 2013-06-24 2014-06-24 Antibody-drug conjugate having improved stability and use thereof
US16/059,761 US20180360986A1 (en) 2013-06-24 2018-08-09 Antibody-drug conjugate having improved stability and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20130072686 2013-06-24
KR10-2013-0072686 2013-06-24

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/898,126 A-371-Of-International US10071170B2 (en) 2013-06-24 2014-06-24 Antibody-drug conjugate having improved stability and use thereof
US16/059,761 Division US20180360986A1 (en) 2013-06-24 2018-08-09 Antibody-drug conjugate having improved stability and use thereof

Publications (1)

Publication Number Publication Date
WO2014208987A1 true WO2014208987A1 (ko) 2014-12-31

Family

ID=52142250

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2014/005589 WO2014208987A1 (ko) 2013-06-24 2014-06-24 안정성이 개선된 항체-약물 결합체 및 이의 용도

Country Status (10)

Country Link
US (2) US10071170B2 (ko)
EP (1) EP3015116B1 (ko)
JP (1) JP6208864B2 (ko)
KR (1) KR101641206B1 (ko)
CN (2) CN105377307B (ko)
AU (1) AU2014299561B2 (ko)
BR (1) BR112015032200A2 (ko)
CA (1) CA2916202C (ko)
RU (1) RU2670748C9 (ko)
WO (1) WO2014208987A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10111966B2 (en) 2016-06-17 2018-10-30 Magenta Therapeutics, Inc. Methods for the depletion of CD117+ cells
US10434185B2 (en) 2017-01-20 2019-10-08 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD137+ cells

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2017204139B2 (en) 2016-06-17 2018-08-09 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cells
AU2018259856A1 (en) * 2017-04-28 2019-11-14 Ajinomoto Co., Inc. Compound having substance that has affinity for soluble protein, cleavable moiety, and reactive group, or salt thereof
CN111587124B (zh) * 2017-06-23 2024-01-12 维洛斯生物股份有限公司 Ror1抗体免疫缀合物
KR20230161542A (ko) * 2017-09-08 2023-11-27 리제너론 파마슈티칼스 인코포레이티드 항체-약제 접합체 평가 방법
WO2019149116A1 (zh) * 2018-01-30 2019-08-08 四川科伦博泰生物医药股份有限公司 制备偶联物的方法
JP7273858B2 (ja) * 2018-06-15 2023-05-15 シャンハイ ミラコーケン インコーポレイティド 癌を治療するための方法と材料
WO2020004937A1 (ko) * 2018-06-26 2020-01-02 주식회사 티에스디라이프사이언스 항-bcma 항체-약물 접합체 및 그 용도

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005037992A2 (en) 2003-10-10 2005-04-28 Immunogen, Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
KR20070037575A (ko) * 2004-06-01 2007-04-05 제넨테크, 인크. 항체 약물 접합체 및 방법
WO2009026274A1 (en) * 2007-08-22 2009-02-26 Medarex, Inc. Site-specific attachment of drugs or other agents to engineered antibodies with c-terminal extensions
US7723485B2 (en) * 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
US20100183636A1 (en) * 2003-02-20 2010-07-22 Seattle Genetics, Inc. Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IE62496B1 (en) 1990-04-19 1995-02-08 Res Dev Foundation Antibody conjugates for treatment of neoplastic disease
US20030215421A1 (en) 1999-07-21 2003-11-20 Mcdonald John R. Methods and compositions for treating secondary tissue damage and other inflammatory conditions and disorders
DE69925009T2 (de) 1998-10-13 2006-03-02 Immunomedics, Inc. Lage-spezifische markierung von disulfide-enthaltenden zielgerichteten vektoren
DE60121733T2 (de) * 2000-02-24 2007-08-09 Philogen S.P.A. Zusamensetzungen und Verfahren zur Behandlung von Angiogenese in pathologischen Schädigungen
EP1264910B1 (en) 2000-02-28 2008-05-21 Nippon Steel Corporation Steel pipe having excellent formability and method for production thereof
US8877901B2 (en) * 2002-12-13 2014-11-04 Immunomedics, Inc. Camptothecin-binding moiety conjugates
AU2003250971B2 (en) * 2002-07-24 2008-04-03 F. Hoffmann - La Roche Ag Polyethylene glycol aldehyde derivatives
US20040202666A1 (en) 2003-01-24 2004-10-14 Immunomedics, Inc. Anti-cancer anthracycline drug-antibody conjugates
CA2646508A1 (en) 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
CA2649751A1 (en) 2006-04-20 2007-11-01 Amgen Inc. Glp-1 compound/glucagon antibody compositions
AR060978A1 (es) * 2006-05-30 2008-07-23 Genentech Inc Anticuerpos e inmunoconjugados y sus usos
WO2008036449A2 (en) * 2006-06-29 2008-03-27 The Regents Of The University Of California Chemical antibodies for immunotherapy and imaging
BRPI0715794A2 (pt) 2006-08-17 2013-07-23 Hoffmann La Roche conjugado de anticorpo contra ccr5 e peptÍdeo antifusogÊnico
AU2008334063A1 (en) 2007-11-30 2009-06-11 Bristol-Myers Squibb Company Anti-B7H4 monoclonal antibody-drug conjugate and methods of use
ES2936256T3 (es) 2008-02-01 2023-03-15 Massachusetts Gen Hospital Uso de microvesículas en el diagnóstico, y pronóstico de enfermedades y afecciones médicas
ES2602459T3 (es) * 2008-12-26 2017-02-21 Kyowa Hakko Kirin Co., Ltd. Anticuerpo anti-CD4
SG174930A1 (en) 2009-04-01 2011-11-28 Genentech Inc Anti-fcrh5 antibodies and immunoconjugates and methods of use
EP2423228B1 (en) * 2009-04-20 2015-12-16 Kyowa Hakko Kirin Co., Ltd. Antibody containing igg2 having amino acid mutation introduced therein
CA2811667C (en) * 2010-09-29 2017-09-05 Philogen S.P.A. Thiazolidine linker for the conjugation of drugs to antibodies
CA2819187A1 (en) * 2010-11-29 2012-06-07 National Research Council Of Canada Covalently dimerized bivalent binding agents
SG10201608138RA (en) * 2011-02-01 2016-11-29 Genmab As Human antibodies and antibody-drug conjugates against cd74
AU2012302596B2 (en) * 2011-09-01 2016-12-01 Eisai R&D Management Co., Ltd. Anti-human XCR1 antibodies
KR101426134B1 (ko) * 2011-09-26 2014-08-06 한화케미칼 주식회사 항 ｉｇｆ-1ｒ 단일클론 항체와 ｉｌ-2를 포함하는 융합 단일클론 항체 및 이를 포함하는 암치료용 조성물
KR20130057959A (ko) * 2011-11-24 2013-06-03 한화케미칼 주식회사 항 ｈｅｒ2 단일클론항체와 ｉｌ-2를 포함하는 융합 단일클론 항체 및 이를 포함하는 암치료용 조성물
US20150079045A1 (en) 2012-02-13 2015-03-19 Wuyi Kong Nprcps, pfdncs and uses thereof
RU2014148162A (ru) * 2012-05-01 2016-06-20 Дженентек, Инк. Анти-pmel17 антитела и их иммуноконъюгаты
KR20130138608A (ko) 2012-06-11 2013-12-19 한화케미칼 주식회사 위치 특이적 항체-싸이토톡신 결합체 및 이의 용도
JP2016526688A (ja) 2013-07-12 2016-09-05 クォン ヨンアＫＷＯＮ， Ｙｏｕｎｇ Ａｈ ルテリアルの形態学的特性を用いた疾病の診断方法
US20160334389A1 (en) 2014-01-14 2016-11-17 Won Cheol Choi Method for screening cancer prevention agent or anticancer agent using morphological characteristics of luterial

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100183636A1 (en) * 2003-02-20 2010-07-22 Seattle Genetics, Inc. Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders
WO2005037992A2 (en) 2003-10-10 2005-04-28 Immunogen, Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
KR20070037575A (ko) * 2004-06-01 2007-04-05 제넨테크, 인크. 항체 약물 접합체 및 방법
US7723485B2 (en) * 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
WO2009026274A1 (en) * 2007-08-22 2009-02-26 Medarex, Inc. Site-specific attachment of drugs or other agents to engineered antibodies with c-terminal extensions

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
See also references of EP3015116A4
ZOLOT, R. S. ET AL.: "Antibody-drug conjugates", NATURE REVIEWS DRUG DISCOVERY, vol. 12, April 2013 (2013-04-01), pages 259 - 260, XP055303640 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10111966B2 (en) 2016-06-17 2018-10-30 Magenta Therapeutics, Inc. Methods for the depletion of CD117+ cells
US10434185B2 (en) 2017-01-20 2019-10-08 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD137+ cells
US10576161B2 (en) 2017-01-20 2020-03-03 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD137+ cells

Also Published As

Publication number Publication date
AU2014299561B2 (en) 2017-06-08
BR112015032200A2 (pt) 2017-11-21
KR101641206B1 (ko) 2016-07-22
CA2916202A1 (en) 2014-12-31
RU2016102116A (ru) 2017-07-28
EP3015116A4 (en) 2017-03-08
EP3015116A1 (en) 2016-05-04
CN105377307A (zh) 2016-03-02
CN110251683A (zh) 2019-09-20
US20160136300A1 (en) 2016-05-19
CA2916202C (en) 2019-07-02
RU2670748C9 (ru) 2018-12-13
JP2016523900A (ja) 2016-08-12
JP6208864B2 (ja) 2017-10-04
US10071170B2 (en) 2018-09-11
RU2670748C2 (ru) 2018-10-25
CN105377307B (zh) 2019-09-24
US20180360986A1 (en) 2018-12-20
EP3015116B1 (en) 2020-02-26
KR20150000843A (ko) 2015-01-05
AU2014299561A1 (en) 2016-01-21

Similar Documents

Publication Publication Date Title
WO2014208987A1 (ko) 안정성이 개선된 항체-약물 결합체 및 이의 용도
AU2019229076B2 (en) Anti-TIGIT antibodies and uses thereof
WO2015152618A1 (ko) 면역글로불린 fc 단편 결합을 이용한 단백질 및 펩타이드의 용해도를 개선시키는 방법
AU2018271751B2 (en) Anti-human interleukin-2 antibodies and uses thereof
WO2018174544A2 (ko) Muc1에 특이적으로 결합하는 항체 및 그의 용도
KR20160113623A (ko) 항체-약물 접합체 및 면역독소
WO2019050362A2 (ko) 인간 dlk1에 대한 항체 및 이의 용도
WO2017030370A1 (ko) 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
WO2020184944A1 (ko) 위치특이적 항체 콘쥬게이션 및 이의 구체예로서의 항체-약물 콘쥬게이트
CN114173825A (zh) 抗体-药物偶联物及其在治疗中的应用
WO2015005747A1 (ko) FcRn 결합력이 유지되는 면역글로불린 Fc 결합체
WO2019066603A1 (ko) 효력이 향상된 지속성 단백질 결합체
CN115515642A (zh) 抗cd56抗体-药物偶联物及其在治疗中的用途
WO2019212253A1 (ko) C-met에 특이적으로 결합하는 항체 및 그의 용도
WO2021201654A1 (ko) Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물
WO2020004937A1 (ko) 항-bcma 항체-약물 접합체 및 그 용도
WO2021101349A1 (ko) Ror1 및 b7-h3에 결합하는 항체, 이를 포함하는 항체-약물 접합체 및 그 용도
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2019022563A2 (ko) 이두로네이트 2-설파타제 결합체
WO2013176516A1 (ko) 트랜스글루타미나아제를 이용하여 제조한 항체-약물 결합체 및 이의 용도
WO2020071881A1 (ko) Pdgf 수용체에 대한 항체 및 이의 용도
WO2018105988A1 (ko) 면역반응이 약화된 결합체
WO2024043643A1 (ko) Il2 변이체 및 이를 포함하는 단백질 복합체
WO2013125769A1 (ko) 아포리포단백질을 포함하는 항체-약물 결합체
WO2023157989A1 (ko) 항체-약물 접합체

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14817162

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14898126

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2916202

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2014817162

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2016523642

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015032200

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2014299561

Country of ref document: AU

Date of ref document: 20140624

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2016102116

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112015032200

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015032200

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151222