WO2014201172A1 - Novel glp-1 receptor modulators - Google Patents

Novel glp-1 receptor modulators Download PDF

Info

Publication number
WO2014201172A1
WO2014201172A1 PCT/US2014/041997 US2014041997W WO2014201172A1 WO 2014201172 A1 WO2014201172 A1 WO 2014201172A1 US 2014041997 W US2014041997 W US 2014041997W WO 2014201172 A1 WO2014201172 A1 WO 2014201172A1
Authority
WO
WIPO (PCT)
Prior art keywords
compound
tert
butyl
phenyl
following structure
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/041997
Other languages
English (en)
French (fr)
Inventor
Marcus F. Boehm
Esther Martinborough
Manisha Moorjani
Junko Tamiya
Liming Huang
Adam R. YEAGER
Enugurthi Brahmachary
Thomas Fowler
Andrew Novak
Premji Meghani
Michael Knaggs
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Receptos LLC
Original Assignee
Receptos LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Receptos LLC filed Critical Receptos LLC
Priority to MX2015016831A priority Critical patent/MX370666B/es
Priority to HK16110427.4A priority patent/HK1222176A1/zh
Priority to NZ715006A priority patent/NZ715006B2/en
Priority to CA2913791A priority patent/CA2913791A1/en
Priority to KR1020167000708A priority patent/KR102271179B1/ko
Priority to EP14736554.8A priority patent/EP3008056B8/en
Priority to BR112015031040A priority patent/BR112015031040A8/pt
Priority to JP2016519629A priority patent/JP6573604B2/ja
Priority to ES14736554T priority patent/ES2864349T3/es
Priority to AU2014278183A priority patent/AU2014278183B2/en
Priority to HK16110429.2A priority patent/HK1222177B/zh
Priority to EA201592281A priority patent/EA030857B1/ru
Priority to CN201480044849.7A priority patent/CN105593225B/zh
Publication of WO2014201172A1 publication Critical patent/WO2014201172A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D495/00Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms
    • C07D495/02Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D495/04Ortho-condensed systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/13Amines
    • A61K31/155Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4151,2-Diazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/41641,3-Diazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4245Oxadiazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4453Non condensed piperidines, e.g. piperocaine only substituted in position 1, e.g. propipocaine, diperodon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/4985Pyrazines or piperazines ortho- or peri-condensed with heterocyclic ring systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D231/00Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
    • C07D231/02Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
    • C07D231/10Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D231/12Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D233/00Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/54Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
    • C07D233/64Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with substituted hydrocarbon radicals attached to ring carbon atoms, e.g. histidine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D237/00Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings
    • C07D237/02Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings
    • C07D237/04Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings having less than three double bonds between ring members or between ring members and non-ring members
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • C07D239/24Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
    • C07D239/26Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D243/00Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms
    • C07D243/06Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4
    • C07D243/08Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4 not condensed with other rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D271/00Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
    • C07D271/02Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
    • C07D271/061,2,4-Oxadiazoles; Hydrogenated 1,2,4-oxadiazoles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/10Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a carbon chain containing aromatic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D405/00Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/12Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D409/00Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/02Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
    • C07D409/12Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D409/00Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/14Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/04Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/10Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing aromatic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/04Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D471/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04Ortho-condensed systems

Definitions

  • the invention relates to compounds that bind the glucagon- like peptide 1 (GLP-1) receptor, methods of their synthesis, and methods of their therapeutic and/or prophylactic use.
  • GLP-1 glucagon- like peptide 1
  • the present invention is directed to compounds adapted to act as modulators of the GLP-1 receptor, and potentiators of incretin peptides, such as GLP- 1(7-36) and GLP-1 (9-36), as well as peptide-based therapies such as exenatide and liraglutide.
  • GLP-1 R Glucagon- like peptide 1 receptor
  • GLP-1 R belongs to Family Bl of the seven-transmembrane G protein-coupled receptors, and its natural agonist ligand is the peptide hormone glucagon- like peptide- 1 (GLP-1).
  • GLP-1 is a peptide hormone arising by its alternative enzymatic cleavage from proglucagon, the prohormone precursor for GLP-1, which is highly expressed in enteroendocrine cells of the intestine, the alpha cells of the endocrine pancreas (islets of Langerhans), and the brain (Kieffer T. J. and Habener, J. F. Endocrin. Rev.
  • GLP-1 receptors couple to the a-subunit of G protein, with subsequent activation of adenylate cyclase and increase of cAMP levels, thereby potentiating glucose-stimulated insulin secretion. Therefore, GLP-1 is an attractive therapeutic target to lower blood glucose and preserve the ?-cells of the pancreas of diabetic patients.
  • Glucagon has been used for decades in medical practice within diabetes and several glucagon-like peptides are being developed for various therapeutic indications. GLP-1 analogs and derivatives are being developed for the treatment for patients suffering from diabetes.
  • the present invention is directed to compounds adapted to act as potentiators or modulators of GLP-1 receptor; methods of their preparation and methods of their use, such as in treatment of a malcondition mediated by GLP-1 receptor activation, or when modulation or potentiation of GLP-1 receptor is medically indicated.
  • Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • A is a 5-, 6- or 7-membered heterocyclyl having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclyl may be optionally substituted with one or more of R 4 ;
  • B is aryl, aralkyl, heterocyclyl, or heterocyclylalkyl
  • C is aryl, aralkyl, heterocyclyl or heterocyclylalkyl, and when C is aryl A and C may be taken together to form a fused bicyclic ring system between the 5-, 6- or 7-membered heterocyclyl of A and the aryl of C;
  • Yi and Y 2 are both null, or one of Yi or Y 2 is -NH- or -O- and the other Yi or Y 2 is null;
  • Z is -C(O)- or -S(0) 2 -;
  • each Ri is independently H or Ci_ 4 alkyl
  • R 2 is -OH, -0-R 8 , -N(Ri)-S0 2 -R 7 , -NR ⁇ R ⁇ , -N(Ri)-(CR a R b ) m -COOR 8 , -N(Ri)-(CRaR b ) m -CO-N(Ri)(R 40 ), -N(Ri)-(CR a R b ) m -N(Ri)C(0)0(R 8 ), -N(Ri)- (CR a R b ) m -N(Ri)(R 40 ), -N(Ri)-(CRaR b ) m -CO-N(Ri)-heterocyclyl, or -N(Ri)- (CR a R b ) m -heterocyclyl, which heterocyclyl may be optionally (singly or multiply) substituted with R 7 ;
  • each R 3 and R 4 is independently H, halo, alkyl, alkyl substituted (singly or multiply) with R 3 i alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -OR 7 , -CN, -N0 2 , -NRiR 7, -C(0)R 7 , - C(0)NRiR 7 , -NRiC(0)R 7 , -SR 7 , -S(0)R 7 , -S(0) 2 R 7 , -OS(0) 2 R 7 , -S(0) 2 NRiR 7 , - NRiS(0) 2 R 7 , -(CR a R b ) m NRiR 7 , -(CR a Rb) m O(CR a Rb) m R 7 ,-(CR a Rb) m NRi(CR a R b )
  • each R 3 i is independently H, halo, hydroxyl, -NR 4 iR 42 , or alkoxy;
  • each R 40 is independently H, R 7 , alkyl which may be optionally (singly or multiply) substituted with R 7 ,or R 40 and Ritaken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
  • each R41 and R42 is independently R40, -(CHR 40 ) n -C(0)0-R 4 o, -(CHR4o) n - C(0)-R 4 o, -(CH 2 ) n -N(R 1 )(R 7 ), aryl or heteroaryl any of which aryl or heteroaryl may be optionally (singly or multiply) substituted with R 7 ; or any two R41 and R42 taken together with the N atom to which they are attached form a 3- to 7- membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
  • Wi is null or -Li-(CR a Rb)m-Li-R 6 ;
  • each Li is independently, from the proximal to distal end of the structure of Formula I-R or I-S, null, -C(0)0-, -S(0 2 )-, -S(O)-, -S-, -N(Ri)-C(0)-N(Ri)- , -N(Ri)-C(0)-0-, -C(O)- or -S(0 2 )- Ri-;
  • each R a and R b is independently H, halo, alkyl, alkoxy, aryl, aralkyl, heterocyclyl, heterocyclylalkyl (any of which alkyl, alkoxy, aryl, aralkyl, heterocyclyl or heterocyclylalkyl may be optionally (singly or multiply) substituted with R 7 ), -(CHR 4 o)mC(0)OR 4 o, -(CHR 40 ) m OR 40 , -(CHR 40 ) m SR 40 , -(CHR 40 ) m NR 4 iR 42 , -(CHR 4 o) m C(0)NR 4 iR4 2 , -(CHR 40 ) m C(O)N(Ri)(CHR 40 ) m - NR41R42, -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m C(O)NR 41
  • Re is H, alkyl, aryl, heteroaryl, heterocyclyl, heterocycloalkyl, any of which may be optionally substituted (singly or multiply) with R 7 or -(CR a R b ) m - L 2 -(CRaRb)m-R7;
  • each R 7 is independently R 10 ; a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with R 10 ; or when a carbon atom bears two R 7 groups such two R 7 groups are taken together to form oxo or thioxo, or are taken together to form a ring moiety selected from cycloalkyl, aryl, heterocyclyl or heterocyclyl, wherein such ring moiety is optionally singly or multiply substituted with R 10 ;
  • each R 8 is independently H, alkyl, aryl, -(CR a R b ) m -L 2 -(CRi
  • I-R or I-S null, -0-, -OC(O)-, -NRi- , -C(0)NRi-, -N(Ri)-C(0)-, - S(0 2 )-, -S(O)-, -S-, -C(O)- or -S(0 2 )-N(Ri)-;
  • each L 3 is independently null, -0-, or -N(Ri)- each m is independently 0, 1 , 2, 3, 4, 5 or 6;
  • each n is independently 0 or 1 or 2;
  • p 0, 1 , 2 or 3;
  • q 0, 1 , 2 or 3;
  • each r is independently 2, 3, or 4;
  • each s is independently 1 , 2, 3, or 4.
  • a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient is provided.
  • a method of use of a compound of the invention comprising preparation of a medicament is provided.
  • the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
  • the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
  • the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
  • the second medicament is medically indicated for the treatment of type II diabetes.
  • the second medicament is a biguanide, a sulfonylurea, a meglitinide, a thiazolidinedione, an a- glucosidase inhibitor, a bile acid sequestrant, and/or a dopamine-2 agonist, and in more specific embodiments is metformin (a biguanide) or sitagliptin (a DPPIV inhibitor).
  • a method of activation, potentiation or agonism of a GLP-1 receptor comprising contacting the receptor with a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated comprises administering to such subject a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • selective activation, potentiation or agonism of a GLP-1 receptor is medically indicated.
  • the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • the invention provides methods for synthesis of certain compounds including compounds of the invention. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis.
  • Certain embodiments comprise a compound having the chiral structure of Formula I-R or I-S (with the chirality as indicated) or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • A, B, C, Yi, Y 2 , Z, R ls R 2 , R3, R 4 , R5, Wi, n, p and q are as defined above.
  • the compounds have the structure of Formula I-R or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof. In other embodiments, the compounds have the structure of Formula I- S or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof.
  • the compounds can be substantially enantiomerically pure.
  • the invention provides a compound of Formula I- Rand/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and A is a 5- or 6- membered heteroaryl group.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ,MN v " represents either or both the R and S form of the compound):
  • the invention provides a compound where Yi and Y 2 are null, Z is -C(O)- and A is a 5-, 6- or 7-membered non-aromatic heterocyclyl group.
  • Representative compounds of this embodiment include compounds of the following structures (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S (l)-(29) where R4 of the phenyl group is H.
  • the inventions provides compounds of each of structures I-R/S (l)-(29) where the A group (i.e., the 5-, 6- or 7-membered heterocyclyl) is not substituted by R4, or substituted by R4 where R4 is alkyl, haloalkyl, alkoxy, -NR 1 R 7 where Ri and R 7 are independently hydrogen or alkyl, or substituted by two R 4 groups which taken together form oxo.
  • the A group i.e., the 5-, 6- or 7-membered heterocyclyl
  • R4 is alkyl, haloalkyl, alkoxy, -NR 1 R 7 where Ri and R 7 are independently hydrogen or alkyl, or substituted by two R 4 groups which taken together form oxo.
  • the invention provides a compound of Formula I- R and/or Formula I-S whereYi and Y 2 are null, Z is -C(O)- and C is aryl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S (30)-(32) where q is zero.
  • the invention provides compounds of each of structures I-R/S (30)-(32) where q is one, two or three.
  • the invention provides compounds of structure I- R/S(30) where q is one and R 5 is -(CR a Rb) m -L 2 -(CR a R b ) m -R7 or -(-L 3 -(CR a R b ) r -) s -L 3 - R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " ⁇ " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I- R/S(33) where R 7 is H or alkyl and L 2 is O.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I- R/S(30) where R 5 is R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(35) where R 7 is a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with halo, -OH, -CN, alkyl, alkoxy, haloalkyl or perhaloalkyl.
  • the invention provides a compound of Formula I- Rand/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and C is heterocyclyl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " , ww> " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S(36)-(44) where R 7 is a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with halo, -OH, -CN, alkyl, alkoxy, haloalkyl or perhaloalkyl.
  • the invention provides a compound of Formula I- R and/ or Formula I-S whereYi and Y 2 are null, Z is -C(O)- and B is aryl or aralkyl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S (45)-(48) where Wi is null.
  • Representative compounds of this embodiment include compounds of the following structure (wherein “ , ww> " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I- R/S(49) where R 3 is halo, alkyl, alkyl substituted with R 3 i, alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -OR 7 , -CN, -N0 2 , -NR1R7, ,-C(0)R 7 , -C(0)NRiR 7 , -NRiC(0)R 7 , -SR 7 , -S(0)R 7 , -S(0) 2 R 7 , -OS(0) 2 R 7 , - S(0) 2 NRiR 7 , -NRiS(0) 2 R 7 , -(CR a R b ) m NRiR 7 ,
  • the invention provides compounds of each of structures I-R/S (45)-(49) where R 3 is alkyl.
  • the invention provides a compound of Formula I- Rand/or Formula I-S whereYi and Y 2 are null, Z is -C(O)- and B is heterocyclyl or heterocyclylalkyl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " " represents either or both the R and S form of the compou
  • the invention provides compounds of each of structures I-R/S(50)-(62) where Wi is null.
  • the invention provides compounds of each of structures I-R/S(50)-(62) where Wi is null and R 3 is halo, alkyl, alkyl substituted with R 3 i alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -ORy, -CN, -N0 2 , -NRiRy, ,-C(0)R 7 , -C(0)NRiR 7 , -NRiC(0)R 7 , -SR 7 , -S(0)R 7 , -S(0) 2 R 7 , -OS(0) 2 R 7 , -S(0) 2 NRiR 7 , -NRiS(0) 2 R 7 , -(CR a R b ) m NRiR 7 , -(CRaRb)mO(CR a Rb)mR7,-(CRaRb
  • the invention provides compounds of each of structures I-R/S(l)-(62) where R 2 is -OH, -N(Ri)-(CR a R b ) m -COOH or -N(Ri)-S0 2 -R 7 ; where Ri is H; where Ra and Rb are independently H, alkyl, alkoxy, -(CHR4o) m C(0)NR4iR42, -(CHR 4 o) m C(0)OR 4 o, -(CHR 40 ) m NR 41 R 42 , -(CHR 40 ) m SR 40 , aryl optionally substituted with R 7, or wherein Ri and any one of R a or R b taken together with the carbon(s) to which they are attached form heterocyclyl; Rg is alkyl; and m is 1 or 2.
  • the invention provides compounds of the following structures (wherein “ , ww> " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(63) where A is a 5-membered heteroaryl.
  • the invention provides compounds of structure I-R/S(63) where A is a 6-membered heteroaryl.
  • the invention provides compounds of structure I-R/S(63) where A is a 6-membered heteroaryl having one or two nitrogen atoms.
  • the invention provides compounds of structure I-R/S(63) where A is pyrimindinyl.
  • the invention provides compounds of structure I-R/S(63) where A is pyridinyl.
  • the invention provides compounds of structure I-R/S(63) where B is aryl. [0046] In certain embodiments, the invention provides compounds of structure I-R/S(63) where B is phenyl.
  • the invention provides compounds of structure I-R/S(63) where B is heteroaryl.
  • the invention provides compounds of structure I-R/S(63) where B is thiophenyl.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -OH.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -N(Ri)(CR a R b ) m COOR 8 .
  • the invention provides compounds of structure I-R/S(63) where R 2 is -N(Ri)S0 2 R 7 .
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NHCH 2 COOH.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CHR b )COOH where R b is alkyl optionally substituted with R 7 , -(CHR4o) m OR4o, -(CHR4o) m SR4o, -(CHR4o) m NR4iR4 2 , -(CHR4o) m C(0)NR4iR4 2 , -(CHR 4 o) m C(0)N(R 1 )(CHR4o) m -NR4iR 42 , -(CHR 4 o) m C(0)N(R 1 )(CHR4o) m C(0)NR4iR 42 , -(CHR4o) m C(0)N(Ri)(CHR4o) m C(0)OR4o or -(CHR4 0 )m-S-S-R4o
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CRaR b ) m COOH where R a and R b are independently H, alkyl optionally substituted with R 7 , -(CHR 4 o)mOR4o, -(CHR4o) m SR4o, -(CHR4o)mNR4iR4 2 , -(CHR4o) m C(0)NR4iR4 2 , -(CHR4o) m C(0)N(Ri)(CHR 4 o) m -NR4iR4 2 , -(CHR4o) m C(0)N(Ri)-(CHR4o) m C(0)NR4iR4 2 ,
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NRi(CHR b ) m COOH where Ri and R b taken together form heterocyclyl.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NRi(CR a R b ) m COOH where Ri and one of R b taken together form heterocyclyl. [0057] In certain embodiments, the invention provides compounds of structure I-R/S(63) where any two Ra and Rb taken together with the carbon to which they are attached form a cycloalkyl.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CR a R b ) m COOH where one of R a and R b is H and the other R a and R b is aryl substituted with R 7 .
  • the invention provides compounds of structure I-R/S(63) where p is 1 or 2 and each R 3 is independently alkyl, alkoxy, -OH, perhaloalkyl or _C(0)Rs.
  • the invention provides compounds of structure I-R/S(63) where p is 1 and each R 3 is alkyl.
  • the invention provides compounds of structure I-R/S(63) where q is 1 and R 5 is -(CR a Rb) m -L 2 -(CR a Rb) m -R7, and in more specific embodiments where q is 1 and R 5 is -(CH 2 ) m -L 2 -(CH 2 ) m -R 7 .
  • the invention provides compounds of structure I-R/S(63) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of the following structures(wherein “ /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(64) where B is phenyl or thiophenyl.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65)-(66) where p is 1 and R 3 is alkyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is C 6 -8 alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is C 6 alkoxy
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is C 8 alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is alkyl. [0074] In certain embodiments, the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is Ci_ 4 alkyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is cycloalkyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where q is 1 and R 5 is cyclopropyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where p is 1 , R 3 is alkyl, q is 1 and R 5 is alkoxy .
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of the following structures(wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(64-l) where B is phenyl or thiophenyl.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl (-CH 2 phenyl).
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where p is 1 and R 3 is alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is C 6 -8 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is C 6 alkoxy
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is C 8 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is Ci_ 4 alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is cycloalkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where q is 1 and R 5 is cyclopropyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is alkyl, q is 1 and R 5 is alkoxy. [00106] In certain embodiments, the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 6 _8 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 6 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is Cg alkoxy.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is Ci_ 4 alkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is cycloalkyl.
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is cyclopropyl.
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CR a Rb)mCOOR 8 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65-l)-(66-l) where R 2 is -N(Ri)(CR a Rb)mCOOR 8 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " , ww> " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where Ri is hydrogen.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where R 8 is hydrogen.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where m is 2, Ri is hydrogen, each occurrence of Ra and R b are hydrogen, and R 8 is hydrogen.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where m is 2, a single Ra (i.e., one of the two) is hydrogen, each occurrence of Rb is hydrogen, and Rg is hydrogen.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where m is 1 and R ls R a , R b and R 8 are hydrogen. [00123] In certain embodiments, the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where m is 1, R a is alkyl and R h R b and R 8 are hydrogen.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where m is 1, R a is methyl and R R b and R 8 are hydrogen.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl (-CH 2 phenyl).
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure I-R/S(67), (67-1), (68) and (68-1) where q is 1 and R 5 is alkyl.
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 6 -8 alkoxy.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 6 alkoxy.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is Cg alkoxy.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1 , R 3 is tert-butyl, q is 1 and R 5 is alkyl. [00148] In certain embodiments, the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is phenylethylene, p is 1, R 3 is tert-butyl, q is 1 and R 5 is alkyl.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is phenylethylene, p is 1, R 3 is tert-butyl, q is 1 and R 5 is Ci_4 alkyl.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1, R 3 is tert-butyl, q is 1 and R 5 is cycloalkyl.
  • the invention provides compounds of structure I-R/S(67-l)-(68-l) where aralkyl is benzyl, phenylethyl or phenylethylene, p is 1, R 3 is tert-butyl, q is 1 and R 5 is cyclopropyl.
  • the invention provides compounds of structure I-R/S(67)-(68) where m is 2, Ri is hydrogen, each occurrence of R a and Rb are hydrogen, and Rg is hydrogen.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(69)-(70) where p is 1 and R 3 is alkyl.
  • the invention provides compounds of structure I-R/S(69)-(70) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(69)-(70) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure I-R/S(69)-(70) where q is 1 and R 5 is C 4 _ 8 alkoxy.
  • the invention provides compounds of structure I-R/S(69)-(70) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(69)-(70) where p is 1 , R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(67)-(68) where m is 1 and R ls R b and R 8 are hydrogen.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(67)-(68) where m is 2, a single R, (i.e., one of the two) is hydrogen, each occurrence of R b is hydrogen, and R 8 is hydrogen.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is alkyl optionally substituted with R 7 , wherein alkyl includes straight and branched alkyl groups such as methyl, ethyl, n-propyl, iso-propyl, n-butyl, iso-butyl, sec-butyl and tert-butyl, as well as cycloalkyl groups such as cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is methyl, ethyl, n-propyl, iso-propyl, n-butyl, iso-butyl, sec- butyl or tert-butyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is methyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is heterocycle or heterocyclylalkyl, either which may be optionally substituted with R 7 .
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is heterocycle, such as pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl, pyrrolidinyl, furanyl, tetrahydrofuranyl, tetrahydro-2H-pyranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothiophenyl, benzofuranyl, dihydrobenzofurany
  • R a is heterocycle
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is aryl or aralkyl, either of which may be optionally substituted with R 7 .
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is aryl or aralkyl, such as phenyl or benzyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is aryl or heteroaryl substituted with R 7 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is phenyl or benzyl substituted with hydroxyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -CH(OH)C 6 H 5 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CHR4 0 ) m C(O)OR40.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -(CH 2 ) m C(0)OH.
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CHR 40 ) m OR 40 .
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -(CH 2 ) m OH.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -CH 2 OH.
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -(CHR 40 ) m SR 4 o.
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CH 2 ) m SR 40 , where R 40 is H or alkyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CHR 40 ) m NR 4 iR 42 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CH 2 ) m NR 4 iR 42 . [00181] In certain embodiments, the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CHR 40 ) m C(O)NR 4 iR 42 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CH 2 ) m C(0)NR 4 iR 42 .
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -CH 2 C(0)NH 2 or -CH 2 CH 2 C(0)NH 2
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -(CHR4o) m C(0)N(Ri)(CHR4o) m NR4iR 42 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CH 2 ) m C(0)N(Ri)(CH 2 ) m NR 4 iR 42 .
  • the invention provides compounds of structure
  • Ra is -(CHR 40 ) m C(O)N(Ri)(CHR 40 ) m C(O)NR 4 iR 42 .
  • the invention provides compounds of structure
  • Ra is -(CH 2 ) m C(0)N(Ri)(CH 2 ) m C(0)NR 4 iR 42 .
  • the invention provides compounds of structure
  • Ra is -(CHR 40 ) m C(O)N(Ri)(CHR 40 ) m C(O)OR 40 .
  • the invention provides compounds of structure
  • R a is -(CH 2 ) m C(O)N(Ri)(CH 2 ) m C(O)OR 40 .
  • the invention provides compounds of structure I-R/S(71)-(74) where R a is -(CHR 40 ) m -S-S-R 40 .
  • the invention provides compounds of structure I-R/S(71)-(74) where Ra is -(CH 2 ) m -S-S-R 40 .
  • the invention provides compounds of structure I-R/S(71)-(74) wherein, within the Ra group, Ri, R40, R41 and R 42 are hydrogen.
  • the invention provides compounds of structure I-R/S(71)-(74) wherein, within the R a group, m is 1.
  • the invention provides compounds of structure I-R/S(71)-(74) wherein, within the R a group, m is 2.
  • the invention provides compounds of structure I-R/S(71)-(74) where p is 1 and R 3 is alkyl. [00196] In certain embodiments, the invention provides compounds of structure I-R/S(71)-(74) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(71)-(74) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure I-R/S(71)-(74) where q is 1 and R 5 is C 4 _ 8 alkoxy.
  • the invention provides compounds of structure I-R/S(71)-(74) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(71)-(74) where p is 1, R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(67)-(68) where m is 1, Rb is hydrogen and Ri and Ra taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(67)-(68) where m is 2, 3 ⁇ 4 of the second (CR a Rb) group is hydrogen and Ri and Ra of the second (CRaRb) group taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " ⁇ " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(75)-(78) where Ri and R a taken together with the atoms to which they are attached form azetidinyl, pyrrolindinyl, piperidinyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(75)-(86) where p is 1 and R, is alkyl.
  • the invention provides compounds of structure I-R/S(75)-(86) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(75)-(86) where q is 1 and R 5 is alkoxy. [00207] In certain embodiments, the invention provides compounds of structure I-R/S(75)-(86) where q is 1 and R 5 is C 4 _ 8 alkoxy.
  • the invention provides compounds of structure I-R/S(75)-(86) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(75)-(86) where p is 1 , R 3 is alkyl, q is 1 and R 5 is C 4 _ 8 alkoxy.
  • the invention provides compounds of structure I-R/S(75)-(86) where R 7 is absent.
  • the invention provides compounds of structure I-R/S(75)-(86) where R 7 is hydroxyl.
  • the invention provides compounds of structure I-R/S(75)-(86) where R 7 is absent, p is 1 , R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(75)-(86) where R 7 is hydroxyl, p is 1 , R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(65)-(66) where R2is-N(Ri)-S02-Rs.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(87)-(88) where Ri is hydrogen.
  • the invention provides compounds of structure I-R/S(87)-(88) where Ri is hydrogen an R 8 is alkyl optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is -OH.
  • Representative compounds of this embodiment include compounds of the following structure (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(R 42 ).
  • Representative compounds of this embodiment include compounds of the following structure (wherein " l/ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(91)-(92) where R 4 i and R 42 are independently R 40 , -(CHR 40 ) friendship-C(O)OR 40 , -(CHR 40 ) n -C(0)R 4 o, -(CH 2 ) n N(R 1 )(R 7 ), aryl or heteroaryl, which aryl or heteroaryl is optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure I-R/S(91)-(92) where R 4 i is hydrogen and R 42 is alkyl optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure
  • the invention provides compounds of structure I-R/S(91)-(92) where R41 is hydrogen and R42 is heteroaryl optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure I-R/S(91)-(92) where R41 and R42 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure I-R/S(91)-(92) where R41 and R4 2 taken together with the N atom to which they are attached form pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl,pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl or pyridinyl, any of which may be optionally substituted (singly or multiply) with R 7 .
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CRaR b ) m CON(Ri)(R 4 o).
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(93)-(94) where m is 1 , R b is hydrogen and Ri and R a taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(93)-(94) where m is 2, R b of the second (CR a R b ) group is hydrogen and Ri and R a of the second (CR a R b ) group taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(95)-(98) where Ri and R a taken together with the atoms to which they are attached form azetidinyl, pyrrolindinyl, piperidinyl optionally substituted (singly or multiply) with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(93)-(104) where p is 1 and R 3 is alkyl. [00233] In certain embodiments, the invention provides compounds of structure I-R/S(93)-(104) where p is 1 and R 3 is tert-butyl.
  • the invention provides compounds of structure I-R/S(93)-(104) where q is 1 and R 5 is alkoxy.
  • the invention provides compounds of structure I-R/S(93)-(104) where q is 1 and R 5 is C 4 _ 8 alkoxy.
  • the invention provides compounds of structure I-R/S(93)-(104) where q is 1 and R 5 is C 7 alkoxy.
  • the invention provides compounds of structure I-R/S(93)-(104) where p is 1, R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(93)-(104) where R 7 is absent or hydroxyl.
  • the invention provides compounds of structure I-R/S(93)-(104) where R 7 is absent or hydroxyl, p is 1, R 3 is alkyl, q is 1 and R 5 is C 4 _g alkoxy.
  • the invention provides compounds of structure I-R/S(93)-(104) where Ri is hydrogen.
  • the invention provides compounds of structure I-R/S(93)-(104) where R40 is R 7 .
  • the invention provides compounds of structure I-R/S(93)-(104) where R 40 is R 7 , R 7 is -(CR a Rb)mS(0) 2 R8, and R 8 is -(CRaR b ) m -L 2 -
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CRaRb) m N(Ri)C(0)0(R 8 ).
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CRaR b ) m N(Ri)(R7).
  • Representative compounds of this embodiment include compounds of the following structure (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CR a R b ) m CON(Ri)heterocyclyl.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " ⁇ " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(65)-(66) where R 2 is-N(Ri)(CR a R b ) m -heterocyclyl, which heterocyclyl may be optionally substituted with R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structures I-R/S(65-l)-(66-l) where R 2 is as shown in each of structures I-R/S(69) through I-R/S(112). Such compounds are referred to herein as I-R/S(69-l) through I-R/S(112- 1).
  • structures I-R/S(67-l)-(68-l) depict structures I-R/S(65-l)-(66-l) when R 2 is -N(Ri)(CRaRb) m COOR8.
  • structures I-R/S(69-l) through I-R/S(112-l) correspond to structures I-R/S(69) through I-R/S(112), but with the specific R 2 group of structures I-R/S(69) through I-R/S(112) serving as the R 2 group of structures I-R/S(65-l)-(66-l).
  • the invention provides a compound of Formula I- R and/or Formula I-S where Yi and Y 2 are null and Z is -S(0) 2 -.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(95) where A is pyrimidinyl, B is phenyl and C is phenyl.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides a compound of Formula I- Rand/or Formula I-S where Yi is null, Y 2 is -O- and Z is -C(O)-.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " " represents either or both the R and S form of the compound):
  • the invention provides a compound of Formula I- Rand/or Formula I-S where Y 1 is NH, Y 2 is null and Z is -C(O)-.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides a compound of Formula I- R and/or Formula I-S where C is aryl and A and C are taken together to form a fused bicyclic ring system between the 5-, 6- or 7-membered heterocyclyl of A and the aryl of C.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ⁇ JWW> " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(99) where Yi is null and Z is -C(O)-.
  • Representative compounds of this embodiment include compounds of the following structures where one or both of XA and X B is nitrogen (wherein " ⁇ " represents either or both the R and S form of the compound)
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient.
  • the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament.
  • the second medicament is a GLP-1 agonist or a DPPIV inhibitor.
  • the invention provides a method of use of compounds of the invention for preparation of a medicament.
  • the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
  • the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
  • the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating petptide.
  • the second medicament is a DPPIV inhibitor, such as sitagliptin.
  • the second medicament is medically indicated for the treatment of type II diabetes.
  • the second medicament is a sodium-glucose co-transporter (SGLT) inhibitor, such as a SGLT1 and/or SGLT2 inhibitor.
  • the second medicament is a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride, a meglitinide such as repaglinide and mateglinide, a thiazolidinedione such as pioglitazone and rosiglitazone, an a-glucosidase inhibitor such as acarbose and miglitol, a bile acid sequestrant such as colesevelam, and/or a dopamine-2 agonist such as bromocriptine.
  • SGLT sodium-glucose co-transporter
  • the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament, wherein the second medicament is metformin.
  • the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament, wherein the second medicament is sitagliptin.
  • a method for activation, potentiation or agonism of a glucagon-like peptide 1 comprising contacting the receptor with an effective amount of a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • a method for activation or agonism of a GLP-1 receptor by contacting the receptor with an effective amount of an invention compound and GLP-1 peptides GLP-l(9-36) and GLP-l(7-36), pharmaceutical composition or pharmaceutical combination, wherein the GLP-1 receptor is disposed within a living mammal; in certain embodiments wherein such mammal is a human.
  • a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the subject at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient.
  • a method for treatment of a malcondition in a patient for which activation, potentiation, or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the patient at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient, wherein the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • the subject is a patient or a human being.
  • the human being is afflicted with, or at risk of developing, a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • said disease is type I diabetes or type II diabetes.
  • the invention provides methods for synthesis of certain compounds including compounds of the invention as more fully illustrated herein. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis as illustrated herein.
  • methods are provided for use of an invention compound for preparation of a medicament adapted for treatment of a disorder or a malcondition wherein activation or inhibition of a GLP-1 receptor is medically indicated.
  • the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • said disease is type I diabetes or type II diabetes.
  • the method additionally comprises administering to the subject a second medicament selected from the group of biguanides, peptidic GLP-1 agonists and DPPIV inhibitors, wherein such second medicament is either a component of the pharmaceutical composition or a second pharmaceutical composition.
  • the second medicament can be metformin, exenatide or sitagliptin.
  • mammals as used herein, means both mammals and non-mammals.
  • Mammals include, for example, humans; non-human primates, e.g., apes and monkeys; cattle; horses; sheep; and goats.
  • Non-mammals include, for example, fish and birds.
  • a "receptor”, as is well known in the art, is a biomolecular entity usually comprising a protein that specifically binds a structural class of ligands or a single native ligand in a living organism, the binding of which causes the receptor to transduce the binding signal into another kind of biological action, such as signaling a cell that a binding event has occurred, which causes the cell to alter its function in some manner.
  • An example of transduction is receptor binding of a ligand causing alteration of the activity of a "G-protein" in the cytoplasm of a living cell.
  • GLP-1 compound or "GLP-1 agonist” or “GLP-1 activator” or “GLP-1 inhibitor” or “GLP-1 antagonist” or “GLP-1 potentiator” or “GLP-1 modulator” as the terms are used herein refer to compounds that interact in some way with the GLP-1 receptor. They can be agonists, potentiators, or activators, or they can be antagonists or inhibitors. A “GLP-1 compound” of the invention can be selective for action of the GLP-1 receptor family.
  • substantially as the term is used herein means completely or almost completely; for example, a composition that is "substantially free” of a component either has none of the component or contains such a trace amount that any relevant functional property of the composition is unaffected by the presence of the trace amount, or a compound is "substantially pure” is there are only negligible traces of impurities present.
  • Substantially enantiomerically or diasteromerically pure means a level of enantiomeric or diasteromeric enrichment of one enantiomer with respect to the other enantiomer or diasteromer of at least about 80%, and more preferably in excess of 80%, 85%, 90%, 95%, 98%, 99%, 99.5% or 99.9%.
  • Treating or “treatment” within the meaning herein refers to an alleviation of symptoms associated with a disorder or disease, or inhibition of further progression or worsening of those symptoms, or prevention or prophylaxis of the disease or disorder.
  • the expression "effective amount”, when used to describe use of a compound of the invention in providing therapy to a patient suffering from a disorder or malcondition mediated by GLP-1 refers to the amount of a compound of the invention that is effective to bind to as an agonist or as an antagonist a GLP-1 receptor in the individual's tissues, wherein the GLP-1 is implicated in the disorder, wherein such binding occurs to an extent sufficient to produce a beneficial therapeutic effect on the patient.
  • an "effective amount” or a “therapeutically effective amount” of a compound of the invention refers to an amount of the compound that alleviates, in whole or in part, symptoms associated with the disorder or condition, or halts or slows further progression or worsening of those symptoms, or prevents or provides prophylaxis for the disorder or condition.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result by acting as an agonist of GLP-1 activity.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of compounds of the invention are outweighed by the therapeutically beneficial effects.
  • a therapeutically effective amount of a GLP-1 receptor agonist of the invention is an amount sufficient to control the malcondition, to mitigate the progress of the malcondition, or to relieve the symptoms of the malcondition.
  • malconditions that can be so treated include, but not limited to, type II diabetes.
  • the isomers resulting from the presence of a chiral center comprise a pair of non-superimposable isomers that are called "enantiomers.”
  • Single enantiomers of a pure compound are optically active, i.e., they are capable of rotating the plane of plane polarized light.
  • Single enantiomers are designated according to the Cahn-Ingold-Prelog system.
  • isolated optical isomer means a compound which has been substantially purified from the corresponding optical isomer(s) of the same formula.
  • the isolated isomer is at least about 80%, and preferably at least 80% or even at least 85% pure. In other embodiments, the isolated isomer is at least 90%> pure or at least 98%> pure, or at least about 99% pure, by weight.
  • Enantiomers are sometimes called optical isomers because a pure enantiomer rotates plane-polarized light in a particular direction. If the light rotates clockwise, then that enantiomer is labeled "(+)” or “d” for dextrorotatory, its counterpart will rotate the light counterclockwise and is labeled "(-)” or "1” for levorotatory.
  • racemate and “racemic mixture” are frequently used interchangeably.
  • a racemate is an equal mixture of two enantiomers.
  • a racemate is labeled “( ⁇ )” because it is not optically active (i.e., will not rotate plane-polarized light in either direction since its constituent enantiomers cancel each other out).
  • the preferred compounds of the present invention have a particular spatial arrangement of substituents on the aromatic rings, which are related to the structure activity relationship demonstrated by the compound class. Often such substitution arrangement is denoted by a numbering system; however, numbering systems are often not consistent between different ring systems. In six-membered aromatic systems, the spatial arrangements are specified by the common nomenclature "para” for 1 ,4-substitution, "meta” for 1,3 -substitution and "ortho" for 1 ,2-substitution as shown below.
  • substituted refers to an organic group as defined herein in which one or more bonds to a hydrogen atom contained therein are replaced by one or more bonds to a non-hydrogen atom such as, but not limited to, a halogen (i.e., F, CI, Br, and I); an oxygen atom in groups such as hydroxyl groups, alkoxy groups, aryloxy groups, aralkyloxy groups, oxo(carbonyl) groups, carboxyl groups including carboxylic acids, carboxylates, and carboyxlate esters; a sulfur atom in groups such as thiol groups, alkyl and aryl sulfide groups, sulfoxide groups, sulfone groups, sulfonyl groups, and sulfonamide groups; a nitrogen atom in groups such as amines, hydroxylamines, nitriles, nitro groups, N-oxides, hydrazides, azides,
  • Non-limiting examples of substituents that can be bonded to a substituted carbon (or other) atom include F, CI, Br, I, OR', OC(0)N(R') 2 , CN, CF 3 , OCF 3 , R', O, S, C(O), S(O), methylenedioxy, ethylenedioxy, N(R) 2 , SR, SOR, S0 2 R, S0 2 N(R * ) 2 , S0 3 R, C(0)R, C(0)C(0)R, C(0)CH 2 C(0)R, C(S)R, C(0)OR, OC(0)R, C(0)N(R) 2 , OC(0)N(R) 2 , C(S)N(R) 2 , (CH 2 ) 0 _ 2 NHC(O)R, (CH 2 ) 0 _ 2 N(R)N(R) 2 , N(R * )N(R * )C(0)R, N(R)N(R)C(0)OR, N
  • Substituted alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups as well as other substituted groups also include groups in which one or more bonds to a hydrogen atom are replaced by one or more bonds, including double or triple bonds, to a carbon atom, or to a heteroatom such as, but not limited to, oxygen in carbonyl (oxo), carboxyl, ester, amide, imide, urethane, and urea groups; and nitrogen in imines, hydroxyimines, oximes, hydrazones, amidines, guanidines, and nitriles.
  • Substituted ring groups include substituted aryl, heterocyclyl and heteroaryl groups. Substituted ring groups can be substituted by one or more substituents at any available ring position. In some embodiments, two substituents on a substituted ring group may taken together with the ring to which they are attached to form a ring, such that the two rings are fused together. For example, benzodioxolyl is a fused ring system formed by two substituents taken together on a phenyl group.
  • Such substituted ring groups also include rings and fused ring systems in which a bond to a hydrogen atom is replaced with a bond to a carbon atom. Therefore, substituted aryl, heterocyclyl and heteroaryl groups can also be substituted with alkyl, alkenyl, cycloalkyl, aryl, heteroaryl, and alkynyl groups as defined herein, which can themselves be further substituted.
  • the linking groups (e.g., Li and L 2 )of Formula I-R or I-S are partial structures which may be represented by a formula, say, for example, -N(Ri)-C(0)-, which is read from left-to-right. Accordingly, the nitrogen atom of the -N(Ri)-C(0)- linker will be attached to the proximal end of the structure of Formula I-R or I-S, and the carbonyl carbon atom of the -N(Ri)-C(0)- linker will be attached to the distal end of the structure of Formula I-R or I-S.
  • heteroatoms refers to non-carbon and non- hydrogen atoms, capable of forming covalent bonds with carbon, and is not otherwise limited. Typical heteroatoms are N, O, and S.
  • sulfur (S) When sulfur (S) is referred to, it is understood that the sulfur can be in any of the oxidation states in which it is found, thus including sulfoxides (R-S(O)-R') and sulfones (R-S(0) 2 -R'), unless the oxidation state is specified; thus, the term “sulfone” encompasses only the sulfone form of sulfur; the term “sulfide” encompasses only the sulfide (R-S-R) form of sulfur.
  • heteroatoms selected from the group consisting of O, NH, NR' and S or "[variable] is O, S . . .” are used, they are understood to encompass all of the sulfide, sulfoxide and sulfone oxidation states of sulfur.
  • Alkyl groups include straight chain and branched alkyl groups and cycloalkyl groups having from 1 to about 20 carbon atoms, and typically from 1 to 12 carbons (Ci-Ci 2 alkyl), or, in some embodiments, from 1 to 8 carbon atoms (Ci-Cg alkyl), or, in some embodiments, from 1 to 4 carbon atoms (C 1 -C4 alkyl). In the case of cycloalkyl groups, such groups have from 3-20 carbon atoms.
  • straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n-butyl, n- pentyl, n-hexyl, n-heptyl, and n-octyl groups.
  • branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, t-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl groups.
  • Alkyl groups as used herein may optionally include one or more further substituent groups.
  • Representative substituted alkyl groups can be substituted one or more times with any of the groups listed above, for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • Cycloalkyl groups are alkyl groups forming a ring structure, which can be substituted or unsubstituted, wherein the ring is either completely saturated, partially unsaturated, or fully unsaturated, wherein if there is unsaturation, the conjugation of the pi-electrons in the ring do not give rise to aromaticity.
  • Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl groups.
  • the cycloalkyl group has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms range from 3 to 5, 3 to 6, or 3 to 7.
  • Cycloalkyl groups further include polycyclic cycloalkyl groups such as, but not limited to, norbornyl, adamantyl, bornyl, camphenyl, isocamphenyl, and carenyl groups, and fused rings such as, but not limited to, decalinyl, and the like. Cycloalkyl groups also include rings that are substituted with straight or branched chain alkyl groups as defined above.
  • Representative substituted cycloalkyl groups can be mono-substituted or substituted one or more times with any of the groups listed above, for example, but not limited to, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • carbocyclic and “carbocycle” denote a ring structure wherein the atoms of the ring are carbon.
  • the carbocycle has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms is 4, 5, 6, or 7.
  • the carbocyclic ring can be substituted with as many as N substituents wherein N is the size of the carbocyclic ring with for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • (Cycloalkyl)alkyl groups also denoted cycloalkylalkyl, are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkyl group as defined above.
  • Alkenyl groups include straight and branched chain and cyclic alkyl groups as defined above, except that at least one double bond exists between two carbon atoms.
  • alkenyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms.
  • cycloalkenyl alone or in combination denotes a cyclic alkenyl group wherein at least one double bond is present in the ring structure.
  • Cycloalkenyl groups include cycloalkyl groups having at least one double bond between two adjacent carbon atoms.
  • cycloalkenyl groups include but are not limited to cyclohexenyl, cyclopentenyl, and cyclohexadienyl groups, as well as polycyclic and/or bridging ring systmes such as adamantine.
  • (Cycloalkenyl)alkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkenyl group as defined above.
  • Alkynyl groups include straight and branched chain alkyl groups, except that at least one triple bond exists between two carbon atoms.
  • alkynyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms. Examples include, but are not limited to - C ⁇ CH, -C ⁇ C(CH 3 ), -C ⁇ C(CH 2 CH 3 ), -CH 2 C ⁇ CH, -CH 2 C ⁇ C(CH 3 ), and -CH 2 C ⁇ C(CH 2 CH 3 ), among others.
  • Aryl groups are cyclic aromatic hydrocarbons that do not contain heteroatoms.
  • aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, indacenyl, fluorenyl, phenanthrenyl, triphenylenyl, pyrenyl, naphthacenyl, chrysenyl, biphenylenyl, anthracenyl, and naphthyl groups.
  • aryl groups contain 6-14 carbons in the ring portions of the groups.
  • aryl groups includes groups containing fused rings, such as fused aromatic- aliphatic ring systems (e.g., indanyl, tetrahydronaphthyl, and the like), and also includes substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
  • fused aromatic- aliphatic ring systems e.g., indanyl, tetrahydronaphthyl, and the like
  • substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
  • Representative substituted aryl groups can be mono-substituted or substituted more than once, such as, but not limited to, 2-, 3-, 4-, 5-, or 6-substituted phenyl or naphthyl groups, which can be substituted with groups including but not limited to those listed above.
  • Aralkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen atom of an alkyl, alkenyl or alkynyl group is replaced with an aryl group as defined above.
  • aryl moiety or the alkyl, alkenyl or alkynyl moiety or both are optionally substituted with other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
  • Heterocyclyl or heterocyclic groups include aromatic and non-aromatic ring moieties containing 3 or more ring members, of which one or more is a heteroatom such as, but not limited to, N, O, S, or P.
  • heterocyclyl groups include 3 to 20 ring members, whereas other such groups have 3 to 15 ring members, including for example single ring systems containing 5, 6 or 7 ring members. At least one ring contains a heteroatom, but every ring in a polycyclic system need not contain a heteroatom.
  • a dioxolanyl ring and a benzdioxolanyl ring system are both heterocyclyl groups within the meaning herein.
  • a heterocyclyl group designated as a C 2 -heterocyclyl can be a 5 -ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms, and so forth.
  • a C4-heterocyclyl can be a 5 -ring with one heteroatom, a 6-ring with two heteroatoms, and so forth.
  • the number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
  • heterocyclyl includes fused ring species including those having fused aromatic and non-aromatic groups.
  • the phrase also includes polycyclic and/or bridging ring systems containing a heteroatom such as, but not limited to, quinuclidyl and 7-azabicyclo[2.2.1]heptane, and also includes heterocyclyl groups that have substituents, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring members.
  • a heterocyclyl group as defined herein can be a heteroaryl group or a partially or completely saturated cyclic group including at least one ring heteroatom.
  • Heterocyclyl groups include, but are not limited to, pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl,pyrrolidinyl, furanyl, tetrahydrofuranyl, tetrahydro-2H-pyranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothiophenyl, benzofuranyl, dihydrobenzofuranyl, indolyl, dihydroindolyl, azaindo
  • Heterocyclyl groups can be substituted.
  • Heteroaryl groups are aromatic ring moieties containing 5 or more ring members, of which, one or more is a heteroatom such as, but not limited to, N, O, and S.
  • a heteroaryl group designated as a C 2 -heteroaryl can be a 5 -ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms and so forth.
  • a C4-heteroaryl can be a 5 -ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
  • Heteroaryl groups include, but are not limited to, groups such as pyrrolyl, pyrazolyl, pyridinyl, pyridazinyl, pyrimidyl, pyrazyl, pyrazinyl, pyrimidinyl, thiadiazolyl, imidazolyl, oxadiazolyl, thienyl, triazolyl, tetrazolyl, triazinyl, thiazolyl, thiophenyl, oxazolyl, isoxazolyl, benzothiophenyl, benzofuranyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xant
  • heteroaryl and heteroaryl groups include fused ring compounds such as wherein at least one ring, but not necessarily all rings, are aromatic, including tetrahydroquinolinyl, tetrahydroisoquinolinyl, indolyl and 2,3-dihydro indolyl.
  • the term also includes heteroaryl groups that have other groups bonded to one of the ring members, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
  • Representative substituted heteroaryl groups can be substituted one or more times with groups such as those listed above.
  • aryl and heteroaryl groups include but are not limited to phenyl, biphenyl, indenyl, naphthyl (1-naphthyl, 2-naphthyl), N- hydroxytetrazolyl, N-hydroxytriazolyl, N-hydroxyimidazolyl, anthracenyl (1- anthracenyl, 2-anthracenyl, 3-anthracenyl), thiophenyl (2-thienyl, 3-thienyl), furyl (2- furyl, 3-furyl), indolyl, oxadiazolyl (1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl), thiadiazolyl (1,2,4-thiadiazolyl, l,3,4-thiadiazolyl),isoxazolyl, quinazolinyl, fluorenyl, xanthenyl, isoindanyl, benzhydryl
  • Heterocyclylalkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen or carbon bond of an alkyl, alkenyl or alkynyl group is replaced with a bond to a heterocyclyl group as defined above.
  • heterocyclyl alkyl groups include, but are not limited to, furan-2-yl methyl, furan-3-yl methyl, pyridine-2-yl methyl (a-picolyl), pyridine-3-yl methyl ( ⁇ -picolyl), pyridine -4-yl methyl ( ⁇ -picolyl), tetrahydrofuran-2-yl ethyl, and indol-2-yl propyl.
  • Heterocyclylalkyl groups can be substituted on the heterocyclyl moiety, the alkyl, alkenyl or alkynyl moiety, or both.
  • Heteroarylalkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen or carbon bond of an alkyl, alkenyl or alkynyl group is replaced with a bond to a heteroaryl group as defined above.
  • Heteroarylalkyl groups can be substituted on the heteroaryl moiety, the alkyl, alkenyl or alkynyl moiety, or both.
  • ring system as the term is used herein is meant a moiety comprising one, two, three or more rings, which can be substituted with non-ring groups or with other ring systems, or both, which can be fully saturated, partially unsaturated, fully unsaturated, or aromatic, and when the ring system includes more than a single ring, the rings can be fused, bridging, or spirocyclic.
  • spirocyclic is meant the class of structures wherein two rings are fused at a single tetrahedral carbon atom, as is well known in the art.
  • a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring” as the term is used herein refers to a ring system including an unsaturated ring possessing 4n+2 pi electrons, or a partially reduced (hydrogenated) form thereof.
  • the aromatic or partially aromatic ring can include additional fused, bridged, or spiro rings that are not themselves aromatic or partially aromatic.
  • naphthalene and tetrahydronaphthalene are both a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein.
  • a benzo-[2.2.2]- bicyclooctane is also a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein, containing a phenyl ring fused to a bridged bicyclic system.
  • a fully saturated ring has no double bonds therein, and is carbocyclic or heterocyclic depending on the presence of heteroatoms within the meaning herein.
  • alkoxy refers to an oxygen atom connected to an alkyl group, including a cycloalkyl group, as are defined above.
  • linear alkoxy groups include but are not limited to methoxy, ethoxy, n-propoxy, n-butoxy, n-pentyloxy, n- hexyloxy, n-heptyloxy, n-octyloxy n-nonyloxy, and the like.
  • branched alkoxy include but are not limited to isopropoxy, sec-butoxy, tert-butoxy, isopentyloxy, isohexyloxy, and the like.
  • cyclic alkoxy include but are not limited to cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, and the like.
  • aryloxy and arylalkoxy refer to, respectively, an aryl group bonded to an oxygen atom and an aralkyl group bonded to the oxygen atom at the alkyl moiety. Examples include but are not limited to phenoxy, naphthyloxy, and benzyloxy.
  • An "acyl” group as the term is used herein refers to a group containing a carbonyl moiety wherein the group is bonded via the carbonyl carbon atom.
  • the carbonyl carbon atom is also bonded to another carbon atom, which can be part of an alkyl, aryl, aralkyl cycloalkyl, cycloalkylalkyl, heterocyclyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl group or the like.
  • the group is a "formyl" group, an acyl group as the term is defined herein.
  • An acyl group can include 0 to about 12-20 additional carbon atoms bonded to the carbonyl group.
  • An acyl group can include double or triple bonds within the meaning herein.
  • An acryloyl group is an example of an acyl group.
  • An acyl group can also include heteroatoms within the meaning here.
  • a nicotinoyl group (pyridyl-3 -carbonyl) group is an example of an acyl group within the meaning herein.
  • Other examples include acetyl, benzoyl, phenylacetyl, pyridylacetyl, cinnamoyl, and acryloyl groups and the like.
  • the group containing the carbon atom that is bonded to the carbonyl carbon atom contains a halogen, the group is termed a "haloacyl" group.
  • An example is a trifluoroacetyl group.
  • amine includes primary, secondary, and tertiary amines having, e.g., the formula N(group) 3 wherein each group can independently be H or non- H, such as alkyl, aryl, and the like.
  • Amines include but are not limited to R-NH 2 , for example, alkylamines, arylamines, alkylarylamines; R 2 NH wherein each R is independently selected, such as dialkylamines, diarylamines, aralkylamines, heterocyclylamines and the like; and R 3 N wherein each R is independently selected, such as trialkylamines, dialkylarylamines, alkyldiarylamines, triarylamines, and the like.
  • the term "amine” also includes ammonium ions as used herein.
  • amino group is a substituent of the form -NH 2 , -NHR, -NR 2 , -NR 3 + , wherein each R is independently selected, and protonated forms of each. Accordingly, any compound substituted with an amino group can be viewed as an amine.
  • An "ammonium” ion includes the unsubstituted ammonium ion NH 4 , but unless otherwise specified, it also includes any protonated or quaternarized forms of amines. Thus, trimethylammonium hydrochloride and tetramethylammonium chloride are both ammonium ions, and amines, within the meaning herein.
  • amide (or “amido”) includes C- and N-amide groups, i.e., -C(0)NR 2 , and -NRC(0)R groups, respectively. Amide groups therefore include but are not limited to carbamoyl groups (-C(0)NH 2 ) and formamide groups (-NHC(O)H).
  • a "carboxamido” group is a group of the formula C(0)NR 2 , wherein R can be H, alkyl, aryl, etc.
  • carbonyl refers to a -C(O)- group.
  • Halo include fluorine, chlorine, bromine and iodine.
  • perhaloalkyl refers to an alkyl group where all of the hydrogen atoms are replaced by halogen atoms. Perhaloalkyl groups include, but are not limited to, -CF 3 and -C(CF 3 ) 3 .
  • haloalkyl refers to an alkyl group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms. Haloalkyl groups include but are not limited to -CHF 2 and -CH 2 F.
  • perhaloalkoxy refers to an alkoxy group where all of the hydrogen atoms are replaced by halogen atoms.
  • Perhaloalkoxy groups include, but are not limited to, -OCF 3 and -OC(CF 3 ) 3 .
  • haloalkoxy refers to an alkoxy group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms.
  • Haloalkoxy groups include but are not limited to -OCHF 2 and -OCH 2 F.
  • a "salt" as is well known in the art includes an organic compound such as a carboxylic acid, a sulfonic acid, or an amine, in ionic form, in combination with a counterion.
  • acids in their anionic form can form salts with cations such as metal cations, for example sodium, potassium, and the like; with ammonium salts such as N3 ⁇ 4 + or the cations of various amines, including tetraalkyl ammonium salts such as tetramethylammonium, or other cations such as trimethylsulfonium, and the like.
  • a “pharmaceutically acceptable” or “pharmacologically acceptable” salt is a salt formed from an ion that has been approved for human consumption and is generally non-toxic, such as a chloride salt or a sodium salt.
  • a “zwitterion” is an internal salt such as can be formed in a molecule that has at least two ionizable groups, one forming an anion and the other a cation, which serve to balance each other. For example, amino acids such as glycine can exist in a zwitterionic form.
  • a “zwitterion” is a salt within the meaning herein.
  • the compounds of the present invention may take the form of salts.
  • the term “salts" embraces addition salts of free acids or free bases which are compounds of the invention.
  • Salts can be “pharmaceutically-acceptable salts.”
  • pharmaceutically-acceptable salt refers to salts which possess toxicity profiles within a range that affords utility in pharmaceutical applications. Pharmaceutically unacceptable salts may nonetheless possess properties such as high crystallinity, which have utility in the practice of the present invention, such as for example utility in process of synthesis, purification or formulation of compounds of the invention.
  • Suitable pharmaceutically-acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
  • inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric, and phosphoric acids.
  • organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, panthothenic, trifluoromethanesulfonic, 2-hydroxyethanesulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, ⁇ -hydroxybutyric, sal
  • Suitable pharmaceutically acceptable base addition salts of compounds of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts.
  • Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, N ⁇ -dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
  • Examples of pharmaceutically unacceptable base addition salts include lithium salts and cyanate salts.
  • salts may be useful, for example as intermediates in the synthesis of Formula I compounds, for example in their purification by recrystallization. All of these salts may be prepared by conventional means from the corresponding compound according to Formula I by reacting, for example, the appropriate acid or base with the compound according to Formula I.
  • pharmaceutically acceptable salts refers to nontoxic inorganic or organic acid and/or base addition salts, see, for example, Lit et al, Salt Selection for Basic Drugs (1986), Int J. Pharm., 33, 201-217, incorporated by reference herein.
  • a "hydrate” is a compound that exists in a composition with water molecules.
  • the composition can include water in stoichiometric quantities, such as a monohydrate or a dihydrate, or can include water in random amounts.
  • a "hydrate” refers to a solid form, i.e., a compound in water solution, while it may be hydrated, is not a hydrate as the term is used herein.
  • a “solvate” is a similar composition except that a solvent other that water replaces the water.
  • a solvent other that water replaces the water.
  • methanol or ethanol can form an “alcoholate”, which can again be stoichiometric or non-stoichiometric.
  • a “solvate” refers to a solid form, i.e., a compound in solution in a solvent, while it may be solvated, is not a solvate as the term is used herein.
  • a "prodrug” as is well known in the art is a substance that can be administered to a patient where the substance is converted in vivo by the action of biochemicals within the patient's body, such as enzymes, to the active pharmaceutical ingredient.
  • prodrugs include esters of carboxylic acid groups, which can be hydrolyzed by endogenous esterases as are found in the bloodstream of humans and other mammals.
  • Isotopes are well known in the art and refer to atoms with the same number of protons but different number of neutrons. For example, carbon 12, the most common form of carbon, has six protons and six neutrons, whereas carbon 14 has six protons and eight neutrons.
  • the GLP-1 compounds, their pharmaceutically acceptable salts or hydrolyzable esters of the present invention may be combined with a pharmaceutically acceptable carrier to provide pharmaceutical compositions useful for treating the biological conditions or disorders noted herein in mammalian species, and more preferably, in humans.
  • a pharmaceutically acceptable carrier employed in these pharmaceutical compositions may vary depending upon the type of administration desired (e.g., intravenous, oral, topical, suppository, or parenteral).
  • compositions in oral liquid dosage forms e.g., suspensions, elixirs and solutions
  • typical pharmaceutical media such as water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like
  • carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like can be employed.
  • compositions of the compounds of the invention alone or in combination with another GLP-1 agonist or another type of therapeutic agent or second medicament, or both.
  • GLP-1 receptor agonists include exenatide, liraglutide, taspoglutide, albiglutide, lixisenatide, and mixtures thereof.
  • the GLP-1 agonist is exenatide (Byetta®) or Byetta LAR®. Exenatide is described, for example, in U.S. Pat. Nos. 5,424,286; 6,902,744; 7,297,761, and others, the contents of each of which is herein incorporated by reference in its entirety.
  • the GLP-1 agonist is liraglutide(VICTOZA®) (also called NN-2211 and [Arg34, Lys26]-(N-epsilon-(gamma-Glu(N-alpha-hexadecanoyl))- GLP-1 (7-37)), includes the sequence
  • HAEGTFTSDVSSYLEGQAAKEFIAWKVRGRG is available from Novo Nordisk (Denmark) or Scios (Fremont, Calif. USA). See, e.g., Elbrond et al, 2002, Diabetes Care. August; 25(8):1398404; Agerso et al, 2002, Diabetologia. February; 45(2): 195- 202).
  • the GLP-1 agonist is taspoglutide (CAS Registry No. 275371-94-3) and is available from Hoffman La-Roche. See, for example, U.S. Pat. No. 7,368,427, the contents of which are herein incorporated by reference in its entirety.
  • the GLP-1 agonist isalbiglutide (SYNCRIA® from Glaxo SmithKline) .
  • the GLP-1 agonist is lixisenatide (Lyxumia® from Sanofi-Aventis/Zealand Pharma).
  • Non-limiting examples of the second medicaments are as disclosed above.
  • the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
  • the second medicament is a DPPIV inhibitor.
  • the second medicament is medically indicated for the treatment of type II diabetes.
  • the second medicament is a biguanide, a sulfonylurea, a meglitinide, a thiazolidinedione, an a-glucosidase inhibitor, a bile acid sequestrant, and/or a dopamine-2 agonist.
  • the second medicament is metformin.
  • the second medicament is sitagliptin.
  • compounds of the invention include stereoisomers, tautomers, solvates, hydrates, salts including pharmaceutically acceptable salts, and mixtures thereof.
  • Compositions containing a compound of the invention can be prepared by conventional techniques, e.g., as described in Remington: The Science and Practice of Pharmacy, 19th Ed., 1995, incorporated by reference herein. The compositions can appear in conventional forms, for example capsules, tablets, aerosols, solutions, suspensions or topical applications.
  • compositions include a compound of the invention and a pharmaceutically acceptable excipient which can be a carrier or a diluent.
  • the active compound will usually be mixed with a carrier, or diluted by a carrier, or enclosed within a carrier which can be in the form of an ampoule, capsule, sachet, paper, or other container.
  • the active compound when the carrier serves as a diluent, it can be solid, semi-solid, or liquid material that acts as a vehicle, excipient, or medium for the active compound.
  • the active compound can be adsorbed on a granular solid carrier, for example contained in a sachet.
  • suitable carriers are water, salt solutions, alcohols, polyethylene glycols, polyhydroxyethoxylated castor oil, peanut oil, olive oil, gelatin, lactose, terra alba, sucrose, dextrin, magnesium carbonate, sugar, cyclodextrin, amylose, magnesium stearate, talc, gelatin, agar, pectin, acacia, stearic acid or lower alkyl ethers of cellulose, silicic acid, fatty acids, fatty acid amines, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, polyoxyethylene, hydroxymethylcellulose and polyvinylpyrrolidone.
  • the carrier or diluent can include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
  • the formulations can be mixed with auxiliary agents which do not deleteriously react with the active compounds.
  • auxiliary agents which do not deleteriously react with the active compounds.
  • Such additives can include wetting agents, emulsifying and suspending agents, salt for influencing osmotic pressure, buffers and/or coloring substances preserving agents, sweetening agents or flavoring agents.
  • the compositions can also be sterilized if desired.
  • the route of administration can be any route which effectively transports the active compound of the invention to the appropriate or desired site of action, such as oral, nasal, pulmonary, buccal, subdermal, intradermal, transdermal or parenteral, e.g., rectal, depot, subcutaneous, intravenous, intraurethral, intramuscular, intranasal, ophthalmic solution or an ointment, the oral route being preferred.
  • the carrier will typically comprise sterile water, although other ingredients that aid solubility or serve as preservatives can also be included.
  • injectable suspensions can also be prepared, in which case appropriate liquid carriers, suspending agents and the like can be employed.
  • the compounds of the present invention can be formulated using bland, moisturizing bases such as ointments or creams.
  • the preparation can be tabletted, placed in a hard gelatin capsule in powder or pellet form or it can be in the form of a troche or lozenge. If a liquid carrier is used, the preparation can be in the form of a syrup, emulsion, soft gelatin capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
  • Injectable dosage forms generally include aqueous suspensions or oil suspensions which can be prepared using a suitable dispersant or wetting agent and a suspending agent Injectable forms can be in solution phase or in the form of a suspension, which is prepared with a solvent or diluent.
  • Acceptable solvents or vehicles include sterilized water, Ringer's solution, or an isotonic aqueous saline solution.
  • sterile oils can be employed as solvents or suspending agents.
  • the oil or fatty acid is non-volatile, including natural or synthetic oils, fatty acids, mono-, di- or tri-glycerides.
  • the formulation can also be a powder suitable for reconstitution with an appropriate solution as described above. Examples of these include, but are not limited to, freeze dried, rotary dried or spray dried powders, amorphous powders, granules, precipitates, or particulates.
  • the formulations can optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
  • the compounds can be formulated for parenteral administration by injection such as by bolus injection or continuous infusion.
  • a unit dosage form for injection can be in ampoules or in multi-dose containers.
  • the formulations of the invention can be designed to provide quick, sustained, or delayed release of the active ingredient after administration to the patient by employing procedures well known in the art. Thus, the formulations can also be formulated for controlled release or for slow release.
  • compositions contemplated by the present invention can include, for example, micelles or liposomes, or some other encapsulated form, or can be administered in an extended release form to provide a prolonged storage and/or delivery effect. Therefore, the formulations can be compressed into pellets or cylinders and implanted intramuscularly or subcutaneously as depot injections. Such implants can employ known inert materials such as silicones and biodegradable polymers, e.g., polylactide-polyglycolide. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides).
  • the preparation can contain a compound of the invention, dissolved or suspended in a liquid carrier, preferably an aqueous carrier, for aerosol application.
  • a liquid carrier preferably an aqueous carrier
  • the carrier can contain additives such as solubilizing agents, e.g., propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabens.
  • injectable solutions or suspensions preferably aqueous solutions with the active compound dissolved in polyhydroxylated castor oil.
  • Dosage forms can be administered daily, or more than once a day, such as twice or thrice daily. Alternatively dosage forms can be administered less frequently than daily, such as every other day, or weekly, if found to be advisable by a prescribing physician.
  • An embodiment of the invention also encompasses prodrugs of a compound of the invention which on administration undergo chemical conversion by metabolic or other physiological processes before becoming active pharmacological substances. Conversion by metabolic or other physiological processes includes without limitation enzymatic (e.g., specific enzymatically catalyzed) and non-enzymatic (e.g., general or specific acid or base induced) chemical transformation of the prodrug into the active pharmacological substance.
  • prodrugs will be functional derivatives of a compound of the invention which are readily convertible in vivo into a compound of the invention. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in Design of Prodrugs, ed. H. Bundgaard, Elsevier, 1985.
  • methods of making a composition of a compound described herein including formulating a compound of the invention with a pharmaceutically acceptable carrier or diluent.
  • the pharmaceutically acceptable carrier or diluent is suitable for oral administration.
  • the methods can further include the step of formulating the composition into a tablet or capsule.
  • the pharmaceutically acceptable carrier or diluent is suitable for parenteral administration.
  • the methods further include the step of lyophilizing the composition to form a lyophilized preparation.
  • the compounds of the invention can be used therapeutically in combination with i) one or more other GLP-1 modulators and/or ii) one or more other types of therapeutic agents or second medicaments which can be administered orally in the same dosage form, in a separate oral dosage form (e.g., sequentially or non- sequentially) or by injection together or separately (e.g., sequentially or non- sequentially).
  • combination therapeutic agents include Metformin, Sitagliptin (MK-0431 , Januvia) an oral antihyperglycemic (antidiabetic drug) of the dipeptidyl peptidase-4 (DPP-4) inhibitor class and Exenatide (Byetta) an incretin mimetic.
  • the second medicament is a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride, a meglitinide such as repaglinide and nateglinide, a thiazolidinedione such as pioglitazone and rosiglitazone, an a-glucosidase inhibitor such as acarbose and miglitol, a bile acid sequestrant such as colesevelam, and/or a dopamine-2 agonist such as bromocriptine.
  • a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride
  • a meglitinide such as repaglinide and nateglinide
  • a thiazolidinedione such
  • Combinations of the invention include mixtures of compounds from i) and ii) in a single formulation and compounds from i) and ii) as separate formulations. Some combinations of the invention can be packaged as separate formulations in a kit. In some embodiments, two or more compounds from ii) are formulated together while a compound of the invention is formulated separately.
  • the present invention encompasses compounds that bind with high affinity and specificity to the GLP-1 receptor in an agonist manner or as an activator or a potentiator.
  • a compound of the invention acts as a positive allosteric modulator of GLP-1 receptor.
  • the present invention provides a method for activating, potentiating, or agonizing (i.e., to have an agonic effect, to act as an agonist) a GLP-1 receptor, with a compound of the invention.
  • the method involves contacting the receptor with a suitable concentration of an inventive compound to bring about activation of the receptor.
  • the contacting can take place in vitro, for example in carrying out an assay to determine the GLP-1 receptor activation activity of an inventive compound undergoing experimentation related to a submission for regulatory approval.
  • the method for activating a GLP-1 receptor can also be carried out in vivo, that is, within the living body of a mammal, such as a human patient or a test animal.
  • the inventive compound can be supplied to the living organism via one of the routes as described above, e.g., orally, or can be provided locally within the body tissues. In the presence of the inventive compound, activation of the receptor takes place, and the effect thereof can be studied.
  • An embodiment of the present invention provides a method of treatment of a malcondition in a patient for which activation of an GLP-1 receptor is medically indicated, wherein the patient is administered the inventive compound in a dosage, at a frequency, and for a duration to produce a beneficial effect on the patient.
  • the inventive compound can be administered by any suitable means, examples of which are described above.
  • the present invention is directed to compounds adapted to act as modulators or potentiators of Class B GPCRs. These compounds may have activity on their own or in the presence of receptor ligands.
  • Receptors include incretin peptides including GLP- 1(7-36) and GLP- 1(9-36).
  • Methods of treatments provided by the invention include administration of a compound of the invention, alone or in combination with another pharmacologically active agent or second medicament to a subject or patient having a malcondition for which activation, potentiation or agonism of a glucagon-like peptide 1 receptor is medically indicated such as type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • Reagents (i) Zn(CN) 2 , Pd(PPh 3 ) 4 , NMP; (ii) NH 2 OH HCl, TEA, EtOH.
  • PG is a protecting group; (i) EDC, HOBt, DMF then heat; (ii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group; (i)NH 2 OH, TEA, water or EtOH; (ii) EDC, HOBt, DMF then heat; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group and XA and X B are CR 4 or N;
  • KOAc bis-pinacolatoborane, PdCl 2 (dppf) or Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water;
  • Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN water
  • PG is a protecting group and XA and X B are CR 4 or N;
  • Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group;(i) DIEA or TEA, acetonitrile; (ii) Acetamide, boron trifluoride etherate, DCM; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group; (i) Boron trifluoride etherate, acetamide, DCM; (ii) Zn, I 2 , Pd 2 (dba) 3 , dicyclohexyl(2',6'-dimethoxy-[l,r-biphenyl]-2- yl)phosphine, DMF; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group;(i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (ii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group;(i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (ii) Deprotection e.g., tert-bvXyX ester deprotection: DCM, TFA.
  • PGi and PG 2 are protecting groups;(i) Zn, I 2 , Pd 2 (dba) 3 , dicyclohexyl(2',6'-dimethoxy-[ 1 , 1 '-biphenyl]-2-yl)phosphine, DMF;
  • PGi and PG 2 are a protecting group;(i) 1,1,3,3- tetramethylguanidine, THF; (ii) H 2 , Dioxane; (iii) Deprotection of PGie.
  • PGi and PG 2 are protecting groups;(i) 1,1,3,3- tetramethylguanidine, THF; (ii) H 2 , Dioxane; (iii) Deprotection of PGie.
  • PG is a protecting group;(i) 3-bromo-5-chloro-l,2,4- thiadiazole,NaHC03, Pd(dppf)Cl2, water and THF, ACN or dioxane; (ii) NaHC0 3 , Pd(dppf)Cl 2 , water and THF, ACN or dioxane; (iii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group;(i) NaOfeu or CS 2 CO 3 , Pd(dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group;(i) NaOfeu or Cs 2 C0 3 , Pd(dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group;(i) (a) where R 2 is NH-(CRaRb) m -COOH: NH 2 -(CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;(b) where R 2 is NH-S0 2 -R 8 : R 8 S0 2 NH 2 , DCC, DMAP, DCM (c) where R 2 is NR 4 iR4 2 : HNR 4i R 42 , HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA; (d) where R 2 is N(Ri)-(CR a R b )m-CO-N(Ri)-heterocyclyl: HN(Ri)-(CR a R b )m-CO
  • PGi and PG 2 are protecting groups; (i) DIEA, 1,1,1-trifluoro-N- phenyl-N-((trifluoromethyl)sulfonyl)methanesulfonamide, DCM; (ii) KOAc, bis-pinacolatoborane, PdCl 2 (dppf); (iii) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (iv) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (v) Deprotection of PG 2 , e.g.
  • PG is a protecting group; (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (ii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group; (i) Zn(CN) 2 , Pd(Ph ) 4 , NMP; (ii) hydroxylamine, NEt 3 , EtOH; (iii) EDC, HOBt, DMF then heat; (iv) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group; (i) NH 4 C1, NaN 3 , DMF; (ii) CsC0 3 , or K 2 C0 3 , DMF, acetone or acetonitrile; (iii) Deprotection of PG, e.g., tert-bvXyX ester deprotection: DCM, TFA.
  • PG is a protecting group; (i) sodium tert-butoxide, Pd 2 (dba) 3 , dioxane; (ii) Deprotection of PG, e.g., tert- vXyl ester deprotection: DCM, TFA.
  • PG is a protecting group; (i) sodium tert-butoxide, Pd 2 (dba) 3 , dioxane; (ii) Deprotection of PG, e.g., tert- vXyl ester deprotection: DCM, TFA.
  • DCM tert- vXyl ester deprotection
  • PG is a protecting group; (i) NaO Bu or CS 2 CO3, Pd2(dppf)Ci2 or Pd 2 (dba) ? , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Pd/C, H 2 , EtOH, (iii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PGi and PG 2 are protecting groups; (i) HATU, DMF, DIEA; (ii) Deprotection of PG 2 , e.g. benzyl ester deprotection: Pd/C, H 2 , MeOH; (iii) HNR 41 R 42 , HATU, DMF; (iv) Deprotection of PGi, e.g., tert-butyl ester deprotection: dioxane, HC1 or DCM, TFA.
  • PGi and PG 2 are protecting groups and XA and X B are CR 4 or N;
  • Deprotection of PGi e.g., tert-bvXyX ester deprotection: DCM, TFA;
  • PGi and PG 2 are protecting groups and XA and X B are CR 4 or N;
  • Pd(dppf)Cl 2 Na 2 C0 3 , THF, ACN, water;
  • Br-(CR a Rb) m -R 7 K 2 C0 3 , DMF;
  • Deprotection of PG 2 e.g., tert-bvXy ⁇ ester deprotection: DCM, TFA.
  • PGi and PG 2 are protecting groups and XA and X B are CR 4 or N;(i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, acetonitrile, water; (ii) Deprotection of PG 2 , e.g., tert-bvXy ⁇ ester deprotection: DCM, TFA.
  • PGi and PG 2 are protecting groups and XA and X B are CR 4 or N;
  • Pd 2 (dba) 3 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, NaOtBu, dioxane;
  • Deprotection of PG 2 e.g., tert-butyl ester deprotection: DCM, TFA.
  • PGi and PG 2 are protecting groups and XA and X B are CR 4 or N;
  • dppf PdCl 2
  • HOBt HOBt
  • EDC EDC
  • DMF EtOH
  • Deprotection of PG 2 e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group and XA and X B are CR 4 or N;
  • R 2 is NH-(CR a R b ) m -COOH: NH 2 -(CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;
  • R 2 is NR 4 iR 42 : HNR 4 iR 42 , HATU, DMF then deprotection e.g., tert-but
  • PGi, PG 2 and PG 3 are protecting groups; (i) DIEA, 1,1,1- trifluoro-N-phenyl-N-((trifluoromethyl)sulfonyl)methanesulfonamide, DCM; (ii) KOAc, bis-pinacolatoborane, PdCl 2 (dppf); (iii) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (iv) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (v) Deprotection of PGi, e.g., tert-butyl ester deprotection: DCM, TFA; (vi) (i) (a) where R 2 is NH- (CR a R b ) m -COOH: NH 2 -(CR a R b ) m -COOPG,
  • PGi and PG 2 are protecting groups; (i) HATU, DMF, DIEA; (ii) Deprotection of PGi,e.g., tert-butyl ester deprotection: dioxane, HCl or DCM, TFA; (iii) HNR 4 iR 42 , HATU, DMF; (iv) Deprotection of PG 2 e.g. benzyl ester deprotection: Pd/C, H 2 , MeOH.
  • PG is a protecting group; (i) (a) where R 2 is NH-(CRaRb) m - COOH: NH 2 -(CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;(b) where R 2 is NH 2 -heterocyclyl, NH-S0 2 -R 8 : R 8 S0 2 NH 2 , DCC or EDC, DMAP, DCM (c) where R 2 is NR4iR4 2 : HNR4iR4 2 , HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group; (i) (a) where R 2 is NH-(CRaRb) m - COOH: NH 2 -(CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;(b) where R 2 is NH-S0 2 -R 8 : R 8 S0 2 NH 2 , DCC, DMAP, DCM (c) where R 2 is NR 4 iR4 2 : HNR41R42, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA.
  • PGi, and PG 2 are protecting groups and XA and X B are CR 4 or N; (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (ii) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, ACN, water; (iii) Deprotection of PG 2 , e.g.
  • Reagents (i) HATU, DMF; (ii) hydrazine hydrate, THF, EtOH; (iii) thiocarbonyldiimadazole, DIEA, THF.
  • Method 2 5% mobile phase B (95% A) for 1 min, 5-95% B over 9 min, then held at 95% B for 5 min.
  • Method 3 20-100% mobile phase B (80-0 % A) over 2.5 min then held at 100% B for 4.5 min.
  • Method 12 5% D (95% C) for 1 min. then 5-95% D over 9 min. and held at 95% D for 5 min.
  • System lb Agilent 1100/6110 HPLC system equipped with a Agilent Poroshell 120 EC-C8, 2.7 ⁇ (50 X 3 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
  • Method 13 5% D (95% C) to 95% D over 12 min. then held at 95% D for 2.8 min. and to 5% D over 0.2 min.
  • System lc Agilent 1100/6110 HPLC system equipped with a Agilent Poroshell 120 EC-C18, 2.7 ⁇ (50 X 3 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
  • Method 14 5% D (95% C) to 95% D over 12 min. then held at 95% D for 2.8 min. and then to 5% D over 0.2 min.
  • Method 15 20% D (80% C) to 95% D over 3 min. and hold at 95% D 1.8 min. then to 20% D over 0.2 min.
  • Method 16 20% D (80% C) to 95% D over 3.0 min. and hold at 95% D for 3.8 min. then 20% D over 0.2 min.
  • System 2 Agilent 1200 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 4 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 5 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • System 3 Waters Fractionlynx LCMS system equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ , (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 6 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 7 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • System 4 Agilent 1260 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 8 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 9 5- 95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • System 5 Agilent 1260 LCMS equipped with a Waters Xselect CSH CI 8 3.5 ⁇ (4.6 x 50 mm) column using water with 0.1 %> formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 10 The gradient was 5-95% mobile phase B over 13.0 min with a flow rate of 2.5 mL/min, then held at 95% for 1.0 min with a flow rate of 4.5 mL/min.
  • Method 11 The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.6 min with an flow rate of 4.5 mL/min.
  • System 6 Waters Acquity UPLC system equipped with a Acquity UPLC BEH CI 8, 1.7 ⁇ (2.1 x 50 mm) or Phenomenex Kinetex CI 8, 1.7 ⁇ (2.1 x 50 mm) column using water with 10 mM ammonium formate as mobile phase A, acetonitrile as mobile phase B with a flow rate of 0.5 mL/min.
  • Method 17 10% mobile phase B (90% A) for 0.5 min, 10- 95% B over 3 min, then held at 95% B for 1.1 min, 95-10% B over 0.1 min then held for 0.3 min and the total run time is 5 min.
  • Method 18 20% mobile phase B (80% A) for 0.5 min, 20-95% B over 3 min, then held at 95% B for 1.1 min, 95-20% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
  • Method 19 30% mobile phase B (70% A) for 0.5 min, 30-95% B over 2.2 min, then held at 95% B for 1.9 min, 95-30% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
  • Method 20 40% mobile phase B (60% A) for 0.5 min, 40-95% B over 1.9 min, then held at 95% B for 2.2 min, 95-40% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
  • Method 21 20% mobile phase B (80% A) for 0.5 min, 20-95% B over 2.7 min, then held at 95% B for 1.4 min, 95-20% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
  • Method 22 40% mobile phase B (60% A) for 0.5 min, 40- 95% B over 1.6 min, then held at 95% B for 2.5 min, 95-40% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
  • Pyridine, dichloromethane (DCM), tetrahydrofuran (THF), and toluene used in the procedures were from Aldrich Sure-Seal bottles or Acros AcroSeal dry solvent and kept under nitrogen (N 2 ). All reactions were stirred magnetically and temperatures are external reaction temperatures.
  • EA ethyl acetate
  • NMP l-methy-2-pyrrolidinone
  • TEA triethylamine
  • HOBt N- hydroxybenzotriazole
  • EDC N,N-dimethylformamide
  • DMF dimethyl acetamide
  • DMA Di-tert-butyl dicarbonate
  • Boc 2 0 N,N-Diisopropylethylamine
  • acetic acid AcOH
  • hydrochloric acid HC1
  • O-(7-azabenzotriazol-l-yl-N,N,N',N'- tetramethyluronium hexafluorophosphate HATU
  • DMAP 4-dimethylaminopyridine
  • t-BuOH sodium hydr
  • Oxadiazoles via Acid Chlorides To synthesize oxadiazoles via acid chlorides, dioxanes and DIEA (1.5 eq) were added to a stirred solution of amidoxime (1 eq) followed by an acid chloride (1.1 eq). The reaction mixture was stirred at room temperature for 30 min then at 120°C for up to 6 h. The reaction mixture was allowed to cool to room temperature, diluted with EA and washed with brine. The organics were concentrated and the residue purified by chromatography.
  • the coupling reagent could be HATU (1.05 - 2.5 eq) optionally with DMAP (0.01 - 1 eq), EDC (1.5 eq) with HOBt (1.5 eq) or DMAP (0.01 - 1 eq), DCC (1.1 eq) with HOBt (1.1 eq) or DCC (1.5 eq) with DMAP (2.0 eq).
  • the reaction mixture was stirred until the reaction was complete.
  • the reaction was diluted with EA and washed with saturated aqueous NaHC0 3 .
  • the organic layer was dried over MgS0 4 and concentrated.
  • the product was purified by chromatography or alternatively can be carried on to the next step without further purification.
  • the reaction was diluted with EA and washed with saturated aqueous NaHC0 3 .
  • the organic layer was dried over Na 2 S0 4 and concentrated.
  • the product can be purified by chromatography, preparative HPLC, or carried on to the next step without further purification.
  • the reaction mixture was stirred at room temperature for 2 h, partitioned between saturated aqueous NaHC0 3 (5 ml) and EA (5 mL), and concentrated under reduced pressure to afford the intermediate (5)-methyl 2-(4-(tert- butyl)benzamido)-3-(4-(((4-(heptyloxy)benzimidamido) oxy)carbonyl) phenyl) propanoate.
  • the intermediate was dissolved in DMF (lmL) and heated to 100°C for 18 h.
  • the reaction mixture was cooled to room temperature and partitioned between EA (5 mL) and saturated aqueous NaHC0 3 (5 mL).
  • the reaction mixture was stirred at room temperature for 2 h, partitioned between saturated aqueous NaHC0 3 (15 mL) and EA (15 mL), and concentrated under reduced pressure to afford the intermediate ( ⁇ S)-methyl 2-(4-(tert-butyl)benzamido)-3-(4-(N-((4- (heptyloxy)benzoyl)oxy)carbamimidoyl)phenyl)propanoate.
  • the intermediate was dissolved in DMF (10 mL) and heated to 100°C for 18 h.
  • the reaction mixture was cooled to room temperature and partitioned between EA (10 mL) and saturated aqueous NaHC0 3 (50 mL).
  • Compounds 3 - 11 and 13 - 61 were prepared from ( Z)-methyl 2-(4- (tert-butyl)benzamido)-3-(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate INT-2 using General Procedures5 and 4 sequentially.
  • Compounds 62 - 66 were prepared from (,S,Z)-methyl 2-(4-(tert- butyl)benzamido)-3 -(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate INT-2 using General Procedures5, 6, and 4 sequentially.
  • Compound 69 was prepared from (S, Z)-methyl 2-(4-(fert- butyl)benzamido)-3 -(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate Compound 2 using General Procedure 7.
  • Compound70 was prepared from (S, Z)-methyl 2-(4-(tert- butyl)benzamido)-3 -(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate Compound 2 using General Procedures 7 and 8 sequentially.
  • Compound 76 was prepared using (S)-methyl 2-(4-(tert-butyl)benzamido)- 3-(4-(5-(4-(heptyloxy)phenyl)-l ,3,4-oxadiazol-2-yl)phenyl)propanoate and General Procedure 4. 2-bromo-l-(4-(heptyloxy)phenyl)ethanone (INT-4)
  • Compound 78 was prepared from (5)-methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(2-(4-(heptyloxy)phenyl)oxazol-4-yl)phenyl)propanoate and 4-(tert-butyl)benzoic acid using General Procedures 8, 7 then 4.
  • Compound 79 was prepared from (5)-methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(4-(4-(fieptyloxy) phenyl) thiazol-2-yl) phenyl propanoate and 4-(tert-butyl)benzoic acid using General Procedures 8, 7 then 4.
  • Compound 80 was prepared from (5)-methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(2-(4-(heptyloxy)phenyl)thiazol-4-yl)phenyl)propanoate and 4-(tert-butyl)benzoic acid using General Procedures 8, 7 then 4.
  • Compound 81 was prepared from Methyl 2-((tert-butoxycarbonyl)amino)- 3-(4-(5-(4-(heptyloxy) phenyl) thiazol-2-yl) phenyl) propanoate and 4-(tert- butyl)benzoyl chloride using General Procedures 8, 3 then 4.
  • Compound 82 was prepared in a similar fashion to Compound 81 using 4- (2-(4-(heptyloxy) phenyl) thiazol-5-yl)benzaldehyde in place of 4-(5-(4- (heptyloxy)phenyl)thiazol-2-yl) benzaldehyde.
  • Compound 83 was prepared from (5)-methyl 2- (4-(tert-butyl) benzamido) -3-(4-(5-(4-(heptyloxy) phenyl)- 1 , 3, 4-thiadiazol-2-yl)phenyl)propanoate using General Procedure 4.
  • Compound 84 was prepared using 3-bromo-5-chloro-l,2,4-thiadiazole, (4- (heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Compounds 159 - 181 were prepared from (S)-tert- vXy ⁇ 2-amino-3-(4-(5- (4-(tert-butyl) phenyl)pyrimidin-2-yl)phenyl)propanoate INT-11 using General Procedures 3 ox 7 followed by 4 or 8.
  • Compound 182 was prepared in a manner analogous to 165 starting from (R)-tert-butyl 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compound 183 was prepared from (S)-3-(4-(5-(4- (heptyloxy)phenyl)pyrimidin-2-yl)-2-(4-hydroxybenzamido)propanoic acid, Compound 114 using General Procedure 13.
  • Compound 191 was prepared in a manner analogous to 85 starting from (R)-tert-butyl 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compound 193 was prepared in a manner analogous to 192 starting from (R)-tert-butyl 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compunds 237 - 247 were prepared from tert-butyl (5)-3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(fert-butyl)thiophene-2-carboxamido)propanoate INT-17 using General Procedures 10 and 8 sequentially.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Diabetes (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Emergency Medicine (AREA)
  • Child & Adolescent Psychology (AREA)
  • Endocrinology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Nitrogen- Or Sulfur-Containing Heterocyclic Ring Compounds With Rings Of Six Or More Members (AREA)
  • Hydrogenated Pyridines (AREA)
  • Pyridine Compounds (AREA)
  • Thiazole And Isothizaole Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Pyrrole Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Steroid Compounds (AREA)
PCT/US2014/041997 2013-06-11 2014-06-11 Novel glp-1 receptor modulators Ceased WO2014201172A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
MX2015016831A MX370666B (es) 2013-06-11 2014-06-11 Novedosos moduladores del receptor de péptido tipo glucagón 1 (glp-1).
HK16110427.4A HK1222176A1 (zh) 2013-06-11 2014-06-11 新型glp-1受体调节剂
NZ715006A NZ715006B2 (en) 2013-06-11 2014-06-11 Novel glp-1 receptor modulators
CA2913791A CA2913791A1 (en) 2013-06-11 2014-06-11 Novel glp-1 receptor modulators
KR1020167000708A KR102271179B1 (ko) 2013-06-11 2014-06-11 신규의 glp-1 수용체 조절제
EP14736554.8A EP3008056B8 (en) 2013-06-11 2014-06-11 Novel glp-1 receptor modulators
BR112015031040A BR112015031040A8 (pt) 2013-06-11 2014-06-11 Novos moduladores do receptor de glp-1
JP2016519629A JP6573604B2 (ja) 2013-06-11 2014-06-11 新規なglp−1レセプターモジュレーター
ES14736554T ES2864349T3 (es) 2013-06-11 2014-06-11 Nuevos moduladores del receptor GLP-1
AU2014278183A AU2014278183B2 (en) 2013-06-11 2014-06-11 Novel GLP-1 receptor modulators
HK16110429.2A HK1222177B (zh) 2013-06-11 2014-06-11 新型glp-1受體調節劑
EA201592281A EA030857B1 (ru) 2013-06-11 2014-06-11 Новые модуляторы рецептора glp-1
CN201480044849.7A CN105593225B (zh) 2013-06-11 2014-06-11 新型glp-1受体调节剂

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201361833737P 2013-06-11 2013-06-11
US61/833,737 2013-06-11
US201461981643P 2014-04-18 2014-04-18
US61/981,643 2014-04-18

Publications (1)

Publication Number Publication Date
WO2014201172A1 true WO2014201172A1 (en) 2014-12-18

Family

ID=51136825

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/041997 Ceased WO2014201172A1 (en) 2013-06-11 2014-06-11 Novel glp-1 receptor modulators

Country Status (13)

Country Link
US (3) US9260427B2 (https=)
EP (1) EP3008056B8 (https=)
JP (1) JP6573604B2 (https=)
KR (1) KR102271179B1 (https=)
CN (2) CN109867630A (https=)
AU (1) AU2014278183B2 (https=)
BR (1) BR112015031040A8 (https=)
CA (1) CA2913791A1 (https=)
EA (1) EA030857B1 (https=)
ES (1) ES2864349T3 (https=)
HK (1) HK1222176A1 (https=)
MX (1) MX370666B (https=)
WO (1) WO2014201172A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016094729A1 (en) * 2014-12-10 2016-06-16 Celgene International Ii Sarl Glp-1 receptor modulators
US9598430B2 (en) 2013-06-11 2017-03-21 Celgene International Ii Sàrl GLP-1 receptor modulators
US9700543B2 (en) 2011-05-31 2017-07-11 Celgene International Ii Sàrl GLP-1 receptor stabilizers and modulators
WO2018200833A1 (en) * 2017-04-28 2018-11-01 Celgene International Ii Sarl Novel glp-1 receptor modulators
US10858359B2 (en) 2016-06-07 2020-12-08 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic ring derivatives useful as SHP2 inhibitors
US10988466B2 (en) 2017-03-23 2021-04-27 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
US12233062B2 (en) 2018-09-26 2025-02-25 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112014013925B1 (pt) 2011-12-12 2022-02-22 Receptos Llc Compostos moduladores do receptor de glp-1 e composição e combinação farmacêutica compreendendo os ditos compostos
CA2955836C (en) * 2014-07-25 2023-02-14 Celgene International Ii Sarl Glp-1 receptor modulators
CN109608524B (zh) * 2018-11-09 2022-06-03 北京志道生物科技有限公司 兼具dpp-4抑制及glp1r激活活性的多肽衍生物、制备和应用
HRP20241159T1 (hr) 2020-02-07 2024-12-06 Gasherbrum Bio, Inc. Heterociklički agonisti za glp-1
TW202206429A (zh) 2020-04-29 2022-02-16 美商迦舒布魯姆生物有限公司 雜環glp—1促效劑
CN111548311B (zh) * 2020-06-04 2021-04-23 山西医科大学 一种小分子glp-1r激动剂及其应用
JP2023537501A (ja) 2020-08-06 2023-09-01 ガシャーブラム・バイオ・インコーポレイテッド ヘテロ環glp-1アゴニスト
JP2025509281A (ja) 2022-03-09 2025-04-11 ガシャーブラム・バイオ・インコーポレイテッド ヘテロ環式glp-1アゴニスト
US20250206757A1 (en) 2022-03-21 2025-06-26 Gasherbrum Bio, Inc. 5,8-dihydro-1,7-naphthyridine derivatives as glp-1 agonists for the treatment of diabetes
US20250250269A1 (en) 2022-04-14 2025-08-07 Gasherbrum Bio, Inc. Heterocyclic glp-1 agonists
CN114989204A (zh) * 2022-06-16 2022-09-02 西北工业大学 一种葡萄糖响应自修复凝胶用的二苯乙炔类液晶态交联剂的制备方法
CN120981457A (zh) 2023-09-14 2025-11-18 歌礼制药(中国)有限公司 Glp-1r激动剂及其治疗方法
TW202521534A (zh) 2023-11-24 2025-06-01 香港商歌禮製藥(中國)有限公司 Glp-1r 激動劑及其治療方法

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999010312A1 (en) * 1997-08-22 1999-03-04 F. Hoffmann-La Roche Ag N-alkanoylphenylalanine derivatives
EP1477482A1 (en) * 2002-02-20 2004-11-17 Ajinomoto Co., Inc. Novel phenylalanine derivative
WO2005077915A1 (en) * 2004-02-10 2005-08-25 Janssen Pharmaceutica, N.V. Pyridazinones as antagonists of a4 integrins
EP1700850A1 (en) * 2003-12-22 2006-09-13 Ajinomoto Co., Inc. Novel phenylalanine derivative
WO2011094890A1 (en) * 2010-02-02 2011-08-11 Argusina Inc. Phenylalanine derivatives and their use as non-peptide glp-1 receptor modulators
WO2013090454A2 (en) * 2011-12-12 2013-06-20 Receptos, Inc. Novel glp-1 receptor modulators

Family Cites Families (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IT1062206B (it) 1974-02-01 1983-09-20 Rotta Research Lab S P A A S Derivati della tirosina attivi sulla muscolatura liscia
DE2423536A1 (de) 1974-05-15 1975-11-27 Bayer Ag 3-amino-phenylessigsaeure-derivate, verfahren zu ihrer herstellung sowie ihre verwendung als herbizide
SK94393A3 (en) * 1992-09-11 1994-08-10 Thomae Gmbh Dr K Cyclic derivatives of urea, process for their production and their pharmaceutical agents with the content of those
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5780498A (en) * 1993-11-01 1998-07-14 Ciba-Geigy Japan Limited Endothelin receptor antagonists
US6174905B1 (en) 1996-09-30 2001-01-16 Mitsui Chemicals, Inc. Cell differentiation inducer
DE122007000044I2 (de) 1997-01-07 2011-05-05 Amylin Pharmaceuticals Inc Verwendung von exedinen und deren antagonisten zur verminderung der lebensmittelaufnahme
US6583139B1 (en) 1997-07-31 2003-06-24 Eugene D. Thorsett Compounds which inhibit leukocyte adhesion mediated by VLA-4
AR016133A1 (es) * 1997-07-31 2001-06-20 Wyeth Corp Compuesto de carbamiloxi que inhiben la adhesion de leucocitos mediada por vla-4, compuestos que son prodrogas de dichos compuestos, composicionfarmaceutica, metodo para fijar vla-4 a una muestra biologica, metodo para el tratamiento de una condicion inflamatoria
PL338457A1 (en) 1997-07-31 2000-11-06 Elan Pharm Inc Sulphonylated dipeptidic compounds capable to inhibit adhesion of leucocytes through the mediation of vla-4
CN1276785A (zh) * 1997-08-22 2000-12-13 霍夫曼-拉罗奇有限公司 N-烷酰基苯丙氨酸衍生物
US6191171B1 (en) 1997-11-20 2001-02-20 Merck & Co., Inc. Para-aminomethylaryl carboxamide derivatives
JP4245682B2 (ja) * 1997-12-25 2009-03-25 協和発酵キリン株式会社 キノリン誘導体、イソキノリン誘導体、およびシンノリン誘導体、並びに抗炎症剤および抗アレルギー剤
US6197794B1 (en) * 1998-01-08 2001-03-06 Celltech Therapeutics Limited Phenylalanine derivatives
MY153569A (en) * 1998-01-20 2015-02-27 Mitsubishi Tanabe Pharma Corp Inhibitors of ?4 mediated cell adhesion
EP1992641A3 (en) 1998-12-07 2009-07-29 Ipsen Pharma GLP-1 analogues
US6902744B1 (en) 1999-01-14 2005-06-07 Amylin Pharmaceuticals, Inc. Exendin agonist formulations and methods of administration thereof
EP1150565A1 (en) * 1999-02-08 2001-11-07 LION bioscience AG Thiazole derivatives and combinatorial libraries thereof
JP3795305B2 (ja) * 1999-07-19 2006-07-12 田辺製薬株式会社 医薬組成物
TWI302149B (en) 1999-09-22 2008-10-21 Bristol Myers Squibb Co Substituted acid derivatives useful as antiodiabetic and antiobesity agents and method
DE60033684T2 (de) * 1999-11-18 2007-12-06 Ajinomoto Co., Inc. Phenylalaninderivate
CZ20022352A3 (cs) * 1999-12-06 2003-05-14 F. Hoffmann-La Roche Ag 4-pyridinyl-N-acyl-L-fenylalaniny
TR200401217T4 (tr) 2000-03-07 2004-06-21 Aventis Pharma Deutschland Gmbh İkameli 3-Fenil-5-Alkoksi-1,3,4-Oksdiazol-2-one (ve) hormona duyarlı lipazın önlenmesinde kullanılması
US6960597B2 (en) * 2000-06-30 2005-11-01 Orth-Mcneil Pharmaceutical, Inc. Aza-bridged-bicyclic amino acid derivatives as α4 integrin antagonists
CA2420040C (en) * 2000-08-18 2009-02-03 Ajinomoto Co., Inc. New phenylalanine derivatives
WO2002028830A1 (en) * 2000-09-29 2002-04-11 Ajinomoto Co.,Inc. Novel phenylalanine derivatives
WO2003048081A2 (en) 2001-12-04 2003-06-12 Bristol-Myers Squibb Company Glycinamides as factor xa inhibitors
WO2003053926A1 (en) * 2001-12-13 2003-07-03 Ajinomoto Co.,Inc. Novel phenylalanine derivative
JPWO2003089410A1 (ja) * 2002-04-19 2005-08-25 協和醗酵工業株式会社 フェニルアラニン誘導体
US20070276034A1 (en) 2002-05-31 2007-11-29 Luke Esposito Compounds, compositions and methods for the treatment of synucleinopathies
PL224879B1 (pl) 2002-09-04 2017-02-28 Pharmacopeia Drug Discovery Inc Pirazolo [1,5-a] pirymidynowy związek, jego zastosowanie do wytwarzania leku oraz zawierająca go farmaceutyczna kompozycja
MXPA05002571A (es) 2002-09-04 2005-09-08 Schering Corp Pirazolopirimidinas como inhibidores de cinasa dependientes de ciclina.
US20040152750A1 (en) 2002-12-20 2004-08-05 Kodra Janos Tibor Novel glucagon antagonists
CN100436429C (zh) * 2003-02-20 2008-11-26 味之素株式会社 具有喹唑二酮骨架的苯丙氨酸衍生物的制造方法及制造中间体
EP1644321B1 (en) 2003-06-13 2011-02-09 Laboratorios S.A.L.V.A.T., S.A. New benzamides as ppaty modulators
JP4829506B2 (ja) * 2004-02-17 2011-12-07 石原産業株式会社 チオアミド系化合物又はその塩、並びにそれらを含有するサイトカイン産生抑制剤
US7618981B2 (en) * 2004-05-06 2009-11-17 Cytokinetics, Inc. Imidazopyridinyl-benzamide anti-cancer agents
WO2006117743A1 (en) 2005-05-03 2006-11-09 Ranbaxy Laboratories Limited Substituted aromatic compounds as antidiabetic agents
EP1899304A1 (en) 2005-05-23 2008-03-19 Arena Pharmaceuticals, Inc. 5-amino-1h-pyrazole-3-carboxylic acid derivatives as agonists for the g-protein coupled receptor (gpcr) rup38 for the treatment of metabolic-related disorders thereof
US7825139B2 (en) 2005-05-25 2010-11-02 Forest Laboratories Holdings Limited (BM) Compounds and methods for selective inhibition of dipeptidyl peptidase-IV
ES2416354T3 (es) * 2005-06-21 2013-07-31 Ajinomoto Co., Inc. Cristal de derivado de fenilalanina, método de producción del mismo y uso del mismo
JP2009516729A (ja) * 2005-11-23 2009-04-23 アストラゼネカ アクチボラグ L−フェニルアラニン誘導体
JP2009539815A (ja) * 2006-06-09 2009-11-19 アストラゼネカ アクチボラグ 固形腫瘍の治療用のa5b1アンタゴニストとしてのN−(ベンゾイル)−O−[2−(ピリジン−2−イルアミノ)エチル]−L−チロシン誘導体と関連化合物
EP1878730A1 (en) 2006-07-12 2008-01-16 Bayer Schering Pharma Aktiengesellschaft Substituted isoxazolines, pharmaceutical compositions containing the same, methods of preparing the same, and uses of the same
ES2380135T3 (es) * 2006-11-22 2012-05-08 Ajinomoto Co., Inc. Método de preparación de derivados de fenilalanina que tienen esqueleto de quinazolinadiona e intermedios para su preparación
WO2008064823A1 (en) * 2006-11-27 2008-06-05 Ucb Pharma, S.A. Bicyclic and heterobicyclic derivatives, processes for preparing them and their uses
US7816324B2 (en) 2007-03-13 2010-10-19 Board Of Regents, The University Of Texas System Composition and method for the treatment of diseases affected by a peptide receptor
CA2688136A1 (en) 2007-06-08 2008-12-11 Advinus Therapeutics Private Limited Pyrrole-2-carboxamide derivatives as glucokinase activators, their process and pharmaceutical application
EP2205085A1 (en) * 2007-09-25 2010-07-14 Merck Sharp & Dohme Corp. 2-aryl or heteroaryl indole derivatives
ES2549768T3 (es) * 2010-03-29 2015-11-02 Ajinomoto Co., Inc. Cristal de sal hidrocloruro de derivado de fenilalanina
JP2013530963A (ja) 2010-06-09 2013-08-01 レセプトス インコーポレイテッド 新規のglp−1受容体安定化薬および調節薬
JP6007417B2 (ja) 2011-05-31 2016-10-12 レセプトス エルエルシー 新規glp−1受容体安定剤および調節剤
US8999975B2 (en) * 2011-09-19 2015-04-07 Boehringer Ingelheim International Gmbh Substituted N- [1-cyano-2- (phenyl) ethyl] -2-azabicyclo [2.2.1] heptane-3-carboxamide inhibitors of cathepsin C
CN109867630A (zh) 2013-06-11 2019-06-11 赛尔基因第二国际有限公司 新型glp-1受体调节剂
CA2955836C (en) 2014-07-25 2023-02-14 Celgene International Ii Sarl Glp-1 receptor modulators

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999010312A1 (en) * 1997-08-22 1999-03-04 F. Hoffmann-La Roche Ag N-alkanoylphenylalanine derivatives
EP1477482A1 (en) * 2002-02-20 2004-11-17 Ajinomoto Co., Inc. Novel phenylalanine derivative
EP1700850A1 (en) * 2003-12-22 2006-09-13 Ajinomoto Co., Inc. Novel phenylalanine derivative
WO2005077915A1 (en) * 2004-02-10 2005-08-25 Janssen Pharmaceutica, N.V. Pyridazinones as antagonists of a4 integrins
WO2011094890A1 (en) * 2010-02-02 2011-08-11 Argusina Inc. Phenylalanine derivatives and their use as non-peptide glp-1 receptor modulators
WO2013090454A2 (en) * 2011-12-12 2013-06-20 Receptos, Inc. Novel glp-1 receptor modulators

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9700543B2 (en) 2011-05-31 2017-07-11 Celgene International Ii Sàrl GLP-1 receptor stabilizers and modulators
US9598430B2 (en) 2013-06-11 2017-03-21 Celgene International Ii Sàrl GLP-1 receptor modulators
US10259823B2 (en) 2013-06-11 2019-04-16 Celgene International Ii Sàrl GLP-1 receptor modulators
WO2016094729A1 (en) * 2014-12-10 2016-06-16 Celgene International Ii Sarl Glp-1 receptor modulators
US9795613B2 (en) 2014-12-10 2017-10-24 Celgene International Ii Sàrl GLP-1 receptor modulators
US10034886B2 (en) 2014-12-10 2018-07-31 Celgene International Ii Sàrl GLP-1 receptor modulators
AU2015360364B2 (en) * 2014-12-10 2020-04-30 Receptos Llc GLP-1 receptor modulators
US10858359B2 (en) 2016-06-07 2020-12-08 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic ring derivatives useful as SHP2 inhibitors
US10988466B2 (en) 2017-03-23 2021-04-27 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
WO2018200833A1 (en) * 2017-04-28 2018-11-01 Celgene International Ii Sarl Novel glp-1 receptor modulators
US11530205B2 (en) 2017-04-28 2022-12-20 Receptos Llc GLP-1 receptor modulators
US12233062B2 (en) 2018-09-26 2025-02-25 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors

Also Published As

Publication number Publication date
CA2913791A1 (en) 2014-12-18
MX370666B (es) 2019-12-19
JP6573604B2 (ja) 2019-09-11
EP3008056B8 (en) 2021-03-03
BR112015031040A2 (https=) 2017-07-25
US20160214993A1 (en) 2016-07-28
CN105593225A (zh) 2016-05-18
EP3008056A1 (en) 2016-04-20
CN105593225B (zh) 2019-04-16
US20150011527A1 (en) 2015-01-08
EA201592281A1 (ru) 2016-05-31
US10259823B2 (en) 2019-04-16
AU2014278183B2 (en) 2018-10-04
EA030857B1 (ru) 2018-10-31
CN109867630A (zh) 2019-06-11
US9260427B2 (en) 2016-02-16
US20170313717A1 (en) 2017-11-02
AU2014278183A1 (en) 2016-01-07
HK1222177A1 (zh) 2017-06-23
US9598430B2 (en) 2017-03-21
ES2864349T3 (es) 2021-10-13
KR20160042868A (ko) 2016-04-20
MX2015016831A (es) 2016-04-04
HK1222176A1 (zh) 2017-06-23
JP2016528180A (ja) 2016-09-15
KR102271179B1 (ko) 2021-07-01
EP3008056B1 (en) 2020-12-09
BR112015031040A8 (pt) 2018-01-02
NZ715006A (en) 2021-02-26

Similar Documents

Publication Publication Date Title
EP3008056B1 (en) Novel glp-1 receptor modulators
AU2012352349B2 (en) Carboxylic acid derivatives comprising four cycles acting as GLP-1 receptor modulators for therapy of diseases such as diabetes
US10034886B2 (en) GLP-1 receptor modulators
HK1202864B (en) Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
NZ715006B2 (en) Novel glp-1 receptor modulators
NZ626122B2 (en) Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14736554

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2913791

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/016831

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2016519629

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015031040

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 201592281

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2014278183

Country of ref document: AU

Date of ref document: 20140611

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014736554

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20167000708

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015031040

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151211