WO2014130741A2 - Nme inhibitors and methods of using nme inhibitors - Google Patents
Nme inhibitors and methods of using nme inhibitors Download PDFInfo
- Publication number
- WO2014130741A2 WO2014130741A2 PCT/US2014/017515 US2014017515W WO2014130741A2 WO 2014130741 A2 WO2014130741 A2 WO 2014130741A2 US 2014017515 W US2014017515 W US 2014017515W WO 2014130741 A2 WO2014130741 A2 WO 2014130741A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nme7
- cells
- cancer
- nme
- agent
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/0216—Bacteriodetes, e.g. Bacteroides, Ornithobacter, Porphyromonas
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
- A61K39/001162—Kinases, e.g. Raf or Src
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4727—Mucins, e.g. human intestinal mucin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1229—Phosphotransferases with a phosphate group as acceptor (2.7.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/04—Phosphotransferases with a phosphate group as acceptor (2.7.4)
- C12Y207/04006—Nucleoside-diphosphate kinase (2.7.4.6)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
- G01N33/5073—Stem cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0331—Animal model for proliferative diseases
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0271—Chimeric vertebrates, e.g. comprising exogenous cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- A61K38/1735—Mucins, e.g. human intestinal mucin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/0004—Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
- A61K49/0008—Screening agents using (non-human) animal models or transgenic animal models or chimeric hosts, e.g. Alzheimer disease animal model, transgenic model for heart failure
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/71—Assays involving receptors, cell surface antigens or cell surface determinants for growth factors; for growth regulators
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
Definitions
- the present application relates to inhibitors of NME family of proteins.
- the present application also relates to a method of using the inhibitors.
- anti-cancer drugs that are cytotoxic agents have been replaced or have been augmented by 'smart' drugs that target a particular molecule that directly or indirectly promotes cancer cell growth.
- the targeted molecule is expressed more in cancer cells than in healthy cells.
- NME proteins are ligands of the MUC1* growth factor receptor and that these ligand-receptor pairs mediate the growth of both stem cells and cancer cells (Mahanta et al, 2008, Hikita et al, 2008, Smagghe et al, 2013).
- NM23-H1 and NM23-H2 had been implicated as having a role in differentiation, however the literature was full of contradictory reports (Lombardi et al, 1995).
- ⁇ 23 had been identified as the inhibiting factor that prevented leukemia cells from reaching terminal differentiation, which is a hallmark of the disease (Okabe-Kado, J., et al. 1985, Okabe-Kado, J., et al. 1992, Okabe-Kado, J., et al. 1995).
- NM23-H1 and H-2 were ligands of the MUC1* growth factor receptor which promoted stem and cancer cell growth via ligand induced dimerization of MUCl*'s extracellular domain, it was not known how ⁇ 23 was involved in differentiation or more importantly that it had to be a dimer, or dimerize its target receptor, to be active.
- dimeric ⁇ 23 binds to and dimerizes MUC1* on cancer cells and stem cells and promotes cancer growth and survival or growth and pluripotency, respectively.
- ⁇ 23 tetramers or hexamers do not bind to the PSMGFR region of the MUC1* receptor and have the opposite function as the dimers.
- Hexameric ⁇ 23 induces differentiation of stem cells.
- MUC1* the cleaved form
- PSMGFR sequence the extracellular domain
- MUC1* the extracellular domain
- PSMGFR sequence the extracellular domain
- ligand-induced dimerization it was unknown how MUCl was related to cancer if at all.
- essentially all other attempts at developing anti-cancer therapeutics aimed at MUCl targeted the tandem repeats of the extracellular domain, which the inventors showed is shed and released from the cell surface.
- the invention is directed to antibodies that preferentially recognize cancer cells but not healthy cells where MUCl is clipped to a growth factor receptor form.
- the invention is directed to antibodies that target NME proteins.
- the antibodies target NME proteins that are preferentially expressed in early life and to a much lesser degree in adult life. Preferably, these NME proteins are present at high levels in stem cells but not in adult cells.
- the antibodies target NME proteins that are preferentially expressed in the very early stages of embryogenesis or in naive state stem cells but not expressed or expressed at low levels in adult tissues.
- antibodies are generated that target NME1
- antibodies are generated that target NME6
- antibodies are generated that target NME1 or NME6, wherein they inhibit dimerization.
- antibodies are generated that target NME7.
- the antibodies that are generated which recognize an NME protein also inhibit its dimerization. In another aspect of the invention, the antibodies that are generated which recognize an NME protein, inhibit its interaction with MUC1. In yet another aspect of the invention, the antibodies that are generated which recognize an NME protein, inhibit its interaction with MUC1* or its interaction with the PSMGFR peptide.
- antibodies are generated that bind to MUC1* and inhibit its interaction with NME proteins. In one aspect, they inhibit the interaction between MUC1* and NME7 but not between MUC1* and NME1.
- antibodies are generated outside of the patient, for example, in an animal, in a cell, or artificially generated including using phage display and binding assays.
- the antibodies are generated in the patient, wherein portions of the targeted proteins are given alone or in combinations, wherein an adjuvant may be added for use as a vaccine.
- the present invention is direct to an agent that inhibits function of an NME family member protein.
- the agent may be an antibody, such as Fab, monovalent, bivalent or IgM, bi-specific, human or humanized. Or, the agent may be a small molecule.
- the function of the NME family member protein that may be sought to be inhibited may be the ability of the NME family member protein to: promote stem cell proliferation and/or inhibit differentiation; promote cancer cell proliferation and/or inhibit differentiation; bind to MUC1*; bind to DNA; act as a transcription factor; be secreted by a cell; or form a dimer.
- the NME family member may be preferably NME7 or NME7-AB.
- the agent may be an antibody that inhibits tumorigenic activity of NME7 or NME7AB.
- the NME family member may be a variant of NME7 having a molecular weight between 25 and 33 kDa.
- the NME family member may be NME6 or NMEl.
- the invention is directed to a method for treating a patient with cancer or at risk of developing cancer comprising administering to the patient an effective amount of an agent that inhibits tumorigenic activity of an NME family member protein.
- the NME family member protein may be preferably, NME7, NME6, or NMEl.
- the agent may inhibit NME7 activity but not NMEl activity.
- the agent may inhibit binding between NME7 and MUCl*.
- the agent may inhibit binding between NME7 and its cognate nucleic acid binding site.
- the agent may be an antibody.
- the invention is directed to a method for treating a patient with cancer or at risk of developing cancer comprising administering to the patient an effective amount of NMEl as a hexamer.
- the NMEl polypeptide may be a mutant or variant that prefers hexamer state.
- the invention is directed to a method for treating a patient with cancer or at risk of developing cancer comprising administering to the patient an effective amount of NME6 as a monomer.
- NME6 may be a mutant or a variant that prefers monomer state.
- the invention is directed to a method for treating a patient with cancer or at risk of developing cancer comprising administering to the patient an effective amount of NMEl as a monomer.
- NMEl may be a mutant or variant that prefers monomer state.
- the invention is directed to a method for treating a patient with cancer or at risk of developing cancer comprising administering to the patient an effective amount of a peptide or peptide mimic that inhibits the interaction of the NME family member with its cognate receptor.
- the cognate receptor may be MUCl.
- the peptide may be derived from the MUCl* portion of MUCl, PSMGFR, N-10 PSMGFR, N-15 PSMGFR, or N-20 PSMGFR.
- the invention is directed to a method for classifying cancers or stratifying patients, having or suspected of having cancer, comprising the steps of: (i) analyzing a patient sample for the presence of stem or progenitor cell genes or gene products; and (ii) grouping patients who share similar expression or expression levels of stem or progenitor cell genes or gene products.
- the method may further include the step of (iii) treating the patient with agents that inhibit those stem or progenitor cell genes or gene products.
- the method may include the steps of (iii) analyzing the stem or progenitor genes or gene products to assess severity of the cancer, wherein expression of, or higher expression of, genes or gene products that are characteristic of earlier stem or progenitor states indicate more aggressive cancers and expression of, or higher expression of, genes or gene products that are characteristic of later progenitor states indicate less aggressive cancers; (iv) designing therapy commensurate with treating patient with cancer more or less aggressive cancer as determined in step (iii); and (v) treat patient with therapy in accordance with the design in step (iv).
- the patient sample may be blood, bodily fluid, or biopsy.
- the genes or gene products may be NME family proteins.
- the genes or gene product indicative of an earlier stem cell state may be NME7 or NME6.
- the invention is directed to an agent that inhibits the interaction of an NME family member protein and a MUC1 transmembrane protein whose extracellular domain is devoid of the tandem repeat domain, wherein the agent binds to MUC1* on cancer cells with a higher affinity than its binding to the MUC1 transmembrane protein whose extracellular domain is devoid of the tandem repeat domain present on healthy cells in an adult.
- the agent may include without limitation, an antibody, natural product, synthetic chemical or nucleic acid.
- the NME family member protein may be NME7, NME6 or bacterial NME.
- the invention is directed to a method of inhibiting interaction of an NME family member protein and a MUC1 transmembrane protein whose extracellular domain is devoid of the tandem repeat domain in a cell, comprising contacting the cell with an agent that binds to MUC1* on cancer cells with a higher affinity than its binding to the MUC1 transmembrane protein whose extracellular domain is devoid of the tandem repeat domain on healthy cells in an adult.
- the agent may include without limitation, an antibody, natural product, synthetic chemical or nucleic acid.
- the NME family member protein may be NME7, NME6 or bacterial NME.
- the invention is directed to a method of identifying an agent that inhibits the interaction of an NME family member protein and a MUC1 transmembrane protein whose extracellular domain is devoid of the tandem repeat domain, which steps may include determining affinity of the agent for MUC1* present on cancer cells, determining affinity of the agent for MUC1* present on stem or progenitor cells, and selecting an agent that binds to MUC1* present on cancer cells better than its ability to bind to MUC1* present on stem or progenitor cells, thus identifying the agent.
- the agent may include without limitation, an antibody, natural product, synthetic chemical or nucleic acid.
- the stem or progenitor cells may be embryonic stem cells, iPS cells, cord blood cells, bone marrow cells or hematopoietic progenitor cells.
- the NME family member protein may be NME7, NME6 or bacterial NME.
- the invention is directed to a transgenic mammal that expresses human NME protein in the germ cells and somatic cells, wherein the germ cells and somatic cells contain a nucleic acid encoding human NME introduced into said mammal.
- the human NME may be recombinantly expressed in the transgenic mammal.
- the transgenic mammal may not be human.
- the NME protein may be preferably inducibly expressed.
- the NME protein may be preferably NME7 or NME7-AB.
- the invention is directed to a method of generating a mammal that responds to cancer in a way that more closely resembles the response of a human wherein the mammal is a mammal in which human NME protein is expressed.
- the cancer may be spontaneously generated or implanted from cultured cells or from a human being.
- the NME protein may be NMEl dimer or NME7 monomer.
- the mammal may be transgenic, wherein the mammal may express human MUC1 or MUC1* or NME protein in the germ cells and somatic cells, wherein the germ cells and somatic cells contain a recombinant human MUC1 or MUC1* or NME protein gene sequence introduced into said mammal.
- the NME protein is inducibly expressed.
- the NME protein may be NME7 or NME7-AB.
- the invention is directed to a method for increasing engraftment of human tumors in mammals, comprising mixing the human tumor cells with NMEl dimers or NME7 monomers prior to injecting the cells into the test mammals.
- the invention is directed to a method for generating an antibody comprising injecting an NME family protein or peptide fragment or fragments thereof into a mammal and harvesting the antibody or antibody producing cell.
- the NME family protein may be NME7 or NME7-AB or NMEl.
- the peptide fragment may be selected from SEQ ID NOS:88-140, more preferably 88-133, more preferably 88-121.
- the invention is directed to a method of generating or selecting an antibody or antibody-like molecule that specifically binds to NME family protein or peptide fragment thereof, comprising: (i) screening an antibody library or library of antibody fragments or epitopes with the NME family protein or peptide fragment; (ii) assaying for binding to the NME family protein or a peptide fragment thereof; and (iii) identifying the specifically bound antibody or antibody-like molecule.
- the method may further comprise engineering the identified antibody or antibody-like molecule for administration to a patient for the treatment or prevention of cancer using methods well known in the art.
- the NME family protein may be NME7 or NME7-AB or NMEl.
- the peptide fragment may be selected from SEQ ID NOS:88-140, more preferably 88-133, more preferably 88-121.
- the present invention is directed to a method of preventing cancer by vaccinating a person with an NME family protein or peptide fragment or fragments thereof.
- the peptide fragment or fragments may include one or more peptides whose sequence is present in an NME family protein, which is optionally mixed with a carrier, adjuvant or attached to an immunogenic agent.
- the NME family protein may be NMEl, NME6, NME7 or NME7-AB.
- the peptide fragment may be selected from SEQ ID NOS:88-140, more preferably 88-133, more preferably 88-121.
- the peptide sequence is not a fragment of human NME-H1 protein.
- Figure 1 is a graph of cancer cell growth measured as a function of bivalent or monovalent antibody concentration, showing that it is dimerization of the MUC1* receptor that stimulates growth.
- the addition of bivalent antibody produces the characteristic bell- shaped growth curve indicative of growth factor receptor dimerization.
- the growth of MUC1 -negative HEK 293 cells was not impacted by either the bivalent or monovalent Fab Anti-MUCl*.
- the bivalent antibody was added in excess, there is one bivalent antibody bound to each receptor rather than one bivalent antibody dimerizing every two receptors and thus inhibits growth.
- Figure 2 is a graph of tumor volume measurement of T47D breast cancer cells, implanted into nu/nu female mice, after treatment with either vehicle or the Fab of MN-E6 anti- MUCl* antibody.
- the efficacy of anti-MUCl* E6 antibody was found to be statistically significant in reducing tumor volume with p values of 0.0001.
- FIGS 3A-3D Photos of Western blot gels showing the expression of NME1 or NME7 in the cell lysate of: 1) BGOIV human embryonic stem cells cultured in NM23-H1 dimers over a surface coated with a MUC1* antibody surface (MN-C3 mab); 2) BGOIV human embryonic stem cells cultured according to standard protocol in bFGF over a layer of mouse feeder cells (MEFs); 3) T47D breast cancer cells cultured by standard method in RPMI media; and 4) recombinant human NM23-H1 wild type, "wt" (A, B).
- Bottom row (C, D) shows the results of a "pull-down” or an immuno-precipitation assay in which the cell lysates were separately incubated with beads to which was added an antibody to the MUC1 cytoplasmic tail, "Ab-5".
- Species captured by binding to the MUC1* peptide were separated by SDS-PAGE and blotted with antibodies against each respective NM23 protein. Same experiments were conducted with NME6 but data is not shown.
- Figures 4A-4E show photos of Western blots in which cell lysates from T47D breast cancer cells, BGOIV and HES-3 human ES cells and human SC101-A1 iPS cells were probed for the presence of NME1, NME6 or NME7.
- NME1 in all cell lines ran with an apparent molecular weight of ⁇ 17kDa (A).
- NME7 ⁇ 33kDa species and the 42kDa species (C, E) could be detected in all but the HES-3 cell line (cultured in FGF).
- Species that reacted with an NME6-specific antibody were detected in all cell lines except the HES-3 cell line, when visualization was enhanced using Super Signal.
- Figures 5A-5C show panels of photos of Western blots of human embryonic stem (ES) cells (A) and induced pluripotent stem (iPS) cells (B,C) probed for the presence of NME7.
- Westerns show the presence of three forms of NME7 in the cell lysates.
- B conditioned media
- FIGS 6A-6C are an elution profile of size exclusion chromatography purification of NME7-AB;
- B is non-reducing SDS-PAGE gel from NME7-AB peak fractions;
- (C) is the elution profile of size exclusion chromatography of the purified NME7-AB.
- Figures 7A-7C show photographs of nanoparticle binding assays wherein a MUC1* extra cellular domain peptide is immobilized onto SAM-coated nanoparticles, and NME proteins are added free in solution. A color change from pink to blue indicates that the protein free in solution can simultaneously bind to two peptides on two different nanoparticles.
- Figure 8 shows graph of HRP signal from ELISA sandwich assay showing NME7-
- Figures 9A-9D are magnified photographs of human iPS stem cells cultured in either recombinant NME7-AB, or recombinant NM23 (NME1) purified dimers on Day 1 post-plating.
- Figures 10A-10D are magnified photographs of human iPS stem cells cultured in either recombinant NME7-AB, or recombinant NM23 (NME1) purified dimers on Day 3 post- plating.
- FIGs 11A-11D show photos of an immunocytochemistry experiment showing that human HES-3 stem cells cultured for 10 or more passages in NME7-AB are positive for the pluripotency markers NANOG (A), OCT3/4 (B), Tra 1-81 (C) and SSEA4 (D).
- Figure 12A-12C are photos of HES-3 embryonic stem cells stained with an antibody that recognizes tri-methylated Lysine 27 on Histone 3 which forms a condensed dot if the cell has progressed from the naive state to the primed state wherein a X chromosome is inactivated (XaXi) as opposed to both X's active (XaXa).
- A) cells were first cultured in FGF media on MEF feeder cells (XaXi), B) then grown in NME7 for 10 passages (XaXa), C) then back into FGF- MEFs for 4 passages (XaXi).
- Figures 13A-13G show photos of MUCl*-positive cancer cells treated with nothing (Row A), Taxol (Row B) or an anti-NME7 antibody (Rows C-E); a graph showing cell count in response to treatment at 48 hours (F), and a dot-blot used to estimate antibody concentration used in the cancer cell inhibition experiment (G).
- Figures 14A-14K show the 48 hour results of an experiment using an anti-NME7 antibody to inhibit cancer cell growth. Photos of the cells cultured in media alone (A), taxol (B), or anti-NME7 at the concentrations indicated (C-J); a graph of cell number obtained using a calcein am assay is shown (K).
- Figure 15A-15K show the 96 hour results of an experiment using an anti-NME7 antibody to inhibit cancer cell growth. Photos of the cells cultured in media alone (A), taxol (B), or anti-NME7 at the concentrations indicated (C-J); a graph of cell number obtained using a calcein am assay is shown (K). The graph and the photos show anti-NME7 antibodies inhibit cancer cell growth at concentrations as low as in the nanomolar range.
- Figure 16 shows a native, non-denaturing gel that shows the multimerization state of NM23-WT versus three different preparations of recombinant NM23-S 120G.
- FIGS 17A-17G show photographs of non-reducing gels of NM23-WT, NM23-S 120G-mixed, NM23-S 120G-hexamer and NM23-S 120G-dimer, showing the multimerization state of the wild type protein and the three different preparations of the S 120G mutant.
- Figure 17B shows Surface Plasmon Resonance (SPR) measurements of different NM23 multimers binding to MUC1* extra cellular domain peptide (PSMGFR) attached to the SPR chip surface.
- Figure 17C shows photograph of a nanoparticle experiment showing that only NM23 dimers bind to the cognate receptor MUC1*. MUC1* extra cellular domain peptide was immobilized onto gold nanoparticles.
- Figures 17D-G show different NM23-H1 multimers tested for their ability to support pluripotent stem cell growth.
- Figure 18 is a cartoon of the timing of the expression of NME7, NME1 dimer and NME1 hexamer and the expression levels of their associated cancer/stem factors resulting from analysis of the experiments described herein.
- FIGs 19A-19I show graphs of the results of ELISA assays in which human NME6 is shown to bind to the PSMGFR peptide of the MUC1* extra cellular domain.
- Recombinant NME6-wt is separated by FPLC into monomers or multimers and assayed by ELISA for ability to bind to a surface of PSMGFR peptide (A).
- the NME6 multimers were dissociated by dilution in SDS according to a fraction of the CMC (critical micelle concentration), then assayed by ELISA for ability to bind to a surface of PSMGFR peptide (B).
- NME6 mutants that are designed to prefer dimerization were generated by mimicking the NME1 S 120G mutation that prefers dimer formation and is S 139G in NME6 by alignment.
- a second mutant was made by mutating residues such that human NME6 is converted in that critical area to look like sea sponge NME6 which has been reported to exist as a dimer.
- These recombinant mutants were expressed and purified then assayed for the ability to bind to a surface of PSMGFR peptide (C).
- D-I are photos of polyacrylamide gels evidencing expression of various recombinant human NME6 proteins.
- D) NME6 wt is expressed.
- NME6 bearing S 139G mutation corresponding to the S 120G mutation in NMEl, is expressed.
- Figures 20A-20D show photos of Western blots in which cell lysates (A,C) or nuclear fractions (B,D) from T47D breast cancer cells, BGOIV and HES-3 human ES cells and human SC101-A1 iPS cells were probed for the presence of NME7 (A,B) or NMEl (C,D).
- Figure 21 is a graph of real time PCR measurements of NMEl, NME6, NME7 and MUC1 in MUCl-positive T47D breast cancer cells, MUCl-positive DU145 prostate cancer cells and MUC1 -negative PC3 prostate cancer cells. Measurements are relative to 18S ribosomal RNA and normalized to the measurements of the T47D cells. Both MUCl-positive cancer cell lines are high in NME7. The MUC1 -negative cell line has no detectable NMEl, NME7 or MUC1 but has very high expression of NME6.
- Figure 22 is a photo of a Western blot wherein stem cell lysates (odd numbered lanes) or cell conditioned media (even numbered lanes) were probed for the presence of NME7.
- iPS induced pluripotent stem cells were cultured in FGF over MEFs (lanes 1,2), NM23-H1 dimers over an anti-MUCl* antibody (C3) surface (lanes 3,4) or NME7 over an anti-MUCl* antibody (C3) surface (lanes 5-8).
- HES-3 human embryonic stem cells were cultured in FGF over MEFs (lanes 9,10), NM23-H1 dimers over an anti-MUCl* antibody (C3) surface (lanes 11,12) or NME7 over an anti-MUCl* antibody (C3) surface (lanes 13,14).
- Mouse embryonic fibroblast (MEFs) cells were also probed (lanes 15,16).
- the Western blot shows that the cell lysates contain an NME7 species with molecular weight of ⁇ 42kDa, which corresponds to the full-length protein. However, the secreted species runs with an apparent MW of ⁇ 33kDa, which corresponds to an NME7 species that is devoid of the N-terminal leader sequence.
- Figures 23A-23B are photos of the same Western blot shown in Figure 22 that was then stripped and probed for the presence of histidine-tagged species which would identify recombinant NM23-H1, ⁇ 17kDa and NME7-AB 33kDa, in which stem cells in lanes 3-8 and 11- 14 were cultured. Minimal staining resulted, indicating that the major NME7 species detected in Figure 22 was the native NME7 produced and processed by the stem cells.
- Figures 24A-24B show photos of Western blots of various cell lysates and corresponding conditioned media probed for the presence of NME7 using a mouse monoclonal antibody (A) or another monoclonal antibody that only recognizes the N-terminal DM10 sequence (B).
- A mouse monoclonal antibody
- B another monoclonal antibody that only recognizes the N-terminal DM10 sequence
- FIGS 25A-25B show a polyacrylamide gel of NME from the bacterium Halomonas Sp. 593, which was expressed in E. coli and expressed as a soluble protein and natural dimer.
- Figure 26 shows a polyacrylamide gel of NME from the bacterium Porphywmonas gingivalis W83.
- Figures 27A-27C show sequence alignment of Halomonas Sp 593 bacterial NME to human NME-H1.
- B shows sequence alignment of Halomonas Sp 593 bacterial NME to human NME7-A domain.
- C shows sequence alignment of Halomonas Sp 953 bacterial NME to human NME7-B domain.
- Figures 28A-28D are photographs of human embryonic stem cells cultured in bacterial NME from Halomonas Sp 593 at 10X magnification (A,C) or 20X (B,D)
- Figure 29 is a graph of RT-PCR data measuring expression of the stem/cancer cell marker OCT4 after human fibroblast cells were cultured in a serum free media containing either human NME7-AB, human NME1 dimer or bacterial NME from Halomonas Sp 593.
- Figure 30 is a graph of RT-PCR measurement of the expression levels of the stem/cancer genes OCT4 and NANOG in fibroblasts that have been cultured in the presence of human NME7-AB, human NME1 or bacterial NME from Halomonas Sp 593, 'HSP 593' .
- a rho kinse inhibitor 'ROCi' was added to make non-adherent cells (those becoming stem/cancer-like) adhere to the surface.
- Figure 31 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing human NME1 in dimer form at 4X magnification.
- Figure 32 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing human NME1 in dimer form at 20X magnification.
- Figure 33 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing bacterial NME from Halomonas Sp 593 at 4X magnification.
- Figure 34 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing bacterial NME from Halomonas Sp 593 at 20X magnification.
- Figure 35 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing human NME7-AB at 4X magnification.
- Figure 36 shows photographs of human fibroblast cells after 18 days in culture in a serum-free media containing human NME7-AB at 20X magnification.
- Figure 37 shows photographs of human fibroblast cells after 18 days in standard media without NME protein at 4X magnification.
- Figure 38 shows photographs of human fibroblast cells after 18 days in standard media without NME protein at 20X magnification.
- Figure 39 is a graph of RT-PCR measurement of the expression levels of transcription factors BRD4 and co-factor JMJD6 in the earliest stage naive human stem cells compared to the later stage primed stem cells.
- Figure 40 is a graph of RT-PCR measurement of the expression levels of the chromatin rearrangement factors that are suppressed when fibroblasts revert to an induced pluripotent state while others are suppressed in naive stem cells and in some cancer cells.
- Expression levels of the chromatin rearrangement genes Brd4, JMJD6, Mbd3 and CHD4 were measured in fibroblasts that have been cultured in the presence of human NME7-AB, human NME1 or bacterial NME from Halomonas Sp 593, 'HSP 593'.
- a rho kinse inhibitor 'ROCi' was added to make non-adherent cells (those becoming stem/cancer-like) adhere to the surface.
- Figure 41 is a composite graph of RT-PCR measurements of the expression levels of the stem/cancer genes in fibroblasts that have been cultured in the presence of human NME7- AB, human NME1 or bacterial NME from Halomonas Sp 593, 'HSP 593' .
- a rho kinase inhibitor 'ROCi' was added to make non-adherent cells (those becoming stem/cancerlike) adhere to the surface.
- Figure 42 is a composite graph of RT-PCR measurements of the expression levels of the stem/cancer genes in fibroblasts that have been cultured in the presence of human NME7- AB, human NME1 or bacterial NME from Halomonas Sp 593, 'HSP 593', with the Y-axis compressed to better show differences in genes having smaller changes.
- a rho kinse inhibitor 'ROCi' was added to make non-adherent cells (those becoming stem/cancer-like) adhere to the surface.
- Figure 43 is a graph of RT-PCR measurements of gene expression for stem cell markers and cancer stem cell markers for T47D cancer cells after being cultured in traditional media or a media containing NME7, wherein cells that became non-adherent (floaters) were analyzed separate from those that remained adherent.
- Figure 44 is a graph of RT-PCR measurements of gene expression for stem cell marker SOX2 and cancer stem cell marker CXCR4 for T47D cancer cells.
- Cells were cultured either in traditional media or a media containing NME1 dimers or NME7 (NME7-AB).
- NME7-AB NME7
- Cell types that were separately analyzed were floating cells, cells plus Rho kinase inhibitor (+Ri), which made all cells adhere, or cells that remained adherent after floaters were removed which was in the absence of rho kinase inhibitor (- Ri).
- Figure 45 is a graph of RT-PCR measurements of gene expression for a variety of stem and putative cancer stem cell markers for T47D breast cancer cells.
- Cells were cultured either in traditional media or a media containing NME1 dimers ("NM23") or NME7 (NME7- AB).
- NM23 NME1 dimers
- NME7- AB NME7
- Cell types that were separately analyzed were floating cells, cells plus Rho kinase inhibitor (+Ri), which made all cells adhere, or cells that remained adherent after floaters were removed which was in the absence of rho kinase inhibitor (- Ri).
- Figure 46 is a graph of RT-PCR measurements of gene expression for a variety of stem and putative cancer stem cell markers for DU145 prostate cancer cells.
- Cells were cultured either in traditional media or a media containing NME1 dimers ("NM23”) or NME7 (NME7- AB). Rho kinase inhibitor was not used because by passage 2, cells remained adherent.
- Figure 47 is a graph of RT-PCR measurements of gene expression for a variety of stem and putative cancer stem cell markers for DU145 prostate cancer cells.
- Cells were cultured either in traditional media or a media containing NMEl dimers ("NM23”) or NME7 (NME7- AB). Rho kinase inhibitor was not used because by passage 2, cells remained adherent.
- Figure 48 is a graph of RT-PCR measurement of the expression levels of reported 'cancer stem cell' or 'tumor initiating cell' markers CDH1 (E-cadherin), CXCR4, NANOG, OCT4 and SOX2, along with MUC1 in T47D breast cancer cells following culture in a minimal serum-free base media wherein the only factors that were added were either the '2i' inhibitors (GSK3-beta and MEK inhibitors) or human recombinant NME7-AB. The cells that were analyzed were those that started growing anchorage-independently, 'floaters' .
- Figure 49 is a graph of RT-PCR measurement of the expression levels of transcription factors BRD4 and co-factor JMJD6, reported to suppress NME7 and induce NMEl, respectively, and chromatin re-arrangement factors MBD3 and CHD4, reported to block induction of stem cell pluripotency, in T47D breast cancer cells following culture in a minimal serum-free base media wherein the only factors that were added were either the '2i' inhibitors (GSK3-beta and MEK inhibitors) or human recombinant NME7-AB.
- Figure 50 is a cartoon of the interaction map of NME7 and associated factors resulting from analysis of the experiments described herein.
- Figure 51 is a graph of tumor volumes measured over time. T47D breast cancer cells were implanted using the standard method (dashed line) or wherein the cells were mixed 50/50 vol/vol with NME7-AB and after 10 days, those mice were injected daily with NME7-AB.
- Figure 52 shows a graph of a quantitative PCR assay that measured expression of RNA for MMP14, MMP16 and ADAM 17, which can cleave MUC1 -full-length to MUC1*, in either cultured cancer cells (T47D), human embryonic stem cells (HES) cultured in either FGF, NM23-H1 dimers or NME7.
- T47D cultured cancer cells
- HES human embryonic stem cells
- Figure 53 is a graph of RT-PCR measurement of the expression levels of cleavage enzymes MMP14, MMP16 and ADAM 17 in HES-3 human embryonic stem cells grown in FGF, HES-3 cells grown in human NME7-AB, HES-3 cells grown in NMEl dimers, T47D breast cancer cells in vitro, T47D breast cancer cells implanted into an animal, DU145 prostate cancer cells in vitro, DU145 cells implanted into an animal, and 1500 breast cancer cells implanted into an animal, all normalized to HES-3 cells grown in FGF on MEFs.
- Figure 54 is a graph of RT-PCR measurement of the expression levels of cleavage enzymes MMP14, MMP16 and ADAM 17 in T47D breast cancer cells in vitro, HES-3 human embryonic stem cells grown in FGF, HES-3 cells grown in human NME7-AB, HES-3 cells grown in NME1 dimers, all normalized to T47D breast cancer cells in vitro.
- Figure 55 is a graph of tumor volume measurement of DU145 hormone refractory prostate cancer cells, implanted into NOD/SCID male mice, after 60 days of treatment with either vehicle or the Fab of MN-E6 anti-MUCl* antibody. From Day 60 to Day 70 the treatment groups were switched. The efficacy of anti-MUCl* E6 antibody was found to be statistically significant in reducing tumor volume with p values of 0.0001.
- Figure 56 is a graph of RT-PCR measurement of the expression levels of cleavage enzymes MMP14 and MMP16 in tumors excised from DU145 hormone refractory prostate cancer cells, implanted into NOD/SCID male mice, after 60 days of treatment with either vehicle or the Fab of MN-E6 anti-MUCl* antibody. Although treatment blocking the MUC1* growth factor receptor decreased expression of both cleavage enzymes only MMP14 was statistically significant.
- FIG. 57A-57B is a photograph of a Western blot probing for MUC1* in tumors excised from DU145 hormone refractory prostate cancer cells, implanted into NOD/SCID male mice, after 60 days of treatment with either vehicle or the Fab of MN-E6 anti- MUCl* antibody. The photo shows that in anti-MUCl* Fab treated mice, there is less MUC1*, i.e. less MUC1 cleavage in the treated group.
- (B) is a graph of RT-PCR measurement of the expression levels of microRNA-145 in tumors excised from DU145 hormone refractory prostate cancer cells, implanted into NOD/SCID male mice, after 60 days of treatment with either vehicle or the Fab of MN-E6 anti-MUCl* antibody.
- the graph shows that on average, miR-145, which signals a stem cell to differentiate, is increased in the treated group compared to the control group.
- Figures 58A-58D show the results of FACS experiments wherein live cancer cells were probed with either stem cell specific anti-MUCl* monoclonal antibodies or cancer cell specific monoclonal antibodies.
- A MN-C2 monoclonal antibody that was selected based on binding preference to the N-10 peptide shows strong binding to live T47D breast cancer cells and is cancer cell specific.
- B MN-C3 monoclonal antibody that was selected based on binding preference to the C-10 peptide shows no binding to live T47D breast cancer cells and is stem cell specific.
- C Cancer cell specific MN-C2 binds to DU145 prostate cancer cells.
- D) Stem cell specific MN-C3 does not bind to DU145 prostate cancer cells.
- E) The graph of another FACS experiment shows that cancer cell specific monoclonal antibodies MN-C2 and MN-E6 binds to DU145 prostate cancer cells, while the stem cell specific MN-C3 does not.
- FIGS 59A-59D show the results of FACS experiments wherein either stem cells or cancer cells were probed with either stem cell specific anti-MUCl* monoclonal antibodies or cancer cell specific monoclonal antibodies.
- Stem cell specific MN-C3 monoclonal shows strong binding to BGOlv human embryonic stem cells (A), but shows no binding to T47D breast cancer cells (B), or to DU145 prostate cancer cells (C).
- the graph of another FACS experiment shows that stem cell specific MN-C3 monoclonal shows strong binding to stem cells but does not bind to T47D breast cancer cells, 1500 breast cancer cell line, DU145 prostate cancer cells, or MUC1- negative PC3 prostate cancer cells (D).
- Figure 60A-60E shows photos of DU145 prostate cancer cells cultured in ordinary media to which was added either nothing (A), the Fab of stem cell specific MN-C3 (B), the Fab of stem cell specific MN-C8 (C), the Fab of cancer cell specific MN-C2 (D), or the Fab of cancer cell specific MN-E6 (E). If the antibody recognized MUC1* as it appears on the cancer cells, the Fab of the antibody would block the dimerization of MUC1* and induce cell death. As can be seen in the photos, the Fabs of the stem cell specific antibodies had no effect on the cancer cell growth, while the Fabs of the cancer cells specific antibodies effectively killed the cancer cells.
- Figure 61 is a sequence alignment between human NME1 and human NME7-A or - B domain.
- Figure 62 lists immunogenic peptides from human NME7 with low sequence identity to NME1.
- the listed peptide sequences are identified as being immunogenic peptides giving rise to antibodies that target human NME7 but not human NME1.
- the sequences were chosen for their lack of sequence homology to human NME1, and are useful as NME7 specific peptides for generating antibodies to inhibit NME7 for the treatment or prevention of cancers.
- Figure 63 lists immunogenic peptides from human NME7 that may be important for structural integrity or for binding to MUC1*. Bivalent and bi-specific antibodies wherein each variable region binds to a different peptide portion of NME7 are preferred. Such peptides may be generated by using more than one peptide to generate the antibody specific to both. The peptides are useful as NME7 specific peptides for generating antibodies to inhibit NME7 for the treatment or prevention of cancers. [00101] Figure 64 lists immunogenic peptides from human NMEl that may be important for structural integrity or for binding to MUCl*.
- peptide sequences are from human NMEl and were selected for their high homology to human NME7 as well as for their homology to other bacterial NME proteins that are able to mimic its function.
- peptides 50 to 53 have high homology to human NME7-A or -B and also to HSP 593.
- the "MUCl*" extra cellular domain is defined primarily by the PSMGFR sequence (GTIN VHD VETQFNQ YKTE A AS RYNLTIS D VS VS D VPFPFS AQS G A (SEQ ID NO:6)). Because the exact site of MUCl cleavage depends on the enzyme that clips it, and that the cleavage enzyme varies depending on cell type, tissue type or the time in the evolution of the cell, the exact sequence of the MUCl* extra cellular domain may vary at the N- terminus.
- PSMGFR Primary Sequence of MUCl Growth Factor Receptor as set forth as
- N-10 PSMGFR N-10 PSMGFR
- N-15 PSMGFR N-20 PSMGFR
- C-number refers to the number of amino acid residues that have been deleted at the C-terminal end of PSMGFR.
- the extracellular domain of MUCl* refers to the extracellular portion of a MUCl protein that is devoid of the tandem repeat domain.
- MUCl* is a cleavage product wherein the MUCl* portion consists of a short extracellular domain devoid of tandem repeats, a transmembrane domain and a cytoplasmic tail.
- the precise location of cleavage of MUCl is not known perhaps because it appears that it can be cleaved by more than one enzyme.
- the extracellular domain of MUCl* will include most of the PSMGFR sequence but may have an additional 10-20 N-terminal amino acids.
- NME family proteins or “NME family member proteins”, numbered 1-10, are proteins grouped together because they all have at least one NDPK (nucleotide diphosphate kinase) domain. In some cases, the NDPK domain is not functional in terms of being able to catalyze the conversion of ATP to ADP.
- NME proteins were formally known as NM23 proteins, numbered HI, H2 and so on. Herein, the terms NM23 and NME are interchangeable.
- NME1, NME2, NME6 and NME7 are used to refer to the native protein as well as NME variants. In some cases these variants are more soluble, express better in E.
- NME7 as used in the specification can mean the native protein or a variant, such as NME7-AB that has superior commercial applicability because variations allow high yield expression of the soluble, properly folded protein in E. coli.
- NME1 as referred to herein is interchangeable with "NM23-H1". It is also intended that the invention not be limited by the exact sequence of the NME proteins.
- the mutant NME1-S 120G, also called NM23-S 120G, are used interchangeably throughout the application. The S 120G mutants and the P96S mutant are preferred because of their preference for dimer formation, but may be referred to herein as NM23 dimers or NME1 dimers.
- NME7 as referred to herein is intended to mean native NME7 having a molecular weight of about 42kDa, a cleaved form having a molecular weight between 25 and 33kDa, a variant devoid of the DM10 leader sequence, NME7-AB or a recombinant NME7 protein, or variants thereof whose sequence may be altered to allow for efficient expression or that increase yield, solubility or other characteristics that make the NME7 more effective or commercially more viable.
- the present invention discloses antibodies and antibody variants that modulate a pathway involving MUC1* wherein one set of antibodies preferentially binds to MUC1* as it exists on stem cells but does not recognize MUC1* on cancer cells as well and another set of antibodies that preferentially binds to MUC1* as it exists on cancer cells but does not recognize MUC1* on stem cells as well.
- the present invention further discloses methods for identifying other antibodies that fall into these categories.
- the invention further discloses methods for using the first set of antibodies, hereafter referred to as “stem cell antibodies”, for stimulating stem cell growth in vitro and in vivo.
- the invention also discloses methods for using the second set of antibodies, hereafter referred to as "cancer cell antibodies”, for inhibiting cancer cell growth in vitro and in vivo.
- the cancer specific antibodies MIN-C2 also referred to herein as well as in the applications from which the present application claims priority as "C2”
- MIN-E6 also referred to herein as well as in the applications from which the present application claims priority as "E6”
- WO2010/042562 PCT/US2009/059754
- the stem cell specific antibodies 2D6C3 also referred to herein as well as in the applications from which the present application claims priority as "C3” or MN-C3 or 2D6C8 (also referred to herein as well as in the applications from which the present application claims priority as “C8”) or MN-C8 are the same antibodies structurally and sequence-wise as referred to in the present application as in other applications by the Applicant.
- a description of these antibodies and their CDR sequences can be found in WO2012/126013 (PCT/US2012/059754), filed March 19, 2012. In particular, see Figures 13 to 18 therein.
- an "effective amount of an agent to inhibit an NME family member protein” refers to the effective amount the agent in hindering the activating interaction between the NME family member protein and its cognate receptor such as MUC1 or MUC1*.
- high homology is considered to be at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identity in a designated overlapping region between any two polypeptides.
- low homology is considered lower than 25%, 20%, 15%, 10%, or 5% identity in a designated overlapping region between any two polypeptides.
- small molecule in reference to an agent being referred to as a "small molecule”, it may be a synthetic chemical or chemically based molecule having a molecular weight between 50Da and 2000Da, more preferably between 150 Da and 1000 Da, still more preferably between 200Da and 750Da.
- 2i inhibitor refers to small molecule inhibitors of GSK3-beta and MEK of the MAP kinase signaling pathway.
- the name 2i was coined in a research article (Silva J et al 2008), however herein “2i” refers to any inhibitor of either GSK3-beta or MEK, as there are many small molecules or biological agents that if they inhibit these targets, have the same effect on pluripotency or tumorigenesis.
- FGF FGF-2 or bFGF refer to fibroblast growth factor.
- Rho associated kinase inhibitors may be small molecules, peptides or proteins (Rath N, et al, 2012). Rho kinase inhibitors are abbreviated here and elsewhere as ROCi or ROCKi, or Ri. The use of specific rho kinase inhibitors are meant to be exemplary and can be substituted for any other rho kinase inhibitor.
- cancer stem cells or “tumor initiating cells” refers to cancer cells that express levels of genes that have been linked to a more metastatic state or more aggressive cancers.
- cancer stem cells or “tumor initiating cells” can also refer to cancer cells for which far fewer cells are required to give rise to a tumor when transplanted into an animal. Cancer stem cells and tumor initiating cells are often resistant to chemotherapy drugs.
- stem/cancer As used herein, the terms “stem/cancer”, “cancer-like”, “stem-like” refers to a state in which cells acquire characteristics of stem cells or cancer cells, share important elements of the gene expression profile of stem cells, cancer cells or cancer stem cells.
- Stem-like cells may be somatic cells undergoing induction to a less mature state, such as increasing expression of pluripotency genes.
- Stem-like cells also refers to cells that have undergone some de- differentiation or are in a meta-stable state from which they can alter their terminal differentiation.
- Cancer like cells may be cancer cells that have not yet been fully characterized but display morphology and characteristics of cancer cells, such as being able to grow anchorage-independently or being able to give rise to a tumor in an animal.
- antibody-like means a molecule that may be engineered such that it contains portions of antibodies but is not an antibody that would naturally occur in nature. Examples include but are not limited to CAR (chimeric antigen receptor) T cell technology and the Ylanthia ® technology.
- CAR chimeric antigen receptor
- Ylanthia ® technology uses an antibody epitope fused to a portion of a T cell so that the body's immune system is directed to attack a specific target protein or cell.
- the Ylanthia ® technology consists of an "antibody-like” library that is a collection of synthetic human fabs that are then screened for binding to peptide epitopes from target proteins. The selected Fab regions can then be engineered into a scaffold or framework so that they resemble antibodies.
- nucleotide symbols other than a, g, c, t they follow the convention set forth in WIPO Standard ST.25, Appendix 2, Table 1, wherein k represents t or g; n represents a, c, t or g; m represents a or c; r represents a or g; s represents c or g; w represents a or t and y represents c or t.
- ASANL SEQ ID NO: l
- MUCl Receptor MUCl Receptor
- MTPGTQS PFFLLLLLT VLT VVTA SEQ ID NO:3
- MTPGTQS PFFLLLLLT VLT VVTG SEQ ID NO:4
- SEQ ID NOS:2, 3 and 4 describe N-terminal MUC-1 signaling sequence for directing
- MUCl receptor and truncated isoforms to cell membrane surface Up to 3 amino acid residues may be absent at C-terminal end as indicated by variants in SEQ ID NOS:2, 3 and 4.
- MUCl receptor isoform having nat-PSMGFR at its N-terminus and including the transmembrane and cytoplasmic sequences of a full-length MUCl receptor.
- GTIN VHD VETQFNQ YKTE A AS RYNLTIS D VS VS D VPFPFS AQS G A (SEQ ID NO:6) describes Native Primary Sequence of the MUCl Growth Factor Receptor (nat-PSMGFR
- TIN VHD VETQFNQ YKTE A AS RYNLTIS D VS VS D VPFPFS AQS G A (SEQ ID NO:7) describes Native Primary Sequence of the MUCl Growth Factor Receptor (nat-PSMGFR
- PSMGFR polypeptide sequence
- GTIN VHD VETQFNQ YKTE A AS P YNLTIS D VS VS D VPFPFS AQS G A (SEQ ID NO:8) describes "SPY" functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR").
- TIN VHD VETQFNQ YKTE A AS P YNLTIS D VS VS D VPFPFS AQS G A (SEQ ID NO:9) describes "SPY" functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR"), having a single amino acid deletion at the C-terminus of SEQ ID NO:8).
- VLLS TLGIVFQGEGPPIS S CDTGTM ANCERTFIAIKPDG VQRGLVGEIIKRFE QKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVK TGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGDSVESAEKEIGLWFHPEELVDYTSC AQNWIYE (SEQ ID NO: 17) describes NM23-H1 S 120G mutant amino acid sequence (NM23- Hl: GENBANK ACCESSION AF487339).
- LALIKPDA (SEQ ID NO:88)
- MMMLS RKEALDFH VDHQS (SEQ ID NO:89)
- EILRDDAICEWKRL SEQ ID NO:91
- FREFCGP SEQ ID NO: 101
- VHCTDLPEDGLLEVQYFFKILDN SEQ ID NO: 102
- EIINKAGFTITK SEQ ID NO: 106
- NELIQFITT SEQ ID NO: 1028
- EILRDDAICEWKRL SEQ ID NO: 109
- NCTCCIVKPHAVSE SEQ ID NO: 113
- LGKILMAIRDA SEQ ID NO: 1144
- EISAMQMFNMDRVNVE (SEQ ID NO: 115)
- EYHDMVTE (SEQ ID NO: 117)
- EFCGPADPEIARHLR (SEQ ID NO: 118)
- AIFGKTKIQNAV (SEQ ID NO: 119)
- LPEDGLLEVQYFFKILDN (SEQ ID NO: 120)
- LGKILMAIRDA SEQ ID NO: 1231
- VTEMYSGP (SEQ ID NO: 125)
- NATKTFREF SEQ ID NO: 1236
- AICEWKRLLGPAN (SEQ ID NO: 128)
- AICEWKRLLGPAN (SEQ ID NO: 130)
- VDHQSRPF SEQ ID NO: 1331
- KAGEIIEIINKAGFTITK (SEQ ID NO: 133)
- VDLKDRPF SEQ ID NO: 1357
- ERTFIAIKPDGVQRGLVGEIIKRFE SEQ ID NO: 137
- VDLKDRPFFAGLVKYMHS GP V V AM VWEGLN (SEQ ID NO: 138)
- KPDGVQRGLVGEII (SEQ ID NO: 140)
- MUC1* a key growth factor receptor, MUC1*, and its activating ligand, NM23-H1 (also called NMEl) in dimer form, mediates the growth of most solid tumor cancers.
- NM23-H1 also called NMEl
- MUC1* an alternative splice variant or an enzymatically cleaved form of the transmembrane protein, MUC1 is expressed on all pluripotent human stem cells (Hikita et al, 2008) and on the majority of solid tumor cancers (Mahanta et al, 2008).
- MUC1* functions as a growth factor receptor.
- Ligand-induced dimerization of MUC1* promotes cancer cell growth, survival and can make cancer cells resistant to chemotherapy drugs (Fessler et al, 2009).
- Inhibition of ligand-induced dimerization of MUCl*'s extracellular domain greatly inhibits cancer cell growth in vitro ( Figure 1) and in vivo ( Figure 2).
- ligand-induced dimerization of MUC1* stimulates growth and survival, while inhibiting differentiation. Both stem cells and cancer cells secrete NM23-H1.
- NM23-H1 dimerizes the extra cellular domain of MUC1* to make stem cells proliferate and to inhibit their differentiation.
- NME1 in dimer form not only promotes growth and pluripotency of stem cells, but also induces human stem cells to revert to the earliest, most pluripotent state called the "naive" state (Nichols J, Smith A (2009); Hanna et al, 2010; Amit M, et al, 2000; Ludwig TE, et al 2006; Xu C, et al, 2005; Xu RH, et al, 2005; Smagghe et al 2013). To date, this is the only natural factor that has been shown to maintain human stem cells in the naive state, as they exist in the inner mass of the very early embryo.
- MUC1* an alternative splice variant or an enzymatically cleaved form of the transmembrane protein, MUC1*
- MUC1* an alternative splice variant or an enzymatically cleaved form of the transmembrane protein, MUC1*
- MUC1* functions as a growth factor receptor. Dimerization of MUC1* promotes stem and cancer cell growth; it inhibits differentiation of stem cells and causes cancer cells to revert to a less differentiated state. Both stem cells and cancer cells secrete NM23-H1 in dimeric form, and dimerizes the extra cellular domain of MUC1* to make stem cells proliferate and to inhibit their differentiation.
- NME family members that are actively expressed in stem cells are errantly up-regulated in cancer cells.
- other NME family proteins act as growth factors and transcription factors that promote stem and cancer cell growth and inhibit their differentiation.
- NMEl promotes stem cell growth and pluripotency when it is a dimer.
- NMEl dimers also mediate the growth and de-differentiation of MUC1 -positive cancer cells. As the density of stem cells increases and more and more NMEl is secreted from the stem cells, the NMEl forms hexamers, which actually induce differentiation, thus stopping pluripotent stem cell growth. It is known that cancer cells can appear to be less differentiated than normal adult cells.
- NME6 and NME7 are expressed in early stage stem cells and in cancer cells.
- Western blot analysis was performed on a wide variety of human stem cells and cancer cell lines, which showed that both stem cells and cancer cells express and secrete NMEl, NME6 and NME7.
- human embryonic stem cells (BGOlv) and human MUCl*-positive breast cancer cells (T47D) wherein the cell lysates were probed for the presence of NMEl (NM23-H1), NME6 (data not shown), or NME7.
- Figures 3A and 3B show that NMEl and NME7 were readily detected in the lysate of stem cells and cancer cells.
- NME6, ⁇ 22kDa was detected in a more sensitive assay shown in Figure 4D.
- a pull-down assay was performed on the stem cells and the cancer cells using an antibody that binds to the cytoplasmic domain of MUC1.
- the Western of Figures 3C and 3D show that both NMEl and NME7 bind to MUC1 as it exists in stem and cancer cells.
- NME7 is produced in both stem cells and cancer cells, we discovered that intra-cellularly, it exists as the full-length protein ⁇ 42kDa. However, NME7 must be cleaved before it is secreted. The secreted form appears to be devoid of its leader sequence DM10 and runs with an apparent molecular weight of ⁇ 33kDa.
- Figure 5 is a panel of photos of Western blots of human embryonic stem (ES) cells (A) and induced pluripotent stem (iPS) cells (B, C) probed for the presence of NME7.
- Western blots show the presence of three forms of NME7 in the cell lysates.
- ⁇ 42kDa full length
- ⁇ 33kDa NME7-AB domains devoid of the N-terminal DH domain
- a small ⁇ 25kDa species are secreted in the conditioned media (C).
- NME7 human NME7
- the leader sequence "DM10" was omitted from the sequence. This generated a species that was approximately the same molecular weight, 33kDa, as the secreted form of the protein.
- the protein was made as a Histidine tagged protein and first purified over an NTA-Ni column, then by FPLC with greater than 98% purity. We call this form of NME7, NME7-AB.
- NME7-AB protein that we generated may simply be the minimal portion of the natural protein that is required for its stem/cancer promotion function.
- NME7-AB functions in a way that is essentially the same as the naturally processed NME7, as is demonstrated in the experiments and examples contained herein.
- the naturally occurring cleavage site of NME7 may be different from where we started the NME7-AB N-terminus.
- Inhibitors of NME7 may act on the native protein that contains the DM10 at the N-terminus or may act to inhibit cleavage of NME7 to the secreted form.
- FIG. 6 A-C shows the FPLC trace of the NME7-AB following purification by the nickel column (A), an SDS-PAGE gel of the unpurified protein (B) and an FPLC trace of the final product (C).
- a nanoparticle assay was performed that showed that NME7 as a monomer can simultaneously bind to two PSMGFR peptides (SEQ ID NO:6) of the MUC1* extra cellular domain. Histidine- tagged PSMGFR peptides were immobilized onto NTA-SAM-coated nanoparticles.
- Recombinant NME7-AB (expressed devoid of the DM10 N-terminal leader sequence), which had been verified to be monomeric by FPLC and native gel, was added to the nanoparticles.
- NME7 caused the gold nanoparticle solution to turn from pink to blue indicating that the NME7 simultaneously bound to two peptides on two separate nanoparticles which caused the particles to be drawn close together, thus inducing the characteristic color change (Figure 7).
- Another ELISA experiment was performed that demonstrated that NME7 monomers dimerize two MUC1* extra cellular domain peptides.
- a first PSMGFR peptide was coupled to BSA and immobilized on a multi-well plate. Recombinant NME7-AB was added. After the appropriate wash steps, a second PSMGFR peptide, modified with biotin was added.
- NME7 functions approximately the same as NME1 dimers. Like NME1 dimers, NME7 fully supports human stem cell growth. A panel of human stem cells (embryonic 'ES' and induced pluripotent 'iPS') were cultured in a minimal serum- free base media with either NME1 dimers or NME7-AB added as the only growth factor or cytokine. The stem cells grew faster than growth in the traditional FGF-containing media, did not spontaneously differentiate, and were reverted to the naive state, as evidenced by having two active X chromosomes. Figure 9 and Figure 10 show photographs of human HES-3 embryonic stem cells that were cultured in either NME1 dimers or NME7-AB on Day 1 and Day 3 respectively.
- FIG 11 shows photographs of immunocytochemistry (ICC) experiments that confirm that stem cells cultured in NME7-AB for more than 10 passages stain positive for the standard pluripotency markers.
- Figure 12 shows photographs of ICC experiments that confirm that stem cells cultured in NME7-AB are in the naive state.
- the cells of panel (A) were cultured in FGF on mouse feeder cells as is standard practice.
- the staining antibody produced a red dot where it bound to condensed tri-methylated Lysine 27 on Histone 3 (H3K27me), indicating one X chromosome is inactive (XaXi) and that the stem cells have progressed to the "primed” state.
- the cells of panel (B) are the same cells as photographed in (A) except that they were cultured for 10 passages in NME7-AB.
- the H3K27me antibody produced the "cloud" staining pattern, indicating that both X chromosomes were active (XaXa), evidencing that the cells had reverted to the naive state.
- NME7 fully supports stem cell growth and pluripotency and also reverts them to the naive or ground state, being a less mature state than the later, primed state.
- NME7 was also an active growth factor driving the growth of cancer cells. If so, then cancer growth could be inhibited or prevented in a patient by a therapeutic agent that blocks the interaction of NME7 to MUC1* extra cellular domain.
- a rabbit polyclonal antibody raised against the NME7 A and B domains was added to T47D, MUCl*-positive breast cancer cells and cell growth was measured. Even at very low, nanomolar concentrations, anti-NME7 inhibited the growth of cancer cells ( Figure 13-15).
- a therapeutic agent for the treatment of cancers is an antibody that binds to the NDPK A domain of NME7.
- the therapeutic agent is an antibody that binds to the NDPK B domain of NME7. In a still more preferred embodiment, the therapeutic agent is an antibody that binds a sequence in the A or B domain of NME7 that is not present in NMEl. In a still more preferred embodiment, the therapeutic agent is an antibody that inhibits the interaction between NME7 and MUC1*. In a most preferred embodiment, the therapeutic agent is an antibody that inhibits the function of NME7 wherein said function is the promotion of cancerous growth or reversion to a cancer-like state.
- NME family proteins have one or more NDPK domains. These NDPK domains have a catalytic function that is independent of, and not required for, their function as growth factors and transcription factors. NME family proteins bind to the extra cellular domain of MUC1* via their NDPK domain.
- NME7 is the most primitive of the NME family proteins that regulate stem cell growth and in vivo is only expressed in very early embryo genesis.
- NME7 is a single ⁇ 42kDa protein that has two NDPK domains, A and B plus an N-terminal leader sequence called the DM10 domain.
- ELISA assays show that NME7 binds to and dimerizes MUC1* transmembrane receptor. Since NME7 has 2 NDPK domains, it is a pseudo dimer that is always able to dimerize the MUC1* receptor.
- NMEl is roughly half the molecular weight of NME7 ( ⁇ 17kDa) and has only one NDPK domain. NMEl acts as a growth factor that promotes growth and inhibits differentiation only when it is a dimer. At higher concentrations, NMEl can form hexamers. In contrast to the dimers, NMEl hexamers induce differentiation. Thus, NMEl, which is expressed later in embryogenesis, has the ability to turn itself off, thus limiting self-replication, while NME7 cannot. Wild type (wt) NMEl exists primarily as a hexamer at measurable concentrations.
- NMEl proteins such as S 120G that form stable dimer populations have been isolated from cancers and thus are continuously activating the MUCl* receptor.
- NMEl-wt and the S 120G mutant.
- NME1-S 120G populations of NME1-S 120G that were a mixture of dimer, tetramer and hexamer.
- Figure 16 shows these various multimers on a native gel.
- Figure 17 (A) shows gels of NME1 proteins used in an SPR experiment (B) wherein the PSMGFR peptide of the MUCl* extracellular domain is immobilized on the chip and different NME1 proteins are flowed over the surface. The results show that the dimer form of NME1 is the form that binds to the MUCl* extracellular domain.
- Panel (C) shows a nanoparticle experiment wherein the PSMGFR peptide was attached to NTA-Ni-SAM coated nanoparticles and recombinant NME1 dimers or hexamers are added to the nanoparticles. Gold nanoparticles turn blue if the interaction takes place and remain pink if it does not.
- Panel (D) shows photos of human stem cells cultured in either NME1 dimers (NM23), hexamers, or the dimers plus a free PSMGFR peptide to competitively inhibit the interaction. As can be seen in the photos, only NME1 dimers promote pluripotent stem cell growth.
- Figure 18 is a cartoon depicting the mechanism, supported by experiments described herein, by which NME7 and NME1 function to promote pluripotency wherein NME1 regulates itself.
- NME6 is also expressed in very early embryogenesis. NME6 is reportedly a dimer in some species such as sea sponge. NME6 must be expressed at high enough levels that it can form dimers before it can activate growth and inhibit differentiation. Thus, it is expressed at a later stage than NME7. NME6 also binds to the PSMGFR peptide of the MUCl* extra cellular domain. In a pull-down assay, NME6 was shown to bind to MUCl* in cancer cells and in stem cells. We made recombinant NME6 as the wild type protein, or with a single point mutation S 139G, which mimics the S 120G mutation that causes NME1 to prefer dimer formation.
- NME6 binds to the PSMGFR peptide of the MUC1* extra cellular domain.
- NME6-wt is purified as the monomer or as a high molecular weight multimer.
- the NME6 multimers are dissociated by dilution in SDS.
- the ELISA shows that as the multimers are dissociated, binding to the MUC1* peptide increases.
- the figure shows that NME6-wt and the two mutants that prefer dimer formation, bind to the MUC1* peptides.
- the gels of Figure 19 D-H show expression of NME6- wt (D), NME6 with the S 139G mutation that corresponds to the mutation S 120G which in human NMEl increases dimer formation (E), NME6 bearing three mutations that make the human form mimic the sea sponge form that is reported to be a dimer (F), and a single chain protein linking two NME6 proteins (G,H).
- Panel I shows that in a pull-down assay using an antibody against the cytoplasmic tail of MUC1, NME6 was shown to bind to MUC1 in cancer cells and in stem cells.
- an effective anti-cancer agent would be an antibody, small molecule or other agent that disrupts binding of NME6 dimers to MUC1* extra cellular domain peptide.
- the therapeutic agent for the treatment of cancers is an antibody that binds to the NDPK A domain of NME6.
- the therapeutic antibody binds to sequences of NME6 that are not present in NMEl.
- naive state stem cells Human stem cells that mimic embryonic stem cells of the inner mass of the blastocyst, which are the very earliest stage stem cells, are called “naive" state stem cells.
- researchers were unable to maintain or generate genetically unmodified naive state human stem cells in vitro.
- We recently succeeded in generating genetically unmodified human stem cells in the naive state by culturing cells in NMEl dimers or in NME7 and in the absence of other growth factors or cytokines, particularly in the absence of bFGF.
- these naive state stem cells progress to the more mature "primed" state as soon as they are exposed to bFGF.
- NME7 is expressed at very high levels in very early stage stem cells
- Embryonic stem cells in the primed state which is more differentiated than stem cells in the naive state, express only trace amounts of NME7.
- stem cells in the earlier "naive" state also called the "ground” state
- Figure 3B compare lane 1 (naive) to lane 2 (primed).
- NME7 is expressed in cancer cells to a level comparable to its expression in early stage stem cells (Figure 3B, compare lane 3 (cancer cell) to lane 1 (naive stem cell)). For this reason, NME7 and NME6 can be therapeutically disabled without significant side effects because their primary role is in early embryogenesis rather than in adult life.
- NME7 is a single molecule that has two NDPK domains and so, in one aspect, functions as NMEl dimers do.
- One of the binding partners of NME7 is MUC1*.
- MUC1* One of the binding partners of NME7.
- Our studies show that NME7 binds and dimerizes the extra cellular domain of MUCl*-positive cells to promote growth and to inhibit differentiation of both human stem cells and cancer cells.
- NME7 is also detected in cancer cells, in the conditioned media, cytoplasm and nucleus, indicating that it functions as a secreted growth factor and also as a transcription factor that directly or indirectly binds DNA.
- the Western blots of Figure 20 show that both NMEl and NME7 are present in both the cytoplasm and in the nucleus of human cancer cells (T47D), embryonic stem cells (BGOlv and HES-3) and induced pluripotent stem (iPS) cells. These data show that NMEl and NME7 can function directly or indirectly to affect transcription of genes. Therefore in one aspect of the invention, the function of NMEl or NME7 is inhibited by adding agents which can be small molecules, that inhibit the binding of NMEl or NME7 to DNA, and agents that inhibit the transcription function of NMEl or NME7 are anti-cancer agents that can be administered to a patient with cancer or at risk of developing cancer.
- agents which can be small molecules, that inhibit the binding of NMEl or NME7 to DNA and agents that inhibit the transcription function of NMEl or NME7 are anti-cancer agents that can be administered to a patient with cancer or at risk of developing cancer.
- NME proteins likely are expressed to different levels in different cancer cells. Most cancers that are MUCl*-positive and show high expression of NMEl, NME6 and NME7. DU145 prostate cancer cells had higher expression of NME7 than NMEl or NME6. PC3 prostate cancer cells, which are MUCl*-negative, had no detectable NMEl or NME7 but had high expression of NME6 ( Figure 21).
- NME7 exists in different forms
- NME7 is expressed as different species. Some of these species are specific to cancer cells. Full length NME7 is 42kDa and is comprised of two non-identical NDPK domains and a DM10 leader sequence at its N-terminus. Full length NME7 can be found in the cytoplasm. A ⁇ 33kDa NME7 species, consistent with a species comprised of the NDPK A and B domains but devoid of the DM10 leader sequence is found exclusively in the conditioned media of both stem cells and cancer cells ( Figure 5 and Figure 22). Note that these findings are independent of recombinant NMEl in dimer form added to culture the stem cells.
- NME7-AB an NME7 variant comprised of the NDPK A and B domains but without the DM10 domain, having molecular weight of ⁇ 33kDa, that we called NME7-AB.
- This recombinant NME7-AB is able to fully support pluripotent human stem cell growth in serum-free media, devoid of other growth factors or cytokines.
- NME7-AB also fully supported the growth of MUCl*-positive cancer cells.
- NME7 is the growth factor form and that it is comprised of NDPK A and B domains and devoid of most or all of the DM10 domain and has a molecular weight of ⁇ 33kDa.
- Figure 24 shows photos of Western blots of various cell lysates and corresponding conditioned media probed for the presence of NME7 using a mouse monoclonal antibody (A) or another monoclonal antibody that only recognizes the N-terminal DM10 sequence (B).
- A mouse monoclonal antibody
- B monoclonal antibody that only recognizes the N-terminal DM10 sequence
- the lack of binding of the DM10 specific antibody to the ⁇ 33kDa NME7 species in the samples from the conditioned media of the cells indicates that the secreted form of NME7 is devoid of most if not all of the N-terminal DM10 leader sequence.
- Another smaller ⁇ 25kDa NME7 species is also sometimes present.
- Western blot shows presence of lower molecular weight species ⁇ 25kDa from the outset.
- This ⁇ 25kDa NME7 is comprised of the NDPK A domain and has a single binding site for MUC1*.
- the ⁇ 25kDa band was excised and analyzed by mass spectrometry. Mass spec showed that the ⁇ 25kDa species was comprised essentially of the NDPK A domain.
- NME7 is expressed in other human tissues, albeit at low levels. However, we have discovered that it is the secreted form of NME7 that functions as a growth factor and although some adult tissues may express NME7, the critical aspect is whether or not it is secreted.
- Stem cells that express and secrete NME7 are those stem cells that are in an earlier and thus more pluripotent state than stem cells that do not secrete NME7, which are in an earlier and more pluripotent state than stem cells that do not express or secrete NME7.
- Cancer cells that express and secrete NME7 are those cancer cells that are less differentiated and more aggressive than cancer cells that do not secrete NME7.
- measuring levels of NME7 and secreted NME7 can be used to predict tumor aggressiveness, design therapies, monitor efficacy of therapies and to stratify patient populations for clinical trials. Therefore, antibodies that detect NME1, NME6 or NME7 can be used as diagnostic tools to detect the occurrence of cancer or to assess the aggressiveness of the cancer, wherein high levels of NME1, NME6 or NME7 correlate with tumor aggressiveness and poor outcome. High levels of NME7 and NME6 are especially correlated to tumor aggressiveness and therefore poor prognosis.
- Patient samples that can be probed with antibodies against NME1, NME6 or NME7 can be samples of bodily fluids, including blood, tissue biopsies, needle biopsies and the like.
- NME family member proteins can function to promote cancer
- NME family member proteins promote growth and pluripotency of embryonic and iPS cells as well as inducing cells to revert to a stem-like state. Because much of the genetic signature of a stem-like state and a cancerous state is now shared, we conclude that NME family member proteins are also able to induce a cancerous state.
- the NME family member protein is NME1 or an NME protein having greater than 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% sequence identity to NME1, wherein said protein is a dimer.
- the NME family member protein is NME7 or an NME protein having greater than 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% sequence identity to at least one of the NME7 domains A or B and able to dimerize the MUC1* growth factor receptor.
- NME1 in dimer form a bacterial NME1 in dimer form, NME7 or NME7-AB were able to: a) fully support human ES or iPS growth and pluripotency, while inhibiting differentiation; b) revert somatic cells to a more stem-like or cancer-like state; and c) transform cancer cells to the highly metastatic cancer stem cell state, also referred to as tumor initiating cells.
- Human NME1 dimer or human NME7 are able to make somatic cells revert to a less mature state, expressing stem and cancer cell markers.
- Bacterial NME from HSP 593 was tested alongside the human homologs to determine if it could mimic their function by being able to revert somatic cells to a cancer-like state.
- Human fibroblasts were cultured in a serum-free minimal base media with either HSP 593, human NME1 dimers or human NME7-AB as the only growth factor or cytokine.
- RT-PCR measurement showed that like the human NMEs, bacterial NME1 HSP 593 reverted somatic cells to an OCT4-positive stage by Day 19 ( Figure 29).
- NME7 is an earlier expressed stem cell growth factor than NMEl because the former cannot turn itself off or regulate self-replication the way NMEl does; as a dimer it activates stem cell growth but when the cells secrete more and it forms hexamers, the hexamers do not bind MUCl* and differentiation is induced.
- NMEl dimers, NME7 and bacterial NMEl dimers cause somatic cells to revert to a less mature cancer/stem-like state.
- NMEl and NME7 Another function that NMEl and NME7 have is the ability to transform cancer cells to the more metastatic cancer stem cell state, also called tumor initiating cells.
- a panel of cancer cells were cultured in a serum- free minimal base media with human NME7-AB or human NMEl dimers ('NM23' in figures) as the only growth factor or cytokine. After several days in this media, cells began to float off the surface and continued to grow in solution. The 'floaters' were collected and separately analyzed by PCR. Cells in other wells were treated with a rho kinase inhibitor ('Ri in figures').
- Quantitative PCR measurements show an increase of the cancer stem cell markers, some of which used to be thought of as stem cell markers only (Miki J et al 2007, Jeter CR et al 2011, Hong X et al 2012Faber A et al 2013, Mukherjee D et al 2013, Herreros- Villanueva M et al , 2013, Sefah K et al, 2013; Su H-T et al 2013).
- Figures 44-47 show that culture with the NME proteins reverts the cancer cells to the highly metastatic tumor initiating cells, with the 'metastasis receptor' CXCR4 up-regulated by more than 200-fold, SOX2 up- regulated by more than 200-fold, E-cadherin (CDH1), NANOG and MUCl up by 10-fold.
- cancer cells secrete NME7 and NMEl which activate MUCl and up-regulate a host of cancer and cancer stem cell genes.
- NME7 likely is able to enter these cells by a route other than MUCl* wherein it can still act as a transcription factor and affect the expression levels of these genes.
- NMEl must be a dimer to function this way, because as a hexamer it does not activate stem or cancer growth. However, many cancers mutate NMEl so that it resists the formation of the self- replication limiting hexamer. Unlike NMEl, NME7 is always active.
- 2i inhibitors which are small molecule inhibitors of GSK3-beta and MEK of the MAP kinase signaling pathway, have been reported (Silva J et al, 2008) to revert mouse primed stem cells to the naive state. We arrived whether these inhibitors could also revert human cancer cells to the cancer stem cell state. T47D breast cancer cells were cultured for 10 days in a serum-free minimal base media with the 2i inhibitors added or in the same base media with human recombinant NME7-AB added, or both NME7-AB and 2i.
- agents that disable any of these functions of NMEl dimers, human or bacterial or of NME7 - ability to promote stem cell growth, ability to bind to MUC1* peptide PSMGFR, ability to revert somatic cells to a less mature state, ability to transform cancer cells to cancer stem cell state - are potent anti-cancer agents and can be administered to patients for the treatment or prevention of cancers.
- NME inhibitors are potent anti-cancer agents
- Polyclonal anti-NME7 may not be the ideal anti-cancer agent in that it is a collection of antibodies produced by rabbits.
- NME Function 1 One way that NME proteins function to promote cancer is by binding to a clipped form of the MUCl transmembrane protein, herein referred to as MUCl*, which consists primarily of the PSMGFR sequence. Dimerization of the MUCl* extracellular domain stimulates growth and de-differentiation of stem and cancer cells.
- NME Function 2 Another way that NME proteins function to promote cancer, de- differentiation, pluripotency, growth or survival is that they can be transported to the nucleus where they function directly or indirectly to stimulate or suppress other genes. It has been previously reported (Boyer et al, 2005) that OCT4 and SOX2 bind to the promoter sites of MUCl and its cleavage enzyme MMP16. The same study reported that SOX2 and NANOG bind to the promoter site of NME7. We conclude, on the basis of our experiments that these 'Yamanaka' pluripotency factors (Takahashi and Yamanaka, 2006) up-regulate MUCl, its cleavage enzyme MMP16 and its activating ligand NME7.
- NME7 suppresses NME7, while its co-factor JMJD6 up-regulates NME1 (Thompson et al) that we determined is a self-regulating stem cell growth factor that is expressed later than NME7 in embryogenesis.
- siRNA suppression of Mbd3 or Chd4 greatly reduced resistance to iPS generation (Rais Y et al 2013 et al.)
- NME7 suppresses BRD4 and JMJD6, while also suppressing inhibitors of pluripotency Mbd3 and CHD4.
- NME7 up-regulates SOX2 (>150X), NANOG ( ⁇ 10X), OCT4 ( ⁇ 50X), KLF4 (4X) and MUCl (10X).
- NME7 up- regulates cancer stem cell markers including CXCR4 (-200X) and E-cadherin (CDH1).
- Figure 50 is a cartoon of the interaction map of NME7 and the associated regulators of the stem/cancer state as evidenced by the experiments described herein.
- NME1 in dimer form functioned approximately the same as NME7 in being able to convert somatic cells to a stem/cancer-like state and being able to transform cancer cells to metastatic cancer stem cells, albeit to a slightly lesser degree.
- bacterial NME dimers with high homology to human NME1 or NME7 such as Halomonas Sp 593 was, like NME1 dimers and NME7 monomers, able to fully support human stem cell growth, pluripotency and survival, cancer cell growth and survival, reverted somatic cells to a cancer/stem cell state and transformed cancer cells to the more metastatic cancer stem cells.
- agents that disable the function of NME proteins that support human stem cell growth, pluripotency and survival, cancer cell growth and survival, that are able to revert somatic cells to a cancer/stem cell state and that are able to transform cancer cells to the more metastatic cancer stem cells are ideal targets for anti-cancer therapies, wherein the therapeutic agent disables the NME protein, blocks its binding to MUC1*, blocks its function as a direct or indirect transcription factor or blocks its function as described above.
- the agent that blocks the function of the NME protein is an antibody.
- the agent blocks the function of NME1 dimers or dimerization.
- the agent blocks the function of NME7.
- an anti-cancer agent that blocks the function of one of these NME proteins can alternatively be a nucleic acid.
- a nucleic acid that inhibits expression of the NME such as sh- or siRNA, antisense nucleic acid and the like.
- the agent may indirectly suppress expression of the NME.
- increased expression of BRD4 would suppress NME7 and thus act as an anti-cancer agent.
- the agent that inhibits function of the targeted NME protein is a synthetic chemical such as a small molecule that either acts on the NME protein directly or inhibits its expression. Separately or in combinations, these agents are potent anticancer agents for the treatment or prevention of cancers.
- an agent that inhibits the targeted NME protein is an antibody and is an anti-cancer agent that is administered directly to a patient for the treatment or prevention of cancers.
- the primary cancer or its progeny is a MUC1* positive cancer.
- the antibody may be an antibody per se or may be an engineered antibody-like molecule.
- the antibody or antibody-like molecule can be linked to a cytotoxic entity or an entity that activates an immune response.
- portions of the anti-NME antibody can be engineered to be a part of a therapeutic molecule as described in the CAR (chimeric antigen receptor) T cell technology (Porter D et al, 2011).
- the antibody can be bivalent, monovalent, bi- specific humanized or partially humanized.
- the antibody or antibody-like molecule may be generated using in vitro binding assays, phage display techniques and the like, including those used by Tiller T et al, 2013, and for example using randomized human antibody epitope libraries such as the Ylanthia ® system as well as others.
- the agent that inhibits the targeted NME protein is an antibody that is generated by the patient, wherein the patient is immunized with portions of the targeted NME protein(s) such that the patient mounts an immune response which includes anti-NME antibodies.
- immunization is performed for the treatment or prevention of cancers, for example as a vaccine.
- the present invention involves the identification of peptide sequences derived from MUC1*, NME1 human, NME1 bacterial and NME7 that will give rise to antibodies that are anti-cancer agents.
- These peptide sequences can be used for generating therapeutic antibodies as well as for vaccines, nucleic acid sequences for anti-sense type therapies, methods for the identification of cancer-causing bacteria, diagnostic methods and drug screening methods.
- peptides of sequence described herein may be augmented with adjuvant or fused to other peptides which stimulate the immune system and then used to generate anti-cancer antibodies either in a host animal or in a human as a vaccine to immunize against cancer by inducing the patient to raise antibodies against the targeted NME protein.
- the targeted NME protein is bacterial NME having 30% or greater sequence identity to human NME1 or NME7 domain A or B.
- the targeted NME protein is human NME1, wherein the antibody may specifically target NME1 with mutations that make it prefer dimer formation such as the S 120G mutation, the P69S mutation or C-terminal truncations.
- the targeted NME protein is NME7 (SEQ ID NO: 13), including the cleaved form substantially as set forth as NME7-AB (SEQ ID NO:39) .
- a transgenic mouse expressing human NME7, human NME1 or mutants that prefer dimerization or bacterial NME would be of great use in drug discovery, for growing cancer cells in vivo and for testing the effects of immunizing NME-derived peptides as elements of an anticancer vaccine.
- murine NME proteins differ from human NME proteins.
- Mouse stem cells grow using the single growth factor LIF, while LIF cannot support the growth of human stem cells.
- LIF cannot support the growth of human stem cells.
- cancer cells and stem cells grow by similar mechanisms. Therefore, implanting human cancer cells into a mouse poses problems besides just an immune response in the mouse to human cancer cells; the mouse does not produce human NME7 or dimeric NME1 which are the growth factors that singly promote cancer growth and their transformation to cancer stem cells.
- mice injected with human NME7 develop cancers more easily than mice that are not injected. For example, some cancer cells are very difficult to engraft in animals.
- Immune-compromised mice were implanted with T47D breast cancer cells that were mixed 50/50 vol/vol with either Matrigel or NME7-AB. After 10 days, the mice that had received the NME7 mixed cells were additionally injected with NME7-AB every day ( Figure 51). The group that was additionally injected with NME7-AB (dashed line) had larger tumors that grew at an accelerated rate.
- a range of ratios of cancer cells to NME7 or the injection schedule of NME7 is expected to vary from one mouse strain to another and from one tumor type to another.
- animals that are transgenic for human NME7 or NME7-AB greatly increase engraftment rates of cancer cells and thus, decrease the number of cells required to develop into a tumor in an animal. This allows growth of primary patient cancer cells in an animal expressing human NME7 or NME7-AB.
- cancer cells are implanted into an animal and the animal is administered NME7 or NME7-AB.
- the animal is a transgenic animal that expresses human NME7-AB.
- the cancer cells are primary cells from a patient. In this way, the animal, which can be a mouse, provides the NME growth factor that causes the patient cancer cells to revert to a less mature, more metastatic state.
- the host animal is injected with candidate drugs or compounds and efficacy is assessed in order to predict the patient's response to treatment with the candidate drug or compound.
- the first line treatments or drugs that are being administered to the patient or are being considered for treatment of the patient are administered to the animal bearing the patient's cancer cells which are being reverted to a less mature state.
- the first line treatments likely influence which mutations the cancer cells adopt in order to escape the first line treatments.
- the resultant cancer cells can then be removed from the host animal and analyzed or characterized to identify mutations that are likely to occur in response to certain treatments.
- the cancer cells can remain in the host animal and the host animal is then treated with other therapeutic agents to determine which agents inhibit or kill the resistant cells or cancer stem cells.
- cancer cells including patient cells can be cultured in NME7, NMEl dimers or bacterial NME that mimics human NMEs such that the cells are transformed to the cancer stem cells that require as few as 50-200 cells to initiate a tumor in an animal. These cells would then be tested in vitro or in vivo, including in a transgenic animal bearing NME7, NMEl dimers, bacterial NMEs or single chain NMEl pseudo dimers.
- a transgenic animal expressing human NME, especially NME7-AB would also be useful for assessing which immunizing peptides could safely be used for the generation of antibodies against NME proteins, including NMEl, bacterial NME and NME7.
- mice transgenic for human NMEl, NME7, or NME7-AB could be immunized with one or more of the immunizing peptides set forth as in Figures 62-64, peptide numbers 1-53. Control group mice are analyzed to ensure that anti-NME antibodies were produced. Human tumor cells would then be implanted into the transgenic mouse, wherein expression of the human NME protein in the host animal is induced, if using an inducible promoter.
- the efficacy and potential toxicities of the immunizing peptides is then assessed by comparing the tumor engraftment, tumor growth rate and tumor initiating potential of cells transplanted into the transgenic mouse compared to the control mouse or a mouse wherein the inducible NME promoter was not turned on. Toxicities are assessed by examining organs such as heart, liver and the like, in addition to determining overall bone marrow numbers, number and type of circulating blood cells and response time to regeneration of bone marrow cells in response to treatment with agents cytotoxic to bone marrow cells.
- Immunizing peptides derived from those listed in Figures 62-64, peptide numbers 1-53 that significantly reduced tumor engraftment, tumor growth rate, or tumor initiating potential with tolerable side effects are selected as immunizing peptides for the generation of antibodies outside of the patient or in a human as an anti-cancer treatment, preventative or vaccine.
- a mouse or other mammal that would spontaneously form tumors, or respond more like a human to drugs being tested or that would better allow human tumor engraftment, is generated by using any one of the many methods for introducing human genes into an animal. Such methods are often referred to as knock-in, knock-out, CRISPR, TALENs and the like.
- the invention envisions using any method for making the mammal express human NME7 or NME7-AB.
- NME7 or NME7-AB can be inducible as one of many methods for controlling expression of transgenes are known in the art.
- the expression or timing of expression, of NME7 may be controlled by the expression of another gene which may be naturally expressed by the mammal.
- the NME7 or NME7 variant may be expressed in a certain tissue, such as the heart.
- the gene for the NME7 is then operably linked to the expression of a protein expressed in the heart such as MHC.
- the expression of NME7 is turned on when and where the MHC gene product is expressed.
- the expression of human NME6 or NME7 in a non-human mammal can be controlled by genes expressed in mammary tissues.
- human NME6 or human NME7 is expressed from the prolactin promoter, or a similar gene.
- NME proteins to target with inhibitors that will act as anti-cancer agents may depend on the type of cancer. For example, tumors that are shown to harbor bacterial NME of high sequence homology to human NME1 or NME7-A or -B domains or bacterial NMEs that are shown to mimic the function of human NME1 dimers or NME7-AB would be treated with antibodies or other agents that target the bacterial NME protein and inhibit its ability to dimerize, its ability to bind to MUC1* or its ability to promote cancer growth or transform cancer cells to cancer stem cells. Alternatively, in some cancer cells NME proteins that prefer dimerization may be errantly re-activated or mutated such that they resist formation of the hexameric form.
- Still other cancer may errantly re-activate expression of NME7 or the cleaved form NME7-AB.
- therapeutic antibodies that recognize NMEl, bacterial NMEs that mimic NMEl dimers and/or NME7-AB may be useful for the prevention or treatment of cancers.
- diagnostic assays are performed to determine which NME inhibitor is effective for a cancer or a subset of cancers.
- Antibodies that bind to NME7 and inhibit its tumorigenic potential are potent anticancer agents and can be administered to patients for the treatment or prevention of cancers.
- Antibodies that inhibit tumorigenic potential of NME7 or NME7-AB are those antibodies that inhibit the ability of NME7 to bind to its cognate binding partners, which in one case is the PSMGFR portion of the MUC1* receptor.
- NME7 can function by entering the cell, translocating to the nucleus and acting as a direct or indirect transcription factor, turning on genes that promote tumorigenesis such as CXCR4, SOX2, MUC1, E-cadherin, OCT4.
- NME7 or NME7-AB down-regulates BRD4, JMJD6, MBD3 and CHD4, all of which results in increased tumorigenic potential of a cell. Therefore antibodies for the treatment or prevention of cancer are those that when tested in vitro or in vivo inhibit NME7 binding to MUC1* or inhibit NME7 or its co-factors from binding to the nucleic acid promoter sites of CXCR4, SOX2, MUC1, E- cadherin, OCT4, BRD4, JMJD6, MBD3 or CHD4. These antibodies can be administered to a patient with cancer or at risk of developing cancer. As is well known in the art, antibodies and antibody- like molecules can be generated using the entire NMEl, NME6 or NME7 protein.
- peptides or portions of the proteins can be used. Still in other methods, peptides are injected into a host animal along with carrier molecules or adjuvant to elicit an immune response.
- Antibodies may be harvested from an animal in the standard ways, including monoclonal antibodies produced from antibody-producing cells harvested from an animal which can then be humanized.
- the invention also envisions using NMEl, NME6 or NME7 proteins, or peptides whose sequences are derived from them, in screening assays. In one such example, antibody libraries can be screened for their ability to bind to NMEl, NME6 or NME7, wherein antibodies that bind to the targeted NME protein are then used to treat or prevent cancers.
- the library need not be comprised of antibodies per se.
- Libraries of antibody epitopes or fragments can be screened for binding to portions of the NME proteins in order to identify therapeutic antibodies for the treatment of persons with cancer or at risk of developing cancers.
- One or more of the immunogenic peptides listed in Figures 62-64 are ideal for generating antibodies in a host animal or for identifying and selecting antibody epitope which can later be engineered into antibody-like molecules for administration to a patient.
- peptides whose sequences are derived from NME1, NME6 or preferably NME7 are directly administered to a human, such that the recipient generates an immune response including antibody production as a cancer vaccine.
- One or more of the peptides listed in Figures 62-64 are preferred for antibody generation or selection, whether for antibody generation in a host animal, for use as a vaccine, for bait to screen libraries of synthetic peptides or antibody epitopes such as the Ylanthia ® system, wherein said antibodies will inhibit cancers by inhibiting the function of NME7 or marking it for degradation.
- the invention is directed to peptide fragments of NME family proteins, and using these peptides to generate or select anti-cancer antibodies or antibody epitopes that bind to and inhibit NME7, selected from SEQ ID NOS:88-140, more preferably 88-133, more preferably 88-121.
- NME7 may be an ideal therapeutic target for the treatment or prevention of cancers because its primary role appears to be in very early embryogenesis and is not expressed at significant levels in adult tissues. Therefore, agents that disable NME7 are expected to prevent or greatly inhibit cancers while having minor if any adverse effects on healthy adult tissues.
- Our studies show that cancer cells and naive stem cells secrete NME7, which can function as their only required growth factor.
- the population of cancer cells that are metastatic cancer cells, also called cancer stem cells or tumor initiating cells are preferentially expanded by contacting them with NME1 dimers, bacterial NME dimers, or NME7, wherein NME7 produced the greatest number of cancer stem cells.
- the NME protein that is targeted by the therapeutic agent is NME1, human or bacterial, wherein the therapeutic agent inhibits dimerization, inhibits binding to MUC1*, or inhibits its ability to up-regulate pluripotency genes or cancer stem cell genes such as CXCR4.
- the NME protein that is targeted by the therapeutic agents is NME7, wherein the therapeutic agent inhibits expression of NME7, inhibits NME7 binding to MUC1*, inhibits cleavage of the DM10 domain or inhibits its ability to up-regulate pluripotency genes or cancer stem cell genes such as CXCR4.
- a targeted therapeutic to inhibit growth and de-differentiation of cancer cells is an agent that disables NME7 function.
- NME7 function that therapeutic agents would disable for the treatment of cancer include but are not limited to: 1) ability to bind to MUC1* extra cellular domain; 2) ability to bind to DNA; 3) ability to promote stem cell proliferation; 4) ability to inhibit differentiation; 5) ability to act as a transcription factor; and 6) ability to be secreted by the cell.
- Agents that disable NME7 functions as listed above include but are not limited to: antibodies, chemical entities, small molecules, microRNAs, anti-sense nucleic acids, inhibitory RNA, RNAi, siRNA.
- the therapeutic agent is an antibody, which can be monovalent, bivalent, bispecific, polyclonal, monoclonal or may be antibody-like in that they contain regions that mimic variable domains of antibodies.
- the therapeutic agent is a chemical entity such as a small molecule.
- Agents that cause suppression of NME7 such as RNAi or siRNA are also envisioned as anti-cancer treatments. In a preferred embodiment, these agents block the interaction of NME7 with the extra cellular domain of MUC1*.
- agents that up-regulate BRD4 are administered to a patient for the treatment or prevention of cancer, as BRD4 suppresses NME7.
- NMEl was believed to be a hexamer. Crystal structures of NMEl and NME2 as hexamers have been published (Webb PA et al, 1995; Min K et al, 2002) but provides little information about how NME dimers or NME7 may fold. However, based on the published hexameric structure of NMEl, sequence alignments among human NMEl, human NME7 and bacterial NME that can mimic human NMEl and NME7 function, specifically Halomonas Sp.
- Figure 61 is a sequence alignment between human NME1 and human NME7-A or -B domain.
- Figure 27 is a sequence alignment between human NME1 and bacterial NME from Halomonas Sp 593 and between human NME7-A or -B domain and bacterial NME from Halomonas Sp 593 ('HSP 593').
- the peptides 1 to 34 listed in Figure 62 having SEQ ID NOS:88-121) are peptides from human NME7 that were chosen because of their low homology to human NME1.
- NME7 peptides 35 to 46 (SEQ ID NOS: 122-133) ( Figure 63) were selected because they are somewhat unique sequences regarding regions of NME7 that appear to be structurally important to the integrity of the protein or for their ability to bind to MUC1* peptide. Both sets of NME7 sequences are expected to give rise to antibodies that bind to NME7, whereas the second set of NME7 peptides may function to disable NME7 or its ability to bind to MUC1* peptide. These peptides are expected to give rise to antibodies that would recognize NME7 or could also recognize human NME1 or bacterial NMEs and thus can be used for the treatment or prevention of cancers.
- the peptides 47 to 53 (SEQ ID NOS: 134-140) listed in Figure 64 are human NME1 sequences chosen for their high sequence homology to both human NME7 and bacterial HSP 593 NME, so are inferred to be important for structure or binding to MUC1*. These peptides are expected to give rise to antibodies that could recognize NME1, NME7 or bacterial NMEs and thus can be used for the treatment or prevention of cancers.
- peptides 1 to 34 should give rise to antibodies that prefer to bind to human NME7, which should have limited if any role in adult tissue, except in cancerous tissue in which case it is desired to inhibit its activity.
- the peptides 35 to 46 (SEQ ID NOS: 122-133) listed in Figure 63 are peptide sequences from NME7 wherein they appear to be important for structural integrity or binding to MUC1* based on sequence homology, the published crystal structure of the NME1 hexamer and the knowledge that C-terminal truncations prefer dimerization and do not inhibit binding to MUC1* or the function of the protein in stem and cancer growth.
- the peptides 47 to 53 (SEQ ID NOS: 134-140) listed in Figure 64 are peptide sequences from NME1 wherein they appear to be important for structural integrity or binding to MUC1* based on sequence homology, the published crystal structure of the NME1 hexamer and the knowledge that C-terminal truncations prefer dimerization and do not inhibit binding to MUC1* or the function of the protein in stem and cancer growth.
- Antibodies generated from peptides or peptide mimics containing these sequences will give rise to antibodies that can be administered to a patient for the treatment or prevention of cancers.
- Peptides or peptide mimics containing these sequences will give rise to antibodies in a host and thus constitute an anti-cancer vaccine that can be administered to a patient for the treatment or prevention of cancers.
- diagnostic assays are described that can determine whether the predominant NME in a patient's cancer, or in a patient at risk of developing a cancer, is NME1, bacterial NME or NME7 full-length or cleaved to the NME7-AB form.
- the diagnostic assay involves standard assays such as IHC, ICC, FISH, RNA-Seq and other detection or sequencing techniques, but unlike standard cancer diagnostic tests, the assays would be performed to determine whether NME1, NME7 or bacterial NME is present in amounts greater than those measured in a control group.
- anti-NME antibodies or other NME disabling agents that will specifically inhibit or disable the NME protein(s) present in the patient, or group of patients are selected and administered to the patient(s).
- diagnostic assay are employed to determine if the patient's NME protein bears a mutation that makes the protein favor dimerization and if so, agents that disable that particular mutant NME are administered to the patient for the treatment or prevention of cancer.
- Antibodies that disable the function of the targeted NME protein, or its cognate receptor MUC1* may be further screened to identify those antibodies that preferentially target cancer cells and do not target stem or progenitor cells or do so to a much lesser degree.
- MUC1 is cleaved to the MUC1* form by a variety of cleavage enzymes, wherein which enzyme cleaves MUC1 may be due to the tissue type or the timing of development of the cell or the organism. For example, MMP14 is expressed at higher levels in stem cells than it is on breast cancer cells ( Figure 52).
- MMP14 and ADAM17 also MUC1 cleavage enzymes are expressed on DU145 prostate cancer cells 3- and 5-times higher than they are in human stem cells; in T47D breast cancer cells MMP16 and ADAM17 are 2-times higher than they are in stem cells ( Figures 53 and 54).
- mice implanted with DU145 prostate cancer cells are treated with the Fab of the anti-MUCl* antibody MN-E6, tumor growth was greatly inhibited ( Figure 55), expression of MMP14 and ADAM17 was reduced (Figure 56), MUC1 cleavage was reduced and expression of microRNA-145 that signals differentiation was increased ( Figure 57 A,B)
- MUC1* may vary at its distal, N-terminus by 10 or more amino acids.
- NME1 dimers bind to the N-10 version of the PSMGFR peptide. That is to say that omitting the first 10 amino acids of the PSMGFR peptide, which corresponds to the majority of the MUC1* extracellular domain, did not affect the ability of NME1 dimers to bind to the MUC1* peptide.
- Antibodies that preferentially bind to the N-10 peptide (SEQ ID NO:86) preferentially bind to MUC1* as it exists on cancer cells.
- antibodies that preferentially bind to the C-10 peptide (SEQ ID NO:87), preferentially bind to stem cells and cell of the bone marrow rather than cancer cells ( Figures 58-60). Therefore, antibodies that target MUC1* for the treatment or prevention of cancer may be generated by immunization with the PSMGFR peptide, the N-10 peptide or the C-10 peptide.
- therapeutic antibodies or antibody- like molecules for the treatment or prevention of cancers can be identified by selecting those that bind to MUC1* as it appears on cancer cells as opposed to how it appears on stem and progenitor cells. In a preferred embodiment, the antibody prefers binding to the N-10 peptide.
- the therapeutic antibody is selected for its ability to bind to cancer cells but not stem or progenitor cells.
- antibodies were first selected for their ability to bind to the PSMGFR peptide, the N-10 peptide or the C-10 peptide by ELISA or similar direct binding assay, then confirmed to be able to bind to MUC1* positive cancer cells of many different types, wherein one antibody may bind prostate cancer cells better than breast cancer cells or vice versa, in support of the hypothesis of different cleavage sites on different tissue types. Then, hybridoma supernatants were coated onto multi-well plates and stem cells were plated over them.
- stem cells are non-adherent, wells that were coated with an antibody that bound to stem cells (or progenitor cells) caused the stem cells to adhere, while antibodies that did not cause the stem cells to adhere were selected as preferred anti-MUCl* antibodies for the treatment or prevention of cancers.
- the invention is directed to a method for classifying cancers or stratifying patients, having or suspected of having cancer, including the steps of: (i) analyzing a patient sample for the presence of stem or progenitor cell genes or gene products; and (ii) grouping patients who share similar expression or expression levels of stem or progenitor cell genes or gene products. In this way, the patients can then be treated with agents that inhibit those stem or progenitor cell genes or gene products.
- the expression levels of the stem or progenitor genes or gene products are measured to assess severity of the cancer, wherein expression of, or higher expression of, genes or gene products that are characteristic of earlier stem or progenitor states indicate more aggressive cancers and expression of, or higher expression of, genes or gene products that are characteristic of later progenitor states indicate less aggressive cancers. Such determination would then allow the physician to design a therapy commensurate with treating a patient with cancer more or less aggressive cancer.
- These methods for classifying cancers or stratifying cancers can be accomplished with a blood sample, bodily fluid, or biopsy.
- the gene or gene products whose high expression level would indicate a very aggressive cancer would include NMEl, more preferably NME6 and still more preferably NME7.
- Example 1 Components of minimal serum-free base (“MM”) (500mls)
- Example 2 Probing cancer and stem cells for the presence of NMEl, NME6 and NME7
- MUC1* we probed the expression of NME6 and NME7 in stem cells and cancer cells.
- MUC1* we identified MUC1* as the target of NME7.
- NME7 is expressed to a greater degree in stem cells cultured in NMEl dimers, which we have shown express markers indicating that they are in a more naive state than cells cultured in bFGF, means that NME7 is expressed at a higher level in naive cells, compared to its expression in primed cells.
- NME7 also functions as a growth factor with MUC1* as its target receptor
- pull-down assays a synthetic MUC1* extra cellular domain peptide (His-tagged PSMGFR sequence) was immobilized on NTA-Ni magnetic beads. These beads were incubated with the cell lysates of BGOlv human embryonic stem cells that had been cultured in NMEl dimers over a surface coated with anti-MUCl* antibodies (Lane 1), or cultured in bFGF over MEFs (Lane 2) or T47D human breast cancer cell lysates (Lane 3). Beads were rinsed and captured proteins were released by addition of imidazole.
- NME7 binds to the MUC1* extra cellular domain peptide. This means that in stem cells and cancer cells, NME7 via its portions of its two NDPK domains, activates pluripotency pathways by dimerizing the MUC1* extra cellular domain.
- NME7-AB expressed very well in E. coli and existed as the soluble protein.
- a construct in which a single NDPK domain was expressed, NME-A did not express in E. coli .
- NME7-AB was first purified over an NTA-Ni column and then further purified by size exclusion chromatography (FPLC) over a Sephadex 200 column. The purified NME7-AB protein was then tested for its ability to promote pluripotency and inhibit differentiation of stem cells.
- FPLC size exclusion chromatography
- NME7-AB A soluble variant of NME7, NME7-AB, was generated and purified.
- Human stem cells iPS cat# SClOla-1, System Biosciences
- SClOla-1 Human stem cells
- These source stem cells were then plated into 6-well cell culture plates (VitaTM, Thermo Fisher) that had been coated with 12.5 ug/well of a monoclonal anti-MUCl* antibody, MN-C3. Cells were plated at a density of 300,000 cells per well.
- the base media was Minimal Stem Cell Media consisting of: 400 ml DME/F 12/GlutaM AX I (Invitrogen# 10565-018), 100 ml Knockout Serum Replacement (KO-SR, Invitrogen# 10828-028), 5 ml lOOx MEM Non-essential Amino Acid Solution (Invitrogen# 11140-050) and 0.9 ml (0.1 mM) ⁇ -mercaptoethanol (55mM stock, Invitrogen# 21985-023).
- the base media can be any media. In a preferred embodiment, the base media is free of other growth factors and cytokines.
- NME7-AB 8nM of NME7-AB or 8nM NM23-H1 refolded and purified as stable dimers.
- Media was changed every 48 hours and due to accelerated growth had to be harvested and passaged at Day 3 post-plating.
- Figures 9 and 10 document the day by day comparison of growth in NM23-H1 dimers to growth in NME7 monomers.
- NME7 and NM23-H1 (NME1) dimers both grew pluripotently and had no differentiation even when 100% confluent. As can be seen in the photos, NME7 cells grew faster than the cells grown in NM23-H1 dimers.
- NME6 and NME7 as well as novel variants may be expressed with any affinity tag but were expressed with the following tags:
- Example 6 Human NME7-1 sequence optimized for E. coli expression
- NME7 wt-cDNA codon optimized for expression in E. coli was generated per our request by Genscript (NJ).
- NME7-1 was amplified by polymerase chain reaction (PCR) using the following primers:
- Example 7 Human NME7-2 sequence optimized for E. coli expression
- NME7-2 was amplified by polymerase chain reaction (PCR) using the following primers:
- Example 8 Human NME7-A sequence optimized for E. coli expression
- NME7-A was amplified by polymerase chain reaction (PCR) using the following primers:
- Example 9 Human NME7-AB sequence optimized for E. coli expression
- NME7-AB was amplified by polymerase chain reaction (PCR) using the following primers:
- NME7-AB was amplified by polymerase chain reaction (PCR) using the following primers:
- the fragment was then purified, digested (Ndel, Agel) and cloned between Ndel and Agel restriction sites of the expression vector pET21b where Xhol was replaced by Agel followed by the Strep Tag II and two stop codon before the His Tag .
- the protein is expressed with a C-Term Strep Tag II.
- Example 10 Human NME6 sequence optimized for E. coli expression:
- NME6 was amplified by polymerase chain reaction (PCR) using the following primers:
- the fragment was then purified, digested (Ndel, Xhol) and cloned between Ndel and Xhol restriction sites of the expression vector pET21b.
- the protein is expressed with a C-Term His Tag.
- NME6 was amplified by polymerase chain reaction (PCR) using the following primers:
- the fragment was then purified, digested (Ndel, Agel) and cloned between Ndel and Agel restriction sites of the expression vector pET21b where Xhol was replaced by Agel followed by the Strep Tag II and two stop codon before the His Tag .
- the protein is expressed with a C-Term Strep Tag II.
- LB broth (Luria-Bertani broth) is inoculated with 1/10 of an overnight culture and cultured at 37°C until OD600 reached -0.5. At this point, recombinant protein expression is induced with 0.4mM Isopropyl-P-D-thio-galactoside (IPTG, Gold Biotechnology) and culture is stopped after 5h. After harvesting the cells by centrifugation (6000 rpm for 10 min at 4°C), cell pellet is resuspended with running buffer: PBS pH7.4, 360 mM NaCl and 80 mM imidazole.
- running buffer PBS pH7.4, 360 mM NaCl and 80 mM imidazole.
- lysozyme (1 mg/mL, Sigma), MgCl 2 (0.5mM) and DNAse (0.5 ug/mL, Sigma) is added.
- Cell suspension is incubated on a rotating platform (275 rpm) for 30 min at 37°C and sonicated on ice for 5 min.
- Insoluble cell debris are removed by centrifugation (20000 rpm for 30 min at 4°c).
- the cleared lysate is then applied to a Ni-NTA column (Qiagen) equilibrated with the running buffer.
- NME7-AB is further purified by size exclusion chromatography (Superdex 200) "FPLC".
- LB broth (Luria-Bertani broth) is inoculated with 1/10 of an overnight culture and cultured at 37°C until OD600 reached -0.5. At this point, recombinant protein expression is induced with 0.4mM Isopropyl-P-D-thio-galactoside (IPTG, Gold Biotechnology) and culture is stopped after 5h. After harvesting the cells by centrifugation (6000 rpm for 10 min at 4°C), cell pellet is resuspended with running buffer: PBS pH7.4, 360 mM NaCl and 80 mM imidazole.
- running buffer PBS pH7.4, 360 mM NaCl and 80 mM imidazole.
- lysozyme (1 mg/mL, Sigma), MgCl 2 (0.5mM) and DNAse (0.5 ug/mL, Sigma) is added.
- Cell suspension is incubated on a rotating platform (275 rpm) for 30 min at 37°C and sonicated on ice for 5 min.
- Insoluble cell debris are removed by centrifugation (20000 rpm for 30 min at 4°c).
- the cleared lysate is then applied to a Ni-NTA column (Qiagen) equilibrated with the running buffer. The column is washed (8CV) before eluting the protein off the column with the running buffer (6CV) supplemented with 420 mM imidazole.
- NME6 is further purified by size exclusion chromatography (Superdex 200) "FPLC".
- Example 13 Quantitative PCR analysis of Naive and Primed genes.
- Example 14 - A MUCl pull down assay shows that NME1, NME6 and NME7 bind to a MUCl species protein.
- a pull down assay using an antibody to the MUCl* cytoplasmic tail (Ab-5) was performed on a panel of cells.
- the proteins pulled down by the MUCl antibody were separated by SDS-PAGE then probed with antibodies specific for NME1, NME6 and NME7, using Western blot technique.
- MUCl*-positive breast cancer cell line T47D cells ATCC
- human embryonic stem cell line BGOlv BGOlv
- human ES cells HES-3, BioTime Inc.
- human iPS cells SCIOIA-I, System Biosciences Inc.
- All stem cells were cultured in minimal stem cell media "MM" with 8nM NM23-RS (recombinant NME1 S 120G dimers).
- Stem cells were grown on plasticware coated with 12.5 ug/mL anti-MUC 1* C3 mab. Cells were lysed with 200uL RIPA buffer for 10 min on ice. After removal of cell debris by centrifugation, the supernatant was used in a co-immunoprecipitation assay.
- MUCl* was pulled down using the Ab-5 antibody (anti-MUC- 1 Ab-5, Thermo Scientific), which recognizes the MUCl cytoplasmic tail, coupled to Dynabeads protein G (Life Technologies).
- the beads were washed twice with RIPA buffer and resuspended in reducing buffer. A sample of the supernatant was subjected to a reducing SDS-PAGE followed by transfer of the protein to a PVDF membrane. The membrane was then probed with: A) an anti-NM23-Hl (NME1) Antibody (C- 20, Santa Cruz Biotechnology); B) anti-NME6 (Abnova); or C) anti NM23-H7 Antibody (B-9, Santa Cruz Biotechnology); D) the staining of NME6 was enhanced using Supersignal (Pierce); and E) the staining of NME7 was enhanced using Supersignal. After incubation with their respective secondary antibody coupled to HRP, the proteins were detected by chemiluminescence.
- NME1 anti-NM23-Hl
- B anti-NME6
- B-9 Santa Cruz Biotechnology
- D) the staining of NME6 was enhanced using Supersignal (Pierce)
- Gold nanoparticles of a diameter of 30.0 nm were coated with an NTA-SAM surface according to Thompson et al. (ACS Appl. Mater. Interfaces, 2011 , 3 (8), pp 2979-2987).
- the NTA-SAM coated gold nanoparticles were then activated with an equal volume of 180 uM NiSC>4, incubated for 10 min at room temperaiure, washed, and resuspended in a l Om phosphate buffer (pH 7.4), The gold nanoparticles were then loaded with PSMGFR N-10 peptide (QFNQY TEAASRYNLTISDVSVSDVPFPFSAQSGAHBHBHe (SEQ ID NO: 155)) at 0.5 uM final concentration, and incubated at room temperature for 10 min. Recombinant NME7-AB protein expressed and purified from E. coll was added free in solution at the concentrations indicated.
- Figure 7 shows NTA-Ni-SAM coated nanoparticles loaded with the PSMGFR N- 10 peptide.
- the NME7-AB is added free in solution at the concentrations indicated.
- Solution color change from pink to purple/blue from particle aggregation indicates binding between the MUC1 * peptide on the particles and NME7 free in solution.
- the Fab of the anti-MUCI * antibody fully inhibits the binding, showing that particle aggregation is due to the specific interaction of MUC1* peptide and NME7.
- B shows NME7-AB added free in solution over a wider range of concentrations.
- NME7-AB turned purple almost immediately
- NM23-RS HI clirner
- T47D breast cancer cell line Lysate which contains native NMF.7 turns noticeably purple also.
- Example 16 - Human ES and iPS cells cultured in NME1 dimers or NME7 are in the naive state as evidenced by lack of condensed Histone-3 in the nucleus which would have indicated X-inactivation, a hallmark of the primed state.
- Human ES (HES-3 stem cells, BioTime Inc) and iPS (SCIOIA-Ipsc, System Biosciences) cells were cultured in Minimal Media (“MM”) plus either NME1 dimers (NM23- RS) or NME7 (NME7-AB construct) for 8-10 passages.
- MM Minimal Media
- the cells were plated onto a VitaTM plate (ThermoFisher) that had been coated with 12.5 ug/mL of an anti-MUCl* monoclonal antibody (MN-C3) that binds to the distal portion of the PSMGFR sequence of the MUC1* receptor.
- MN-C3 an anti-MUCl* monoclonal antibody
- samples of the stem cells were assayed by immunocytochemistry (ICC) and analyzed on a confocal microscope (Zeiss LSM 510 confocal microscope) to determine the cellular localization of Histone-3.
- Histone-3 is condensed in the nucleus (appears as single dot), then a copy of the X chromosome has been inactivated and the cells are no longer in the pure ground state or naive state. If the stem cells have reverted from the primed state (all commercially available stem cells have been driven to the primed state by culturing in FGF) to the naive state, then Histone-3 will be seen as a "cloud,” speckled throughout or not detectable.
- Figure 12 shows the control cells, from the same source except that they have been grown in FGF on MEFs according to standard protocols, all show Histone-3 (H3K27me3) condensed in the nucleus, confirming that they are all 100% in the primed state and not in the naive state.
- Histone-3 H3K27me3
- the same source cells that were cultured in NME7 for 10 passages had mostly stem cells that do not have condensed Histone-3, indicating that they are pre-X-inactivation and in the true naive state.
- the insert shown in Figure 12 is one of many clones isolated that were 100% naive.
- NME7 exist as -40 kDa species as well as a lower molecular weight NME7 species of -25-33 kDa, which may be an alternative splice isoform or a post translational modification such as cleavage.
- HRP horseradish peroxidase
- iPS Conditioned media (20 uL) was separated by electrophoresis on either a 12% SDS-PAGE reducing gel and transferred to a PVDF membrane (GE Healthcare). The blot was blocked with PBS-T containing 3% milk and then incubated with primary antibody (anti NM23- H7 clone B-9, Santa Cruz Biotechnology) at 4°C overnight. After washing with PBS-T, the membrane was incubated with horseradish peroxidase (HRP)-conjugated secondary antibody (goat anti mouse, Pierce) for 1 hr at room temperature. Signals were detected with Immun-Star Chemiluminescence kit (Bio-Rad).
- HRP horseradish peroxidase
- a pull down assay was performed using an NME7 specific antibody (NM23 H7 B9, Santa Cruz) on a panel of MUCl*-positive cells.
- Breast cancer cells (T47D) as well as human ES (BGOlv and HES-3) and iPS (SC101-A1) cells were cultured according to standard protocol (T47D) or cultured in NME-based media over a surface of anti-MUCl* antibody.
- Cells were lysed with RIPA buffer (Pierce), supplemented with protease inhibitor (Pierce).
- Cell lysates were supplemented with lOug of recombinant NME7-AB incubated at 4°C for 2h.
- NME7 was immuno-precipitated at 4°C overnight with anti NM23-H7 (B-9, Santa Cruz Biotechnology) coupled to Dynabeads protein G (Life technologies). Beads were washed twice with PBS and immuno-precipitated proteins were separated by electrophoresis on a 12% SDS-PAGE reducing gel. Proteins were detected by silver staining (Pierce). The -23 kDa bands of proteins that co- immunoprecipitated along with NME7, from the T47D sample and the BGOlv cells, were excised and analyzed by mass spec (Taplin Mass Spectrometry Facility, Harvard Medical School). Mass spec analysis showed that the protein bands that were excised all contained sequences from the NME7 NDPK A domain as shown below. The underlined sequences in the A domain of NME7 were identified by mass spec.
- the higher molecular weight protein bands, -30 kDa, that immunoprecipitated with NME7 were not analyzed by mass spec and may correspond to either an endogenous NME7 protein that may be a cleavage product or an alternative splice isoform or alternatively could be NME7-AB -33 kDa that was added to the cell lysates.
- Example 20 - ELISA assay showing NME7-AB simultaneously binds to two MUC1* extra cellular domain peptides
- PSMGFR-Cys The PSMGFR peptide bearing a C-terminal Cysteine (PSMGFR-Cys) was covalently coupled to BSA using Imject Maleimide activated BSA kit (Thermo Fisher). PSMGFR-Cys coupled BSA was diluted to lOug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50uL was added to each well of a 96 well plate. After overnight incubation at 4°C, the plate was wash twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well.
- ELISA MUC1* dimerization The protocol for NME7 binding was used and NME7 was used at 11.6ug/mL.
- WT NME6 cDNA codon optimized for expression in E. coli was synthesized by our request by Genscript, NJ.
- the WT NME6 cDNA was then amplified by polymerase chain reaction (PCR) using the following primer: 5'-atcgacatatgacgcaaaatctgggctcggaaatg-3' (SEQ ID NO: 157) and 5'-actgcctcgagtgccggacccagaccacccgtgc-3' (SEQ ID NO: 158).
- PCR polymerase chain reaction
- LB broth Lia-Bertani broth
- OD600 OD600
- recombinant protein expression was induced with 0.4mM Isopropyl-P-D-thio-galactoside (IPTG, Gold Biotechnology) and culture was stopped after 5h.
- cell pellet was resupended with running buffer: PBS pH7.4, 360 mM NaCl, 10 mM imidazole and 8M urea.
- MUC1* ligand, NM23-H1 is a novel growth factor that maintains human stem cells in a more naive state.
- Rho-associated kinases in tumorigenesis re-considering ROCK inhibition for cancer therapy.
- MUC1* is a determinant of trastuzumab (Herceptin) resistance in breast cancer cells, Breast Cancer Res Treat 118: 113-124 DOI 10.1007/sl0549-009-0412-3
- PMCID PMC3555200 Herreros-Villanueva M, Zhang J-S, Koenig A, Abel EV, Smyrk TC, Bamlet WR, de Narvajas AA-M, Gomez TS, Simeone DM, Bujanda L, Billadeau DD. SOX2 promotes dedifferentiation and imparts stem cell-like features to pancreatic cancer cells. Oncogenesis. 2013;2:e61. PMCID: PMC3759123
- PMCID PMC3140601 Herreros-Villanueva M, Zhang J-S, Koenig A, Abel EV, Smyrk TC, Bamlet WR, de Narvajas AA-M, Gomez TS, Simeone DM, Bujanda L, Billadeau DD. SOX2 promotes dedifferentiation and imparts stem cell-like features to pancreatic cancer cells. Oncogenesis. 2013;2:e61. PMCID: PMC3759123
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Animal Behavior & Ethology (AREA)
- Urology & Nephrology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Pharmacology & Pharmacy (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Environmental Sciences (AREA)
- Mycology (AREA)
Priority Applications (29)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201480022551.6A CN105229027A (zh) | 2013-02-20 | 2014-02-20 | Nme抑制剂以及应用nme抑制剂的方法 |
| IL307628A IL307628A (en) | 2013-02-20 | 2014-02-20 | Nme inhibitors and methods of using nme inhibitors |
| KR1020217019794A KR20210082547A (ko) | 2013-02-20 | 2014-02-20 | Nme 저해제 및 nme 저해제의 사용 방법 |
| CA2901893A CA2901893C (en) | 2013-02-20 | 2014-02-20 | Nme inhibitors and methods of using nme inhibitors |
| IL240695A IL240695B2 (en) | 2013-02-20 | 2014-02-20 | Nme inhibitors and methods of using nme inhibitors |
| AU2014218872A AU2014218872A1 (en) | 2013-02-20 | 2014-02-20 | NME inhibitors and methods of using NME inhibitors |
| JP2015558975A JP6577872B2 (ja) | 2013-02-20 | 2014-02-20 | Nme阻害剤、及びnme阻害剤を使用する方法 |
| KR1020157026033A KR20150121131A (ko) | 2013-02-20 | 2014-02-20 | Nme 저해제 및 nme 저해제의 사용 방법 |
| EP14753856.5A EP2958940A4 (en) | 2013-02-20 | 2014-02-20 | NME INHIBITORS AND METHOD OF USE OF THE NME HEMMER |
| CA2921187A CA2921187A1 (en) | 2013-08-12 | 2014-08-12 | Method for enhancing tumor growth |
| JP2016534802A JP6640086B2 (ja) | 2013-08-12 | 2014-08-12 | 腫瘍成長を増強する方法 |
| EP23160947.0A EP4233536B1 (en) | 2013-08-12 | 2014-08-12 | TUMOR GROWTH STIMULATION METHOD |
| CN201480055352.5A CN105764334B (zh) | 2013-08-12 | 2014-08-12 | 加强肿瘤生长的方法 |
| AU2014306778A AU2014306778B2 (en) | 2013-08-12 | 2014-08-12 | Method for enhancing tumor growth |
| EP14835875.7A EP3038462B1 (en) | 2013-08-12 | 2014-08-12 | Method for enhancing tumor growth |
| TW103127591A TWI659210B (zh) | 2013-08-12 | 2014-08-12 | 加強腫瘤生長的方法 |
| PCT/US2014/050773 WO2015023694A2 (en) | 2013-08-12 | 2014-08-12 | Method for enhancing tumor growth |
| US14/468,106 US20150089677A1 (en) | 2013-02-20 | 2014-08-25 | Method for enhancing tumor growth |
| TW103136428A TW201529596A (zh) | 2013-10-22 | 2014-10-22 | 微生物之nme |
| US14/831,825 US20160326263A1 (en) | 2013-02-20 | 2015-08-20 | NME Inhibitors and Methods of Using NME Inhibitors |
| IL244093A IL244093B (en) | 2013-08-12 | 2016-02-11 | Method for enhancing tumor growth |
| US15/910,894 US20180258186A1 (en) | 2013-02-20 | 2018-03-02 | NME Inhibitors and Methods of Using NME Inhibitors |
| AU2019202199A AU2019202199B2 (en) | 2013-02-20 | 2019-03-29 | NME inhibitors and methods of using NME inhibitors |
| JP2019152467A JP6902577B2 (ja) | 2013-08-12 | 2019-08-23 | 腫瘍成長を増強する方法 |
| AU2021200429A AU2021200429C1 (en) | 2013-08-12 | 2021-01-22 | Method for enhancing tumor growth |
| US17/306,477 US20220089779A1 (en) | 2013-02-20 | 2021-05-03 | Nme inhibitors and methods of using nme inhibitors |
| US17/449,932 US20220193270A1 (en) | 2013-02-20 | 2021-10-04 | Method for enhancing tumor growth |
| US17/548,312 US20220218846A1 (en) | 2013-02-20 | 2021-12-10 | Nme inhibitors and methods of using nme inhibitors |
| US18/439,331 US20240277803A1 (en) | 2013-02-20 | 2024-02-12 | Nme inhibitors and methods of using nme inhibitors |
Applications Claiming Priority (26)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361767206P | 2013-02-20 | 2013-02-20 | |
| US61/767,206 | 2013-02-20 | ||
| US201361768992P | 2013-02-25 | 2013-02-25 | |
| US61/768,992 | 2013-02-25 | ||
| US201361774558P | 2013-03-07 | 2013-03-07 | |
| US61/774,558 | 2013-03-07 | ||
| US201361837560P | 2013-06-20 | 2013-06-20 | |
| US61/837,560 | 2013-06-20 | ||
| PCT/US2013/050563 WO2014012115A2 (en) | 2012-07-13 | 2013-07-15 | Method for inducing cells to less mature state |
| USPCT/US2013/050563 | 2013-07-15 | ||
| PCT/US2013/051899 WO2014018679A2 (en) | 2012-07-24 | 2013-07-24 | Nme variant species expression and suppression |
| USPCT/US2013/051899 | 2013-07-24 | ||
| US201361865092P | 2013-08-12 | 2013-08-12 | |
| US61/865,092 | 2013-08-12 | ||
| USPCT/US2013/055015 | 2013-08-14 | ||
| PCT/US2013/055015 WO2014028668A2 (en) | 2012-08-14 | 2013-08-14 | Stem cell enhancing therapeutics |
| US201361894365P | 2013-10-22 | 2013-10-22 | |
| US61/894,365 | 2013-10-22 | ||
| US201361901343P | 2013-11-07 | 2013-11-07 | |
| US61/901,343 | 2013-11-07 | ||
| US201461925190P | 2014-01-08 | 2014-01-08 | |
| US61/925,190 | 2014-01-08 | ||
| US201461925601P | 2014-01-09 | 2014-01-09 | |
| US61/925,601 | 2014-01-09 | ||
| US201461938051P | 2014-02-10 | 2014-02-10 | |
| US61/938,051 | 2014-02-10 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/050563 Continuation-In-Part WO2014012115A2 (en) | 2012-07-13 | 2013-07-15 | Method for inducing cells to less mature state |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/050773 Continuation-In-Part WO2015023694A2 (en) | 2013-02-20 | 2014-08-12 | Method for enhancing tumor growth |
| US14/468,106 Continuation-In-Part US20150089677A1 (en) | 2013-02-20 | 2014-08-25 | Method for enhancing tumor growth |
| US14/831,825 Continuation US20160326263A1 (en) | 2013-02-20 | 2015-08-20 | NME Inhibitors and Methods of Using NME Inhibitors |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014130741A2 true WO2014130741A2 (en) | 2014-08-28 |
| WO2014130741A3 WO2014130741A3 (en) | 2014-10-23 |
Family
ID=51391971
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/017515 Ceased WO2014130741A2 (en) | 2013-02-20 | 2014-02-20 | Nme inhibitors and methods of using nme inhibitors |
Country Status (9)
| Country | Link |
|---|---|
| US (5) | US20150089677A1 (enExample) |
| EP (1) | EP2958940A4 (enExample) |
| JP (2) | JP6577872B2 (enExample) |
| KR (2) | KR20150121131A (enExample) |
| CN (1) | CN105229027A (enExample) |
| AU (2) | AU2014218872A1 (enExample) |
| CA (1) | CA2901893C (enExample) |
| IL (2) | IL307628A (enExample) |
| WO (1) | WO2014130741A2 (enExample) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160142372A (ko) * | 2014-04-07 | 2016-12-12 | 미네르바 바이오테크놀로지 코포레이션 | 항-nme 항체 |
| CN107660213A (zh) * | 2015-02-10 | 2018-02-02 | 米纳瓦生物技术公司 | 人源化抗muc1*抗体 |
| JP2019515643A (ja) * | 2015-09-23 | 2019-06-13 | ミネルバ バイオテクノロジーズ コーポレーション | 幹細胞分化剤のスクリーニング方法 |
| AU2021200429B2 (en) * | 2013-08-12 | 2023-05-11 | Minerva Biotechnologies Corporation | Method for enhancing tumor growth |
| US12037413B2 (en) | 2019-02-04 | 2024-07-16 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| US12049514B2 (en) | 2020-06-08 | 2024-07-30 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| EP4172215A4 (en) * | 2020-06-26 | 2024-11-20 | Minerva Biotechnologies Corporation | ANTI-NME ANTIBODIES AND METHOD OF TREATING CANCER OR CANCER METASTASES |
| US12491259B2 (en) | 2022-04-12 | 2025-12-09 | Minerva Biotechnologies Corporation | Anti-variable MUC1* antibodies and uses thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180235193A1 (en) * | 2015-07-01 | 2018-08-23 | Minerva Biotechnologies Corporation | Method of stem cell-based organ and tissue generation |
| WO2023215235A2 (en) * | 2022-05-03 | 2023-11-09 | The Regents Of The University Of California | Peptide inhibitors for chromodomain helicase dna binding protein 4 (chd4) |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998044088A2 (en) * | 1997-04-03 | 1998-10-08 | Joslin Diabetes Center, Inc. | Modulating the rad-nm23 interaction |
| EP2329822A1 (en) * | 2001-09-05 | 2011-06-08 | Minerva Biotechnologies Corporation | Compositions and methods of treatment of cancer |
| US20090075926A1 (en) * | 2006-12-06 | 2009-03-19 | Bamdad Cynthia C | Method for identifying and manipulating cells |
| US20090092603A1 (en) * | 2007-09-25 | 2009-04-09 | Bamdad Cynthia C | Early diagnosis and treatment of drug resistance in muc1-positive cancer |
| US20090148535A1 (en) * | 2007-12-06 | 2009-06-11 | Minerva Biotechnologies Corporation | Method for treating cancer using interference rna |
| CN102272290B (zh) * | 2008-10-09 | 2018-08-14 | 米纳瓦生物技术公司 | 用于在细胞中诱导多能性的方法 |
| MX2011013385A (es) * | 2009-06-11 | 2012-05-29 | Minerva Biotechnologies Corp | Metodos para cultivar celulas madre y celulas progenitoras. |
| EP3228629A1 (en) * | 2010-06-16 | 2017-10-11 | Minerva Biotechnologies Corporation | Reprogramming cancer cells |
| WO2012154759A2 (en) * | 2011-05-09 | 2012-11-15 | Minerva Biotechnologies Corporation | Genetically engineered growth factor variants |
-
2014
- 2014-02-20 CA CA2901893A patent/CA2901893C/en active Active
- 2014-02-20 IL IL307628A patent/IL307628A/en unknown
- 2014-02-20 JP JP2015558975A patent/JP6577872B2/ja active Active
- 2014-02-20 KR KR1020157026033A patent/KR20150121131A/ko not_active Ceased
- 2014-02-20 EP EP14753856.5A patent/EP2958940A4/en active Pending
- 2014-02-20 WO PCT/US2014/017515 patent/WO2014130741A2/en not_active Ceased
- 2014-02-20 AU AU2014218872A patent/AU2014218872A1/en not_active Abandoned
- 2014-02-20 CN CN201480022551.6A patent/CN105229027A/zh active Pending
- 2014-02-20 KR KR1020217019794A patent/KR20210082547A/ko not_active Ceased
- 2014-02-20 IL IL240695A patent/IL240695B2/en unknown
- 2014-08-25 US US14/468,106 patent/US20150089677A1/en not_active Abandoned
-
2019
- 2019-03-29 AU AU2019202199A patent/AU2019202199B2/en active Active
- 2019-06-12 JP JP2019109262A patent/JP6862497B2/ja active Active
-
2021
- 2021-05-03 US US17/306,477 patent/US20220089779A1/en not_active Abandoned
- 2021-10-04 US US17/449,932 patent/US20220193270A1/en active Pending
- 2021-12-10 US US17/548,312 patent/US20220218846A1/en not_active Abandoned
-
2024
- 2024-02-12 US US18/439,331 patent/US20240277803A1/en not_active Abandoned
Non-Patent Citations (6)
| Title |
|---|
| HIKITA, S. T. ET AL.: "MUC1* mediates the growth of human pluripotent stem cells", PLOS ONE, vol. 3, no. 10, 2008, pages e3312, XP002560322, doi:10.1371/journal.pone.0003312 |
| LOMBARDI, D. ET AL.: "The association of the Nm23-Ml protein and beta-tubulin correlates with cell differentiation", EXP CELL RES, vol. 217, no. 2, 1995, pages 267 - 71 |
| MAHANTA, S. ET AL.: "A minimal fragment of MUC1 mediates growth of cancer cells", PLOS ONE, vol. 3, no. 4, 2008, pages e2054, XP002560321, doi:10.1371/journal.pone.0002054 |
| OKABE-KADO, J. ET AL.: "Characterization of a differentiation-inhibitory activity from nondifferentiating mouse myeloid leukemia cells", CANCER RES, vol. 45, no. 10, 1985, pages 4848 - 52 |
| OKABE-KADO, J. ET AL.: "Identity of a differentiation inhibiting factor for mouse myeloid leukemia cells with NM23/nucleoside diphosphate kinase", BIOCHEM BIOPHVS RES COMMUN, vol. 182, no. 3, 1992, pages 987 - 94, XP024838216, doi:10.1016/0006-291X(92)91829-F |
| SMAGGHE, B. J. ET AL.: "MUC1* ligand, NM23-H1, is a novel growth factor that maintains human stem cells in a more naive state", PLOS ONE, vol. 8, no. 3, 2013, pages e58601, XP055058843, doi:10.1371/journal.pone.0058601 |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2021200429B2 (en) * | 2013-08-12 | 2023-05-11 | Minerva Biotechnologies Corporation | Method for enhancing tumor growth |
| AU2021200429C1 (en) * | 2013-08-12 | 2023-11-30 | Minerva Biotechnologies Corporation | Method for enhancing tumor growth |
| US11702483B2 (en) | 2014-04-07 | 2023-07-18 | Minerva Biotechnologies Corporation | Method of treating an NME7 expressing cancer with a peptide |
| KR20160142372A (ko) * | 2014-04-07 | 2016-12-12 | 미네르바 바이오테크놀로지 코포레이션 | 항-nme 항체 |
| JP2020073562A (ja) * | 2014-04-07 | 2020-05-14 | ミネルバ バイオテクノロジーズ コーポレーション | 抗nme抗体 |
| KR102294483B1 (ko) * | 2014-04-07 | 2021-08-27 | 미네르바 바이오테크놀로지 코포레이션 | 항-nme 항체 |
| TWI746420B (zh) * | 2014-04-07 | 2021-11-21 | 美商密內瓦生物技術公司 | 抗nme抗體 |
| JP2022095648A (ja) * | 2014-04-07 | 2022-06-28 | ミネルバ バイオテクノロジーズ コーポレーション | 抗nme抗体 |
| US12479928B2 (en) | 2014-04-07 | 2025-11-25 | Minerva Biotechnologies Corporation | Anti-cancer peptide |
| JP2018203765A (ja) * | 2014-04-07 | 2018-12-27 | ミネルバ バイオテクノロジーズ コーポレーション | 抗nme抗体 |
| US11746159B2 (en) | 2015-02-10 | 2023-09-05 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| CN107660213A (zh) * | 2015-02-10 | 2018-02-02 | 米纳瓦生物技术公司 | 人源化抗muc1*抗体 |
| US11897967B2 (en) | 2015-02-10 | 2024-02-13 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| US12006371B2 (en) | 2015-02-10 | 2024-06-11 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| CN107660213B (zh) * | 2015-02-10 | 2023-01-13 | 米纳瓦生物技术公司 | 人源化抗MUCl*抗体 |
| JP2019515643A (ja) * | 2015-09-23 | 2019-06-13 | ミネルバ バイオテクノロジーズ コーポレーション | 幹細胞分化剤のスクリーニング方法 |
| US11931347B2 (en) | 2015-09-23 | 2024-03-19 | Minerva Biotechnologies Corporation | Method of screening for agents for differentiating stem cells |
| US12037413B2 (en) | 2019-02-04 | 2024-07-16 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| US12049514B2 (en) | 2020-06-08 | 2024-07-30 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| EP4172215A4 (en) * | 2020-06-26 | 2024-11-20 | Minerva Biotechnologies Corporation | ANTI-NME ANTIBODIES AND METHOD OF TREATING CANCER OR CANCER METASTASES |
| US12415868B1 (en) | 2020-06-26 | 2025-09-16 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| US12491259B2 (en) | 2022-04-12 | 2025-12-09 | Minerva Biotechnologies Corporation | Anti-variable MUC1* antibodies and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2016514099A (ja) | 2016-05-19 |
| JP6577872B2 (ja) | 2019-09-18 |
| US20220089779A1 (en) | 2022-03-24 |
| US20220218846A1 (en) | 2022-07-14 |
| KR20210082547A (ko) | 2021-07-05 |
| AU2019202199A1 (en) | 2019-04-18 |
| US20150089677A1 (en) | 2015-03-26 |
| IL240695B1 (en) | 2023-11-01 |
| KR20150121131A (ko) | 2015-10-28 |
| AU2019202199B2 (en) | 2021-01-14 |
| CA2901893C (en) | 2022-08-30 |
| EP2958940A2 (en) | 2015-12-30 |
| US20240277803A1 (en) | 2024-08-22 |
| IL240695B2 (en) | 2024-03-01 |
| WO2014130741A3 (en) | 2014-10-23 |
| CA2901893A1 (en) | 2014-08-28 |
| US20220193270A1 (en) | 2022-06-23 |
| IL240695A0 (en) | 2015-10-29 |
| CN105229027A (zh) | 2016-01-06 |
| AU2014218872A1 (en) | 2015-10-08 |
| JP2019206527A (ja) | 2019-12-05 |
| JP6862497B2 (ja) | 2021-04-21 |
| IL307628A (en) | 2023-12-01 |
| EP2958940A4 (en) | 2016-07-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240277803A1 (en) | Nme inhibitors and methods of using nme inhibitors | |
| US20180258186A1 (en) | NME Inhibitors and Methods of Using NME Inhibitors | |
| JP2024038024A (ja) | 幹細胞の増殖及び誘導用の培地 | |
| JP6646118B2 (ja) | 抗nme抗体 | |
| JP7386210B2 (ja) | Nmeバリアント種の発現および抑制 | |
| CN103068971B (zh) | 重编程癌细胞 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480022551.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14753856 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2901893 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014753856 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2015558975 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 240695 Country of ref document: IL Ref document number: P1046/2015 Country of ref document: AE |
|
| ENP | Entry into the national phase |
Ref document number: 20157026033 Country of ref document: KR Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14753856 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2014218872 Country of ref document: AU Date of ref document: 20140220 Kind code of ref document: A |