WO2012172277A1 - Simian adenovirus and hybrid adenoviral vectors - Google Patents

Simian adenovirus and hybrid adenoviral vectors Download PDF

Info

Publication number
WO2012172277A1
WO2012172277A1 PCT/GB2012/000467 GB2012000467W WO2012172277A1 WO 2012172277 A1 WO2012172277 A1 WO 2012172277A1 GB 2012000467 W GB2012000467 W GB 2012000467W WO 2012172277 A1 WO2012172277 A1 WO 2012172277A1
Authority
WO
WIPO (PCT)
Prior art keywords
vector
sequence
ady25
cell
viral
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2012/000467
Other languages
English (en)
French (fr)
Other versions
WO2012172277A4 (en
Inventor
Matthew Douglas James DICKS
Matthew Guy Cottingham
Adrian Vivian Sinton Hill
Sarah Gilbert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oxford University Innovation Ltd
Original Assignee
Oxford University Innovation Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP12723726.1A priority Critical patent/EP2714916B1/en
Priority to US14/119,413 priority patent/US9714435B2/en
Priority to BR112013030222A priority patent/BR112013030222A2/pt
Priority to CA2837274A priority patent/CA2837274C/en
Priority to SG2013087747A priority patent/SG195181A1/en
Priority to ES12723726.1T priority patent/ES2659183T3/es
Priority to DK12723726.1T priority patent/DK2714916T3/en
Priority to EP17204780.5A priority patent/EP3321367B1/en
Priority to AU2012270144A priority patent/AU2012270144B2/en
Priority to NO12723726A priority patent/NO2714916T3/no
Priority to CN201280036659.1A priority patent/CN103930551B/zh
Priority to JP2014511948A priority patent/JP6230527B2/ja
Application filed by Oxford University Innovation Ltd filed Critical Oxford University Innovation Ltd
Priority to RU2013152648/10A priority patent/RU2013152648A/ru
Publication of WO2012172277A1 publication Critical patent/WO2012172277A1/en
Publication of WO2012172277A4 publication Critical patent/WO2012172277A4/en
Anticipated expiration legal-status Critical
Priority to ZA2013/09016A priority patent/ZA201309016B/en
Priority to US15/628,277 priority patent/US10646587B2/en
Priority to US16/849,301 priority patent/US11857640B2/en
Priority to FR21C1026C priority patent/FR21C1026I1/fr
Priority to NO2021028C priority patent/NO2021028I1/no
Priority to US18/511,357 priority patent/US20240181078A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0603Embryonic cells ; Embryoid bodies
    • C12N5/0606Pluripotent embryonic cells, e.g. embryonic stem cells [ES]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10021Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10041Use of virus, viral particle or viral elements as a vector
    • C12N2710/10042Use of virus, viral particle or viral elements as a vector virus or viral particle as vehicle, e.g. encapsulating small organic molecule
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10041Use of virus, viral particle or viral elements as a vector
    • C12N2710/10044Chimeric viral vector comprising heterologous viral elements for production of another viral vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/20Pseudochromosomes, minichrosomosomes
    • C12N2800/204Pseudochromosomes, minichrosomosomes of bacterial origin, e.g. BAC
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to novel adenoviral vectors derived from a chimpanzee adenovirus, immunogenic compositions thereof and their use in medicine.
  • Subunit vaccines present an antigen to the immune system without introducing a whole infectious organism.
  • One such method involves the administration of a specific, isolated protein from an infectious organism.
  • this technique often induces only a weak immune response and the isolated proteins may have a different three-dimensional structure than the protein in its normal context, resulting in the production of antibodies that may not recognize the infectious organism.
  • Viruses are obligate intracellular parasites which replicate by transfecting their DNA into a host cell, and inducing the host cell to express the viral genome.
  • This reproductive strategy has been harnessed to create vectored vaccines by creating recombinant, non-replicating viral vectors which carry one or more heterologous transgenes.
  • Transfection or transduction of the recombinant viral genome into the host cell results in the expression of the heterologous transgene in the host cell.
  • the heterologous transgene encodes an antigen, for example, expression of the antigen within the host cell can elicit a protective or therapeutic immune response by the host immune system.
  • the viral vectors may function as effective vaccines.
  • the heterologous transgene may encode a functional allele of a gene, expression of which can be used to counteract the effects of a deleterious mutant allele of the gene, in a process known as gene therapy.
  • Adenoviruses are non- enveloped viruses, approximately 90 - lOOnm in diameter, comprising a nucleocapsid and a linear double stranded DNA genome.
  • the viral nucleocapsid comprises penton and hexon capsomers.
  • a unique fibre is associated with each penton base and aids in the attachment of the virus to the host cell via the Coxsackie-adenovirus receptor on the surface of the host cell.
  • Over 50 serotype strains of adenoviruses have been identified, most of which cause respiratory tract infections, conjunctivitis and gastroentiritus in humans.
  • adenoviruses Rather than integrating into the host genome, adenoviruses normally replicate as episomal elements in the nucleus of the host cell.
  • the genome of adenoviruses comprises 4 early transcriptional units (El, E2, E3 and E4), which have mainly regulatory functions and prepare the host cell for viral replication.
  • the genome also comprises 5 late transcriptional units (LI, L2, L3, L4 and L5), which encode structural proteins including the penton (L2), the hexon (L3), the scaffolding protein (L4) and the fiber protein (L5), which are under the control of a single promoter.
  • Each extremity of the genome comprises an Inverted Terminal Repeat (ITR) which is necessary for viral replication.
  • ITR Inverted Terminal Repeat
  • adenoviruses were originally developed for gene therapy, but the strong and sustained transgene-specific immune responses elicited by these gene delivery agents prompted their use as vaccine carriers.
  • adenoviruses offer many other advantages for clinical vaccine development.
  • the adenoviral genome is relatively small (between 26 and 45 kbp), well characterised and easy to manipulate.
  • the deletion of a single transcriptional unit, El renders the virus replication-incompetent which increases its predictability and reduces side effects in clinical applications.
  • Recombinant adenoviruses can accommodate relatively large transgenes, in some cases up to 8kb, allowing flexibility in subunit design, and have a relatively broad tropism facilitating transgene delivery to a wide variety of cells and tissues. Importantly for clinical applications, methods for scaled-up production and purification of recombinant adenoviruses to high titre are well established. Thus far, subgroup C serotypes AdHu2 or AdHu5 have predominantly been used as vectors.
  • chimpanzee adenoviral vectors have limited efficacy on the grounds of unexplained immunity in human populations, varying levels of cross-reactivity with human adenoviruses, and sub-optimal growth in transformed cell lines.
  • the present invention provides the complete genomic sequence of a chimpanzee adenovirus referred to herein as AdY25.
  • the present invention provides an adenovirus vector comprising a capsid derived from chimpanzee adenovirus AdY25, wherein said capsid encapsidates a nucleic acid molecule comprising an exogeneous nucleotide sequence of interest operably linked to expression control sequences which direct the translation, transcription and/or expression thereof in an animal cell and an adenoviral packaging signal sequence.
  • a third aspect provides immunogenic compositions comprising the adenoviral vector according to the second aspect, optionally in combination with one or more additional active ingredients, a pharmaceutically acceptable carrier, diluent, excipient or adjuvant.
  • a fourth aspect provides the use of the adenoviral vector according to the second aspect or the immunogenic composition according to the third aspect in medicine.
  • the adenoviral vector and immunogenic compositions are provided for delivery of a transgene into a host cell, elicitation of an immune response in an animal, boosting an immune response in an animal, treating or preventing at least one disease, inducing an immune response in an animal that will break tolerance to a self antigen and gene therapy.
  • a fifth aspect of the present invention provides a polynucleotide sequence encoding the adenoviral vector according to the second aspect of the present invention.
  • a sixth aspect of the present invention provides a host cell transduced with the viral vector according to the second aspect of the present invention.
  • a seventh aspect of the present invention provides a method of producing the viral vector according to the second aspect of the present invention, preferably by generating a molecular clone of AdY25 in a Bacterial Artificial Chromosome (BAC).
  • An eighth aspect of the present invention therefore provides a Bacterial Artificial Chromosome (BAC) clone comprising the polynucleotide sequence according to the fifth aspect of the present invention.
  • a ninth aspect of the present invention provides a packaging cell line producing the viral vector according to the second aspect of the present invention.
  • a tenth aspect of the present invention provides an adenoviral vector other than AdHu5 having a nucleic acid molecule comprising the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • Figure 1 shows a phylogenetic sequence alignment of the amino acid sequences of (A) the hexon protein and (B) the fiber protein of different adenovirus serotypes. Sequences are clustered into the six adenovirus groups A-F.
  • Figure 2 shows a phylogenetic sequence alignment based on the whole genomic nucleotide sequence of wild type adenoviruses of different species. Sequences are clustered into the six adenovirus groups A-F.
  • Figure 3A is a histogram of the viral yield (infectious units/ml) of AdHu5 and three Ad Y25 -based vectors expressing Green Fluorescent Protein (GFP): i) AdY25 E4 wildtype ("Y25E4wt”); ii) AdY25 E4 AdHu5 Orf6 ("Y25Ad5E40rf6") and iii) AdY25 AdHu5 E40rf4/6/7 ("AdChOXl").
  • Figure 3B is a histogram of the ratio of GFP foci to anti-hexon titer for AdHu5, AdCh63, AdY25 E4 wildtype and the constructs A-E as described in Figure 3C, all expressing the TIPeGFP antigen.
  • Figure 3C is a table detailing the construction of the E4-modified AdY25 vector constructs A, B, C, D and E.
  • Figure 3D is a histogram of the ratio of marker gene: hexon titer for AdChOXl -based vectors expressing TIPeGFP, having either GFP or mCherry fluorescent transgenes. All data is representative of at least two independent experiments. Error bars show mean and SEM.
  • Figure 4 is a graphical representation of cellular immunogenicity (spot forming cells (SFC)/million) of ChAdOXl as compared to AdCh63 and AdCh68.
  • Figure 5 is a graphical representation of the effect of E4 modification on IFN- ⁇ spleen ELISpot responses (SFC/million) to two epitopes, Pb9 and PI 5, two weeks after intramuscular immunisation of Balb/c mice (4/group) with either 10 8 or 10 6 infectious units (ifu) of AdY25-based vectors with the following E4 regions: i) wildtype E4 region ("E4wt”); ii) E40rf6 from AdHu5 (“E40rf6"); or iii) E40rf4, 6 and 7 from AdHu5 (“E40rf4/6/7").
  • Figure 6 is a histogram showing the prevalence of vector-neutralising antibodies in human sera from (A) the UK and (B) the Gambia, against Y25Ad5E40rf6 (referred to in Figure 6 as "ChAdOXl”) and AdCh63.
  • Figure 7 is a graphical representation of the humoral immunogenicity of ChAdOXl and AdCh68-based vectors carrying TIPeGFP antigen. After 56 days post prime, mice were boosted with 10 6 pfu MVA-TIPeGFP Serum was collected and responses measured by endpoint ELISA a) 50 days post prime and b) 10 days post boost. Mean and significance indicated. Statistical analyses performed by one way ANOVA.
  • FIG. 8A is a graphical representation of cellular immunogenicity (spot forming cells (SFC)/million splenocyltes) of ChAdOXl vector carrying the Mycobacterium tuberculosis Ag85A antigen, at three different doses.
  • Cellular immune responses to Ag85A were determined by IFN- ⁇ ELIspot assay using splenocytes stimulated with synthetic peptides corresponding to the known immunodominant CD4 + T cell H-2 d restricted epitope in Ag85A (pi 5).
  • Figure 8B is a graphical representation of cellular immunogenicity (spot forming cells (SFC)/million splenocyltes) of ChAdOXl carrying the Mycobacterium tuberculosis Ag85A antigen, at three different doses.
  • Cellular immune responses to Ag85A were determined by IFN- ⁇ ELIspot assay using splenocytes stimulated with synthetic peptides corresponding to the known immunodominant CD8 + T cell H-2 d restricted epitope in Ag85A (pi 1).
  • Figure 9 is a graphical representation of cellular immunogenicity (spot forming cells (SFC)/million splenocyltes) of ChAdOXl and HAdV-5 carrying the nucleoprotein (NP) and matrix protein 1 (Ml) of Influenza A virus, at two different doses.
  • Cellular immune responses to nucleoprotein (NP) were determined by IFN- ⁇ ELIspot assay using splenocytes stimulated with synthetic peptides corresponding to the known immunodominant CD8 + T cell H-2 d restricted epitope in NP.
  • the present invention relates to novel adenoviral vectors derived from a chimpanzee adenovirus, AdY25, immunogenic compositions thereof and their use in medicine.
  • AdY25 is a chimpanzee adenovirus which has been sequenced for the first time by the present inventors.
  • the nucleotide sequence is provided in SEQ ID NO. 1.
  • a first aspect of the present invention therefore provides a nucleic acid molecule having the sequence of SEQ ID NO. 1.
  • the nucleic acid molecule is isolated.
  • the person skilled in the art will appreciate that there are homologues, equivalents and derivatives of all of the nucleic acid sequences described herein.
  • the invention also encompasses nucleic acid molecules having a sequence substantially identical to the nucleic acid sequences described herein over their entire length.
  • the present invention can also include variants of those particular nucleic acid molecules which are exemplified herein. These may occur in nature, for example because of strain variation. For example, additions, substitutions and/or deletions are included.
  • variants have substantial identity to the nucleic acid sequences described herein over their entire length.
  • nucleic acid sequences which have "substantial identity” preferably have at least 80%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 98.1%, 98.2%, 98.3%, 98.4%, 98.5%, 98.6%, 98.7%, 98.8%, 98.9%, 99%, 99.1%, 99.2%, 99.3%, 99.4% 99.5%, 99.6%, 99.7%, 99.8% or 99.9% identity with said sequences.
  • the term "substantial identity” indicates that said sequence has a greater degree of identity with any of the sequences described herein than with prior art nucleic acid sequences.
  • BESTFIT When comparing nucleic acid sequences for the purposes of determining the degree of homology or identity one can use programs such as BESTFIT and GAP (both from the Wisconsin Genetics Computer Group (GCG) software package).
  • BESTFIT compares two sequences and produces an optimal alignment of the most similar segments.
  • GAP enables sequences to be aligned along their whole length and finds the optimal alignment by inserting spaces in either sequence as appropriate.
  • identity of nucleic acid sequences the comparison is made by alignment of the sequences along their whole length. The above applied mutatis mutandis to all nucleic acid sequences disclosed in the present application.
  • the nucleic acid molecule according to the first aspect has a sequence at least 98% identical to SEQ ID NO. l, more preferably at least 98.6% identical to SEQ ID NO.l .
  • the nucleic acid molecule according to the first aspect comprises one or more nucleotide sequences selected from the group consisting of;
  • nucleotide sequences encode the (a) hexon, (b) penton and (c) fibre capsid proteins of AdY25, the exterior regions of which determine the properties of the viral vector, including serotype.
  • the nucleic acid molecule according to the first aspect may also comprise one or more nucleotide sequences selected from the group consisting of:
  • nucleotide sequence encoding a hexon protein comprising the amino acid sequence of SEQ ID NO.2, or a sequence at least 98.2% identical thereto; or a nucleotide sequence encoding a hexon protein having a sequence at least 98.2% identical to the protein encoded by nucleotides 18302 to 21 130 of SEQ ID NO. 1 ;
  • nucleotide sequence encoding a penton protein comprising the amino acid sequence of SEQ ID NO.3, or a sequence at least 98.3% identical thereto; or a nucleotide sequence encoding a penton protein having a sequence at least 98.3% identical to the protein encoded by nucleotides 13891 to 15486 of SEQ ID NO. 1 ;
  • nucleotide sequence encoding a fiber protein comprising the amino acid sequence of SEQ ID NO.4 or a sequence at least 99.1% identical thereto; or a nucleotide sequence encoding a fiber protein having a sequence at least 99.1 % identical to the protein encoded by nucleotides 32290 to 33621 of SEQ ID NO. 1.
  • Nucleic acid molecules comprising a sequence complementary to the nucleic acid molecule according to the first aspect of the present invention are within the scope of the present invention.
  • nucleic acid molecules which hybridize only to the nucleic acid molecule according to the first aspect of the present invention are also encompassed by the present application.
  • the conditions used for hybridisation are sufficiently stringent that only such nucleic acid sequences would remain hybridised. The person skilled in the art would easily be able to determine such conditions.
  • the nucleic acid can be DNA, including cDNA, RNA including mRNA or PNA (peptide nucleic acid) or a mixture thereof.
  • Table 1 provides an overview of the wildtype AdY25 sequences disclosed herein:
  • E. coli strain DH10B containing bacterial artificial chromosomes (BACs) containing the cloned genome of chimpanzee adenovirus Y25 (pBACe3.6 Y25, cell line name "Y25”) was deposited by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Cultures (ECACC) at the Health Protection Agency Culture Collections, Health Protection Agency, Porton Down, Salisbury SP4 OJG, United Kingdom under the Budapest Treaty and designated by provisional accession no. 12052401.
  • BACs bacterial artificial chromosomes
  • the E. coli containing the BAC is a class I genetically modified organism.
  • the genotype of E. coli strain DH10B is: F- mcrA A(mrr-hsdRMS-mcrBC)
  • Chimpanzee adenovirus Y25 is provisionally classified within the species Human adenovirus E based on the nucleotide sequence of the viral DNA polymerase.
  • the BAC propagates within the ' bacteria during replication and can be maintained by selection with chloramphenicol.
  • the E. coli strain DH10B containing the BAC into which the genome is cloned can be propagated in Luria-Bertani broth or agar containing 12 ⁇ g/mL chloramphenicol at 37°C.
  • Converting the BAC clones of the viral genomes into viruses can be carried out by the following steps.
  • the E. coli host is propagated and the BAC DNA is purified from the bacteria according to standard methods.
  • the DNA is linearised with the restriction endonuclease Pmel and transfected into any cell line supporting growth of human adenoviruses (e.g. A549 cells).
  • the resulting adenovirus can then be propagated and purified for use as a vaccine, for example. All of these reagents and cells are publicly available. If the deposition were rescued, the resulting virus would be a wild-type adenovirus.
  • E. coli strain DH10B containing bacterial artificial chromosomes containing the cloned genome of chimpanzee adenovirus Y25 with deletion of the El region (pBACe3.6 Y25delEl , cell line name "Y25delEl"
  • BACs bacterial artificial chromosomes
  • pBACe3.6 Y25delEl cell line name "Y25delEl”
  • ECACC European Collection of Cell Cultures
  • the E. coli containing the BAC is a class I genetically modified organism.
  • the genotype of E. coli strain DH10B is: F- mcrA A(mrr-hsdRMS-mcrBC)
  • Chimpanzee adenovirus Y25 is provisionally classified within the species Human adenovirus E based on the nucleotide sequence of the viral DNA polymerase.
  • the BAC propagates within the bacteria during replication and can be maintained by selection with chloramphenicol.
  • the E. coli strain DH10B containing the bacterial artificial chromosomes into which the genomes are cloned can be propagated in Luria-Bertani broth or agar containing 12 ⁇ g/mL chloramphenicol at 37°C.
  • Converting the BAC clones of the viral genomes into viruses can be carried out by the following steps.
  • the E. coli host is propagated and the BAC DNA is purified from the bacteria according to standard methods.
  • the DNA is linearised with the restriction endonuclease Pmel and transfected into HEK293 cells (or a similar El complementing cell line).
  • the resulting adenovirus can then be propagated and purified for use as a vaccine for example. All of these reagents and cells are publicly available. If the deposition were rescued, the resulting virus would be a class I genetically modified organism.
  • a specific embodiment of the first aspect of the present invention provides the complete genomic sequence of a chimpanzee adenovirus referred to herein as AdY25, wherein said genomic sequence comprises or consists of the genomic sequence deposited in a BAC in E. coli strain DH10B by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Cultures (ECACC) at the Health
  • a second aspect of the present invention therefore provides an adenovirus vector comprising a capsid derived from chimpanzee adenovirus AdY25, wherein said capsid encapsidates a nucleic acid molecule comprising an exogeneous nucleotide sequence of interest operably linked to expression control sequences which direct the translation, transcription and/or expression thereof in an animal cell and an adenoviral packaging signal sequence.
  • the phrase "viral vector” refers to a recombinant virus or a derivative thereof which is capable of introducing genetic material, including recombinant DNA, into a host cell or host organism by means of transduction or non-productive infection.
  • the vector of the present invention may be a gene delivery vector, a vaccine vector, an antisense delivery vector or a gene therapy vector.
  • AdY25 and Y25 refer to the chimpanzee adenovirus AdY25 or vectors derived therefrom or based thereon. Shorthand terms are used to indicate modifications made to the wildtype virus. For example, “ ⁇ 1” or “delEl” indicates deletion or functional deletion of the El locus. The phrase “Ad5E40rf6” indicates that the viral vector comprises heterologous E4 open reading frame 6 from the Ad5 virus.
  • the vector of the present invention comprises a capsid derived from chimpanzee adenovirus AdY25.
  • the capsid comprises the native or wildtype AdY25 capsid proteins, including penton proteins, hexon proteins, fiber proteins and/or scaffolding proteins.
  • the vector capsid comprises one or more capsid proteins selected from the group consisting of:
  • a fibre protein comprising the amino acid sequence of SEQ ID NO. 4 or a sequence substantially identical thereto.
  • the present invention can include variants of those particular amino acid sequences which are exemplified herein. Particularly preferred are variants having an amino acid sequence similar to that of the parent protein, in which one or more amino acid residues are substituted, deleted or added in any combination. Especially preferred are silent substitutions, additions and deletions, which do not alter the properties and activities of the protein of the present invention.
  • Various amino acids have similar properties, and one or more such amino acids of a substance can often be substituted by one or more other such amino acids without eliminating a desired activity of that substance.
  • amino acids glycine, alanine, valine, leucine and isoleucine can often be substituted for one another (amino acids having aliphatic side chains).
  • amino acids having aliphatic side chains amino acids having aliphatic side chains.
  • glycine and alanine are used to substitute for one another (since they have relatively short side chains) and that valine, leucine and isoleucine are used to substitute for one another (since they have larger aliphatic side chains which are hydrophobic).
  • amino acids which can often be substituted for one another include: phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains); lysine, arginine and histidine (amino acids having basic side chains); aspartate and glutamate (amino acids having acidic side chains); asparagine and glutamine (amino acids having amide side chains); and cysteine and methionine (amino acids having sulphur containing side chains).
  • Variants include naturally occurring and artificial variants. Artificial variants may be generated using mutagenesis techniques, including those applied to nucleic acid molecules, cells or organisms. Preferably, the variants have substantial identity to the amino acid sequences exemplified herein.
  • amino acid sequences which have "substantial identity” preferably have at least 80%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 98.1%, 98.2%, 98.3%, 98.4%, 98.5%, 98.6%, 98.7%, 98.8%, 98.9%, 99%, 99.1%, 99.2%, 99.3%, 99.4%,99.5%, 99.6%, 99.1%, 99.8% or 99.9% identity with said sequences.
  • the term "substantial identity” indicates that said sequence has a greater degree of identity with any of the sequences described herein than with prior art amino acid sequences.
  • This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or similarity (identity plus conservation of amino acid type) for an optimal alignment.
  • a program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. The above applied mutatis mutandis to all amino acid sequences disclosed in the present application.
  • the hexon protein comprises an amino acid sequence at least 98.2% identical to SEQ ID NO. 2.
  • the penton protein comprises an amino acid sequence at least 98.3% identical to SEQ ID NO. 3.
  • the fiber protein comprises an amino acid sequence at least 99.1% identical to SEQ ID NO. 4.
  • the nucleotide sequences for the AdY25 hexon, penton and fibre proteins are set out in nucleotides 18302 to 21130 of SEQ ID NO. l (hexon protein), nucleotides 13891 to 15486 of SEQ ID NO. 1 (penton protein) and nucleotides 32290 - 33621 of SEQ ID NO.l (fibre protein).
  • the vector capsid may comprise one or more AdY25 capsid proteins encoded by these nucleotide sequences or sequences substantially identical thereto.
  • the vector according to the second aspect of the present invention may comprise one of the hexon, penton and fibre proteins as described above, any combination of two of said proteins, or all three of said proteins.
  • the vector of the present invention also comprises a nucleic acid molecule.
  • the nucleic acid molecule comprises an exogeneous nucleotide sequence of interest, operably linked to expression control sequences which direct the translation, transcription and/or expression thereof in an animal cell and an adenoviral packaging signal sequence.
  • the exogeneous nucleotide sequence encodes a molecule of interest.
  • the molecule of interest may be a protein, polypeptide or nucleic acid molecule of interest.
  • the exogeneous nucleotide sequence may encode one or more, two or more or three or more molecules of interest.
  • Proteins and polypeptides of interest include antigens, molecular adjuvants, immunostimulatory proteins and recombinases.
  • the protein or polypeptide of interest is an antigen.
  • the antigen is a pathogen-derived antigen.
  • the pathogen is selected from the group consisting of bacteria, viruses, prions, fungi, protists and helminthes.
  • the antigen is derived from the group consisting of M. tuberculosis, Plasomodium sp, influenza virus, HIV, Hepatitis C virus, Cytomegalovirus, Human papilloma virus, malaria parasites, leishmania parasites or any mycobacterial species.
  • Preferred antigens include TRAP, MSP-1, AMA-1 and CSP from Plasmodium, influenza virus antigens and ESAT6, TBI 0.4 85 A and 85B antigens from
  • Mycobacterium tuberculosis particularly preferred antigens include Ag85A from Mycobacterium tuberculosis and nucleoprotein (NP) and matrix protein 1 (Ml) from influenza A virus, preferably Influenza A virus.
  • NP nucleoprotein
  • Ml matrix protein 1
  • the antigen is a self-antigen.
  • Suitable self-antigens include antigens expressed by tumour cells which allow the immune system to differentiate between tumour cells and other cell types.
  • Suitable self-antigens include antigens that are either inappropriate for the cell type and/or its environment, or are only normally present during the organisms' development (e.g. foetal antigens).
  • GD2 is normally only expressed at a significant level on the outer surface membranes of neuronal cells, where its exposure to the immune system is limited by the blood-brain barrier.
  • GD2 is expressed on the surfaces of a wide range of tumour cells including small-cell lung cancer, neuroblastoma, melanomas and osteosarcomas.
  • the self antigen comprises a tumour-associated antigen (TAA).
  • TAA tumour-associated antigen
  • the term 'antigen' encompasses one or more epitopes from an antigen and includes the parent antigen, and fragments and variants thereof. These fragments and variants retain essentially the same biological activity or function as the parent antigen. Preferably, they retain or improve upon the antigenicity and/or immunogenicity of the parent antigen.
  • antigenic is taken to mean that the protein or polypeptide is capable of being used to raise antibodies or T cells or indeed is capable of inducing an antibody or T cell response in a subject.
  • immunogenic is taken to mean that the protein or polypeptide is capable of eliciting a potent and preferably a protective immune response in a subject.
  • the protein or polypeptide may be capable of generating an antibody response and a non- antibody based immune response.
  • fragments of the antigens comprise at least n consecutive amino acids from the sequence of the parent antigen, wherein n is preferably at least, or more than, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 57, 58, 59, 60, 70, 80, 90 or 100.
  • the fragments preferably include one or more epitopic regions from the parent antigen. Indeed, the fragment may comprise or consist of an epitope from the parent antigen. Alternatively, the fragment may be sufficiently similar to such regions to retain their antigenic/immunogenic properties.
  • the antigens of the present invention include variants such as derivatives, analogues, homologues or functional equivalents of the parent antigen. Particularly preferred are derivatives, analogues, homologues or functional equivalents having an amino acid sequence similar to that of the parent antigen, in which one or more amino acid residues are substituted, deleted or added in any combination. Preferably, these variants retain an antigenic determinant or epitope in common with the parent antigen.
  • the derivatives, analogues, homologues, and functional equivalents have an amino acid sequence substantially identical to amino acid sequence of the parent antigen.
  • the exogeneous nucleotide sequence may encode more than one antigen.
  • the viral vector may be designed to express the one or more antigen genes as an epitope string.
  • the epitopes in a string of multiple epitopes are linked together without intervening sequences such that unnecessary nucleic acid and/or amino acid material is avoided.
  • the creation of the epitope string is preferably achieved using a recombinant DNA construct that encodes the amino acid sequence of the epitope string, with the DNA encoding the one or more epitopes in the same reading frame.
  • An exemplary antigen, TIPeGFP comprises an epitope string which includes the following epitopes: E6FP, SIV-gag, PyCD4 and Py3. Alternatively, the antigens may be expressed as separate polypeptides.
  • One or more of the antigens or antigen genes may be truncated at the C-terminus and/or the N-terminus. This may facilitate cloning and construction of the vectored vaccine and/or enhance the immunogenicity or antigenicity of the antigen.
  • Methods for truncation will be known to those of skill in the art. For example, various well- known techniques of genetic engineering can be used to selectively delete the encoding nucleic acid sequence at either end of the antigen gene, and then insert the desired coding sequence into the viral vector. For example, truncations of the candidate protein are created using 3' and/or 5' exonuclease strategies selectively to erode the 3' and/or 5' ends of the encoding nucleic acid, respectively.
  • the wild type gene sequence is truncated such that the expressed antigen is truncated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids relative to the parent antigen.
  • the antigen gene is truncated by 10 - 20 amino acids at the C- terminus relative to the wild type antigen. More preferably, the antigen gene is truncated by 13 - 18 amino acids, most preferably by 15 amino acids at the C- terminus relative to the wild type antigen.
  • the Ag85A antigen is C-terminally truncated in this manner.
  • One or more of the antigen genes may also comprise a leader sequence.
  • the leader sequence may affect processing of the primary transcript to mRNA, translation efficiency, mRNA stability, and may enhance expression and/or immunogenicity of the antigen.
  • the leader sequence is tissue plasminogen activator (tPA).
  • tPA tissue plasminogen activator
  • the tPA leader sequence is positioned N-terminal to the one or more antigens.
  • the leader sequence such as the tPA leaders sequence may be linked to the sequence of the antigen via a peptide linker.
  • Peptide linkers are generally from 2 to about 50 amino acids in length, and can have any sequence, provided that it does not form a secondary structure that would interfere with domain folding of the fusion protein.
  • One or more of the antigen genes may comprise a marker such as the Green
  • GFP Fluorescent Protein
  • One or more of the antigen genes may comprise a nucleic acid sequence encoding a tag polypeptide that is covalently linked to the antigen upon translation.
  • the tag polypeptide is selected from the group consisting of a PK tag, a FLAG tag, a MYC tag, a polyhistidine tag or any tag that can be detected by a monoclonal antibody.
  • the nucleic acid sequence encoding the tag polypeptide may be positioned such that, following translation, the tag is located at the C-terminus or the N-terminus of the expressed antigen or may be internal to the expressed antigen.
  • the tag is located at the C-terminus of the expressed antigen.
  • one or more of the antigen genes encode a PK tag. A tag of this type may facilitate detection of antigen expression and clones expressing the antigen, and/or enhance the immunogenicity or antigenicity of the antigen.
  • nucleotides encoding a linker sequence are preferably inserted between the nucleic acid encoding the tag polypeptide and the nucleic acid encoding the expressed antigen.
  • An exemplary linker is IPNPLLGLD (SEQ ID N0.49).
  • the exogeneous sequence of interest may be nonprotein encoding.
  • the exogeneous nucleotide sequence may be an miRNA or imrnunostimulatory RNA sequence.
  • the adenoviral vector may comprise one or more exogeneous nucleotide sequences, for example 1, 2 or 3 or more exogeneous nucleotide sequences.
  • each exogeneous nucleotide sequence embodies a transgene.
  • the exogeneous nucleotide sequence embodying the transgene can be a gene or a functional part of the gene.
  • the adenoviral vector may comprise one nucleotide sequence encoding a single molecule of interest.
  • the adenoviral vector may comprise one nucleotide sequence or more than one nucleotide sequence encoding more than one molecule of interest.
  • the exogeneous nucleotide sequence is located in a nucleic acid molecule that contains other, adenoviral sequences.
  • the exogeneous nucleotide sequence may be inserted into the site of a partially or fully deleted AdY25 gene, for example into the site of an El deletion or an E3 deletion.
  • the exogeneous nucleotide sequence may be inserted into an existing AdY25 gene region to disrupt the function of that region.
  • the exogeneous nucleotide sequence may be inserted into a region of the AdY25 genome with no alteration to the function or seqeuence of the surrounding genes.
  • the exogeneous nucleotide sequence or transgene is preferably operably linked to regulatory sequences necessary to drive translation, transcription and/or expression of the exogeneous nucleotide sequence /transgene in a host cell, for example a mammalian cell.
  • the phrase "operably linked" means that the regulatory sequences are contiguous with the nucleic acid sequences they regulate or that said regulatory sequences act in trans, or at a distance, to control the regulated nucleic acid sequence.
  • regulatory sequences include appropriate expression control sequences such as transcription initiation, termination, enhancer and promoter sequences, efficient RNA processing signals, such as splicing and polyadenylation signals, sequences that enhance translation efficiency and protein stability and sequences promote protein secretion.
  • the promoter is selected from the group consisting of human CMV promoters, simian CMV promoters, murine CMV promoters, ubiquitin, the EF1 promoter, frog EF1 promoter, actin and other mammalian promoters. Most preferred are human CMV promoters and in particular the human CMV major immediate early promoter.
  • the exogeneous nucleotide sequence(s) of interest may be introduced into the viral vector as part of a cassette.
  • cassette refers to a nucleic acid molecule comprising at least one nucleotide sequence to be expressed, along with its transcriptional and translational control sequences to allow the expression of the nucleotide sequence(s) in a host cell, and optionally restriction sites at the 5' and 3' ends of the cassette. Because of the restriction endonuclease sites, the cassettes can easily be inserted, removed or replaced with another cassette. Changing the cassette will result in the expression of different sequence(s) by the vector into which the cassette is incorporated.
  • any method known to one of skill in the art could be used to construct, modify or derive said cassette, for example PCR mutagenesis, In-Fusion ® , recombineering, Gateway ® cloning, site-specific
  • the expression control sequences preferably include the adenovirus elements necessary for replication and virion encapsidation.
  • the elements flank the exogeneous nucleotide sequence.
  • the Y25 vector comprises the 5' inverted terminal repeat (ITR) sequences of Y25, which function as origins of replication, and 3' ITR sequences.
  • the packaging signal sequence functions to direct the assembly of the viral vector.
  • the nucleic acid molecule may also comprise "stuffing", i.e. extra nucleotide sequence to bring the final vector genome up to the required size.
  • the nucleic acid molecule comprises sufficient "stuffing" to ensure that the nucleic acid molecule is about 80% to about 108% of the length of the wild-type nucleic acid molecule.
  • the nucleic acid molecule may also comprise one or more genes or loci from the AdY25 genome.
  • the wildtype AdY25 genome comprises 4 early transcriptional units (El, E2, E3 and E4), which have mainly regulatory functions and prepare the host cell for viral replication.
  • the genome also comprises 5 late transcriptional units (LI , L2, L3, L4 and L5), which encode structural proteins including the penton (L2), the hexon (L3), the scaffolding protein (L4) and the fiber protein (L5), which are under the control of a single promoter.
  • Each extremity of the genome comprises an Inverted Terminal Repeat (ITR) which is necessary for viral replication.
  • the viral vector of the present invention may comprise the complete native AdY25 genome, into which the exogeneous nucleotide sequence has been inserted. However, one of skill in the art will appreciate that various modifications to the native AdY25 genome are possible, and indeed desirable, when creating a viral vector.
  • One or more native AdY25 genes may be deleted, functionally deleted or modified to optimise the viral vector.
  • the phrase “deleted” refers to total deletion of a gene, whilst “functional deletion” refers to a partial deletion of a gene/locus, or some other modification such as a frame shift mutation, which destroys the ability of the adenovirus to express the gene/locus or renders the gene product non-functional.
  • the AdY25 genome may be modified to increase the insert capacity or hinder replication in host cells and/or increase growth and yield of the viral vector in transformed packaging cell lines.
  • any number of early or late genes can be functionally deleted. Replication of such modified viral vectors will still be possible in transformed cell lines which comprise a complement of the deleted genes.
  • the viral proteins necessary for replication and assembly can be provided in trans by engineered packaging cell lines or by a helper virus.
  • the vector of the present invention may comprise the minimal adenoviral sequences, the adenoviral genome with one or more deletions or functional deletions of particular genes, or the complete native adenoviral genome, into which has been inserted the exogeneous nucleotide sequence.
  • the vector of the present invention comprises the native Y25 late transcriptional units (LI - L5) and/or the native Y25 Inverted Terminal Repeats (ITR) or sequences substantially identical thereto.
  • ITR Inverted Terminal Repeats
  • one or more of the early transcriptional units are modified, deleted or functionally deleted.
  • the viral vector is non-replicating or replication-impaired.
  • non-replicating or “replication-impaired” means not capable of replicating to any significant extent in the majority of normal mammalian cells, preferably normal human cells. It is preferred that the viral vector is incapable of causing a productive infection or disease in the human patient. However, the viral vector is preferably capable of stimulating an immune response. Viruses which are non-replicating or replication-impaired may have become so naturally, i.e. they may be isolated as such from nature. Alternatively, the viruses may be rendered non- replicating or replication-impaired artificially, e.g. by breeding in vitro or by genetic manipulation. For example, a gene which is critical for replication may be
  • the adenoviral vector replication is rendered incompetent by functional deletion of a single transcriptional unit which is essential for viral replication.
  • the El gene/locus is deleted or functionally deleted.
  • the El gene/locus may be replaced with a heterologous transgene, for example a nucleotide sequence or expression cassette encoding a protein or polypeptide of interest.
  • the wildtype AdY25 El amino acid sequence, and the corresponding nucleic acid sequence, are set out in Table 1 , above.
  • the recombinant adenovirus may be created by generating a molecular clone of AdY25 in a Bacterial Artificial Chromosome (BAC), and the El locus is preferably deleted by including an extra homology flank downstream of the adenovirus El region to enable simultaneous deletion of El during homologous recombination between the AdY25 viral DNA and a linearised BAC "rescue vector", as described in Example 1.
  • BAC Bacterial Artificial Chromosome
  • the viral vector according to the present invention comprises one or more recombination sites to enable the insertion of one or more transgenes or cassettes comprising the exogeneous nucleotide sequence.
  • the recombination sites comprise phage lambda site specific recombination sites. These recombination sites may be introduced at any suitable locus, but are preferably introduced at the Ad El locus.
  • the non-replicating or replication-impaired vector may be prepared by replacing the El gene with a nucleotide sequence encoding the protein or polypeptide of interest.
  • the recombination sites attRl and attR2 are introduced at the Ad El locus as part of an Invitrogen Gateway ® destination cassette as described in Example 1.
  • the vector lacks an adenovirus E3 gene/locus. Deletion of the adenovirus E3 region increases the insert capacity of the new vector by approximately 5kb. Deletion of E3 has little consequence to viral vector yield since this region is not required for virus replication and therefore does not need to be provided in trans in the packaging cell line.
  • the E3 locus may be deleted using GalK recombineering as described in Example 2.
  • the wildtype AdY25 E3 amino acid sequence, and the corresponding nucleic acid sequence, are set out in Table 1, above.
  • both the El and E3 loci are deleted from the AdY25 genome.
  • the vector of the present invention comprises the native E2 locus.
  • E2 is a transcriptional unit comprising the open reading frames encoding the Polymerase, PTP and IVa2 proteins.
  • the wildtype AdY25 E4 amino acid sequence, and the corresponding nucleotide sequence, are set out in Table 1, above.
  • the vector of the present invention comprises a nucleotide sequence encoding E2 or a sequence substantially identical thereto.
  • the viral vectors of the present invention may be produced in engineered cell lines containing a complement of any deleted genes required for viral replication.
  • replication of viral vectors according to the present invention may be sub-optimal in cells designed to facilitate replication of other serotypes.
  • the first generation of AdY25-based vectors comprising the wildtype E4 locus were found to grow inefficiently in HEK293 cells and yield was approximately two logs lower than for comparable AdHu5-based vectors. It is hypothesized that the low yield resulted from suboptimal interaction between the cell-expressed El proteins (designed to support propagation of AdHu5 viruses) and vector-encoded E4 gene products. Therefore, the adenoviral vectors according to the present invention preferably further comprise one or more modifications designed to optimise vector growth and yield in transformed cell lines, such as HEK293, expressing the genes functionally deleted in the adenoviral vector according to the present invention.
  • the native E4 region may be replaced in its entirety with a heterologous E4 region from other serotype(s), which heterologous E4 region preferably increases vector yield and growth in a transformed cell line.
  • the native E4 region may be replaced with the E4 region from AdHu5 to increase vector yield and growth in HEK293.
  • the adenovirus E4 region comprises at least 6 Open Reading Frames (ORFs or Orfs).
  • ORFs or Orfs Open Reading Frames
  • one or more of the ORFs in the E4 region may be replaced with one or more heterologous ORFs from the E4 region of other adenoviral serotype(s), which heterologous ORF(s) preferably increase(s) vector yield and growth in a transformed cell line.
  • 1, 2, 3, 4, 5 or 6 ORFs in the E4 region may be replaced 1, 2, 3, 4, 5 or 6 heterologous ORFs from the E4 region of other serotype(s), e.g. AdHu5.
  • E40rf6 a multifunctional protein implicated in late viral mRNA splicing and selective export of viral mRNA, viral DNA synthesis and inhibition of apoptosis.
  • Suboptimal interaction between E40rf6 and the cell-expressed E1B-55K is believed to reduce the yield of AdChOXl vectors in HEK293 cells. Therefore, the native E40rf6 region may be replaced with a heterologous E40rf6 region.
  • the entire native E4 locus may be replaced with the E40rf6 gene from AdHu5, as described in Example 3.
  • the amino acid sequence of E40rf6 from AdHu5 is found in SEQ ID NO.40.
  • the vector of the present invention comprises the nucleotide sequence of AdHu5E40rf6 or a sequence substantially identical thereto. As described in Example 3 and shown in Figure 3A, this modification was found to improve viral yield and growth.
  • more than one ORF in the E4 region is replaced with more than one heterologous ORF from the E4 region of other serotype(s).
  • native E40rf4, E40rf6 and E40rf7 may be replaced with the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • the recombinant E4 region comprises the E40rfl, E40rf2 and E40rf3 coding regions from AdY25 and the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • the amino acid sequence of E40rf4 from AdHu5 is found in SEQ ID NO. 41.
  • a corresponding nucleotide sequence is found at nucleotides 29053 to 29397 of SEQ ID NO. 38.
  • the amino acid sequence of the E40rf6 from AdHu5 is found in SEQ ID NO. 40.
  • a corresponding nucleotide sequence is found at nucleotides 28248 to 29132 of SEQ ID NO. 38.
  • the amino acid sequence of the E40rf6/7 from AdHu5 is found in SEQ ID NO. 39.
  • a corresponding nucleotide sequence is found at nucleotides 28959 to 29132 and 27969 to 28247 of SEQ ID NO. 38.
  • the vector of the present invention comprises the nucleotide sequences of AdHu5 E40rf4, E40rf6 and E40rf6/7 or sequences substantially identical thereto.
  • the genome of the viral vector according to the present invention lacks the nucleotide sequences which encode the adenovirus El and E3 regions, and has the native E4 locus replaced with E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5, and the E40rfl, E40rf2 and E40rf3 coding regions from AdY25.
  • This particularly preferred embodiment is referred to herein interchangeably as "ChAdOXl" or "AdChOXl”.
  • EIA, EIB 19kDa and EIB 55kDa are deleted and replaced with a Gateway ® Destination Cassette (nucleotides 592 to 2550 of SEQ ID NO. 38).
  • E3 CRlal, E3 gpl9kDa, E3 22.3 kDa, E3 31 kDa, E3 10.4 kDa, E3 15.2 kDa and E3 14.7 kDa are deleted and replaced with a Pacl site (nucleotides 26286 to 26293 of SEQ ID NO. 38).
  • the native E4 region is deleted and replaced with E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5, and the E40rfl, E40rf2 and E40rf3 coding regions from AdY25, as described above.
  • the viral vector encoded by SEQ ID NO. 38 also comprises a number of wild-type AdY25 proteins, the nucleotide sequences of which are set out in Table 2, below: Table 2
  • the genome of the viral vector according to the present invention comprises the nucleotide sequence of SEQ ID NO.38 or a sequence substantially identical thereto, into which is inserted the exogeneous nucleotide sequence encoding the protein of interest.
  • modification of the E4 region was found to have little impact on immunogenicity of the viral vector, but did improve the rate of viral growth and replication. Therefore, such E4 modifications can be used to enhance the rate of production of the viral vectors, but will not have a negative impact on the immunogenicity of the vectors.
  • Example 4 and Figure 4 demonstrate that the immune responses elicited by the AdY25-based vector ChAdOXl are robust and comparable to those elicited by AdCh63 (also known as ChAd63) and AdCh68 (also known as AdC68, ChAd68, C9 or SAdV-25).
  • AdCh63 also known as ChAd63
  • AdCh68 also known as AdC68, ChAd68, C9 or SAdV-25
  • the humoral immunogenicity of ChAdOXl was found to be superior to that of AdCh68, as described in Example 7 and Figure 7.
  • T-cell responses and antibody responses to correlate fully with one another. The superiority of the humoral responses to ChAdOXl is therefore surprising.
  • Example 8 and Figures 8 A and 8B demonstrate that ChAdOXl is capable of inducing immune responses against Mycobacterium tuberculosis, whilst Example 9 and Figure 9 demonstrate that ChAdOXl is capable of inducing immune responses against Influenza A.
  • a third aspect of the present invention provides a pharmaceutical or immunogenic composition
  • a pharmaceutical or immunogenic composition comprising the viral vector according to the second aspect of the present invention optionally in combination with one or more additional active ingredients, a pharmaceutically acceptable carrier, diluent, excipient or adjuvant.
  • the composition is an immunogenic and/or antigenic composition.
  • the immunogenic and/or antigenic compositions according to the present invention may be prophylactic (to prevent infection), post-exposure (to treat after infection but before disease) or therapeutic (to treat disease).
  • the composition is prophylactic or post-exposure.
  • the composition is a vaccine.
  • the immunogenic composition is for prophylactic use, the subject is preferably an infant, young child, older child or teenager.
  • the immunogenic composition is for therapeutic use, the subject is preferably an adult.
  • the composition may comprise one or more additional active agents, such as an antiinflammatory agent (for example a p38 inhibitor, glutamate receptor antagonist, or a calcium channel antagonist), AMPA receptor antagonist, a chemotherapeutic agent and/or an antiproliferative agent.
  • additional active agents such as an antiinflammatory agent (for example a p38 inhibitor, glutamate receptor antagonist, or a calcium channel antagonist), AMPA receptor antagonist, a chemotherapeutic agent and/or an antiproliferative agent.
  • the composition may also comprise one or more antimicrobial compounds. Examples of suitable antimicrobial compounds include antituberculous chemotherapeutics such as rifampicin, isoniazid, ethambutol and pyrizinamide.
  • Suitable carriers and/or diluents are well known in the art and include pharmaceutical grade starch, mannitol, lactose, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, (or other sugar), magnesium carbonate, gelatin, oil, alcohol, detergents, emulsifiers or water (preferably sterile).
  • the composition may be a mixed preparation of a composition or may be a combined preparation for simultaneous, separate or sequential use (including administration).
  • Suitable adjuvants are well known in the art and include incomplete Freund's adjuvant, complete Freund's adjuvant, Freund's adjuvant with MDP (muramyldipeptide), alum (aluminium hydroxide), alum plus Bordatella pertussis and immune stimulatory complexes (ISCOMs, typically a matrix of Quil A containing viral proteins).
  • composition according to the invention for use in the aforementioned indications may be administered by any convenient method, for example by oral (including by inhalation), parenteral, mucosal (e.g. buccal, sublingual, nasal), rectal or transdermal administration and the compositions adapted accordingly.
  • oral administration the composition can be formulated as liquids or solids, for example solutions, syrups, suspensions or emulsions, tablets, capsules and lozenges.
  • a liquid formulation will generally consist of a suspension or solution of the compound or physiologically acceptable salt in a suitable aqueous or non-aqueous liquid carrier(s) for example water, ethanol, glycerine, polyethylene glycol or oil.
  • the formulation may also contain a suspending agent, preservative, flavouring or colouring agent.
  • a composition in the form of a tablet can be prepared using any suitable pharmaceutical carrier(s) routinely used for preparing solid formulations. Examples of such carriers include magnesium stearate, starch, lactose, sucrose and microcrystalline cellulose.
  • a composition in the form of a capsule can be prepared using routine encapsulation procedures.
  • powders, granules or pellets containing the active ingredient can be prepared using standard carriers and then filled into a hard gelatine capsule; alternatively, a dispersion or suspension can be prepared using any suitable pharmaceutical carrier(s), for example aqueous gums, celluloses, silicates or oils and the dispersion or suspension then filled into a soft gelatine capsule.
  • a suitable pharmaceutical carrier(s) for example aqueous gums, celluloses, silicates or oils
  • compositions for oral administration may be designed to protect the active ingredient against degradation as it passes through the alimentary tract, for example by an outer coating of the formulation on a tablet or capsule.
  • compositions consist of a solution or suspension of the compound or physiologically acceptable salt in a sterile aqueous or non-aqueous carrier or parenterally acceptable oil, for example polyethylene glycol, polyvinyl pyrrolidone, lecithin, arachis oil or sesame oil.
  • a sterile aqueous or non-aqueous carrier or parenterally acceptable oil for example polyethylene glycol, polyvinyl pyrrolidone, lecithin, arachis oil or sesame oil.
  • the solution can be lyophilised and then reconstituted with a suitable solvent just prior to administration.
  • Compositions for nasal or oral administration may conveniently be formulated as aerosols, drops, gels and powders.
  • Aerosol formulations typically comprise a solution or fine suspension of the active substance in a physiologically acceptable aqueous or non-aqueous solvent and are usually presented in single or multidose quantities in sterile form in a sealed container, which can take the form of a cartridge or refill for use with an atomising device.
  • the sealed container may be a unitary dispensing device such as a single dose nasal inhaler or an aerosol dispenser fitted with a metering valve, which is intended for disposal once the contents of the container have been exhausted.
  • the dosage form comprises an aerosol dispenser, it will contain a pharmaceutically acceptable propellant.
  • the aerosol dosage forms can also take the form of a pump-atomiser.
  • compositions suitable for buccal or sublingual administration include tablets, lozenges and pastilles, wherein the active ingredient is formulated with a carrier such as sugar and acacia, tragacanth, or gelatin and glycerin.
  • a carrier such as sugar and acacia, tragacanth, or gelatin and glycerin.
  • compositions for rectal or vaginal administration are conveniently in the form of suppositories (containing a conventional suppository base such as cocoa butter), pessaries, vaginal tabs, foams or enemas.
  • compositions suitable for transdermal administration include ointments, gels, patches and injections including powder injections.
  • composition is in unit dose form such as a tablet, capsule or ampoule.
  • the pharmaceutical composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered e.g. at between pH 6 and pH 8, generally around pH 7.
  • the composition is substantially isotonic with humans.
  • the pharmaceutical compositions of the present invention deliver an immunogenically or pharmaceutically effective amount of the viral vector to a patient.
  • 'immunogenically or pharmaceutically effective amount means that the administration of that amount to an individual, either as a single dose or as a series of doses, is effective for prevention or treatment of a disease or condition.
  • this phrase means that a sufficient amount of the viral vector is delivered to the patient over a suitable timeframe such that a sufficient amount of the antigen is produced by the patient's cells to stimulate an immune response which is effective for prevention or treatment of a disease or condition.
  • This amount varies depending on the health and physical condition of the individual to be treated, age, the capacity of the individual's immune system, the degree of protection desired, the formulation of the vaccine, the doctor's assessment of the medical situation and other relevant factors.
  • a pharmaceutically effective dose comprises 1 x 10 to 1 x 10 viral particles, preferably 1 x 10 10 to 1 x 10" particles.
  • the immunogenic composition of the present invention may also comprise one or more other viral vectors, preferably other adenoviral vectors.
  • a fourth aspect of the present invention provides the use of the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the fourth aspect provides the use of the viral vector or the immunogenic composition of the present invention in medicine.
  • This aspect also provides: i) the viral vector or the immunogenic composition according to the present invention for use in medicine and ii) the use of the viral vector or the immunogenic composition according to the present invention in the manufacture of a medicament for use in medicine.
  • the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention may be used to deliver a transgene into a host cell.
  • This method preferably comprises the step of administering to said host cell a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the host cell is an animal cell, more preferably a mammalian cell.
  • Preferred mammals include chickens, other poultry, cows, sheep, goats, pigs, wild boar, buffalo, bison, horses, camelids, deer, elephants, badgers, possums, cats, lions, monkeys and humans.
  • the host cell is a somatic cell.
  • the host cell may be selected from the group consisting of an antigen-presenting dendritic cell, langerhans cell, macrophage, B cell, lymphocyte, leukocyte, myocyte and fibroblast.
  • This method may be carried out in vitro or in vivo.
  • the viral vector or immunogenic composition is brought into contact with the host cell under suitable conditions such that transduction or non-productive infection of the host cell with the viral vector is facilitated.
  • the host cell may comprise an isolated host cell or a sample from an animal subject.
  • the viral vector or immunogenic composition is preferably administered to the animal subject such that transduction of one or more cells of the subject with the viral vector is facilitated.
  • the viral vector or immunogenic composition is administered to the subject by oral (including by inhalation), parenteral, mucosal (e.g. buccal, sublingual, nasal), rectal or transdermal administration.
  • the transduction of the host cell with the viral vector of the present invention results in the stable delivery of the exogeneous nucleotide sequence of interest into the host cell. Therefore, in another embodiment, the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention may be used to elicit an immune response in an animal.
  • This method preferably comprises the step of administering to said animal a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • protein or polypeptide of interest is an antigen
  • expression of the protein or polypeptide in an animal will result in the elicitation of a primary immune response to that antigen, leading to the development of an immunological memory which will provide an enhanced response in the event of a secondary encounter, for example upon infection by the pathogen from which the antigen was derived.
  • the animal is a naive animal, i.e. an animal that has not previously been exposed to the pathogen or antigens in question.
  • the viral vector of the present invention or the immunogenic composition thereof can be used to boost the immune response of an animal previously exposed to the antigen.
  • the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention may be used to boost an immune response in an animal.
  • This method preferably comprises the step of administering to said animal a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the animal subject has been previously exposed to the antigen in question, or "primed".
  • the subject may have previously been inoculated or vaccinated with a composition comprising the antigen, or may have previously been infected with the pathogen from which the antigen was derived.
  • the subject may be latently infected with the pathogen from which the antigen was derived.
  • the vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention may be used to treat or prevent at least one disease in a patient. This method preferably comprising the step of administering to said patient a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the disease is selected from the group consisting of Tuberculosis and other mycobacterial infections, malaria, influenza, HIV/ AIDS, Hepatitis C, Cytomegalovirus infection, Human papilloma virus infection, adenoviral infection, leishmaniasis, streptococcus spp., staphylococcus spp., meningococcus spp., infection, rift valley fever, foot and mouth disease and chikungunya virus infection.
  • the adenoviral vector of the present invention may also induce an immune response against the adenovirus from which the viral vector is derived.
  • an immune response against AdY25 may be elicited.
  • the immune response induced against AdY25 may also be cross-reactive with other adenoviral serotypes, and as such an immune response against more than one adenovirus may be elicited.
  • the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention can therefore also be used for treating or preventing an adenoviral disease.
  • This embodiment of the present invention therefore also provides the treatment or prevention of at least one adenoviral disease and at least one non-adenoviral disease in a patient.
  • the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention may be used to induce an immune response in an animal that will break tolerance to a self antigen.
  • This method preferably comprises the step of administering to said animal a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the viral vector of the present invention can be used to stimulate a patient's immune system to attack the tumour cells in a process known as "cancer immunotherapy".
  • the vector of the present invention can be used to 'train' the patient's immune system to recognise tumour cells as targets to be destroyed. This can be achieved by including within the viral vector an exogeneous nucleotide sequence encoding a suitable self-antigen.
  • suitable self-antigens include antigens expressed by tumour cells which allow the immune system to differentiate between tumour cells and other cell types.
  • Suitable self-antigens include antigens that are either inappropriate for the cell type and/or its environment, or are only normally present during the organisms' development (e.g. foetal antigens).
  • GD2 is normally only expressed at a significant level on the outer surface membranes of neuronal cells, where its exposure to the immune system is limited by the blood-brain barrier.
  • GD2 is expressed on the surfaces of a wide range of tumour cells including small-cell lung cancer, neuroblastoma, melanomas and osteosarcomas.
  • Suitable self-antigens include cell-surface receptors that are found on tumour cells but are rare or absent on the surface of healthy cells. Such receptors may be responsible for activating cellular signalling pathways that result in the unregulated growth and division of the tumour cell.
  • ErbB2 is produced at abnormally high levels on the surface of breast cancer tumour cells.
  • the adenoviral vector of the present invention may be used to induce an immune response against a tumour cell, and can therefore be used in the treatment of cancer. The following details apply mutatis mutandis to all of the above uses of the vector and immunogenic composition of the present invention.
  • the treatment and prevention of many diseases are associated with the maintenance of a strong cell- mediated response to infection involving both CD4+ and CD8+ T cells and the ability to respond with Thl-type cytokines, particularly IFN- ⁇ , TNF-a, IL-2 and IL-17.
  • Thl-type cytokines particularly IFN- ⁇ , TNF-a, IL-2 and IL-17.
  • the viral vector of the present invention preferably stimulates both cellular and humoral immune responses against the encoded antigen.
  • Memory immune responses are classically attributed to the reactivation of long-lived, antigen-specific T lymphocytes that arise directly from differentiated effector T cells and persist in a uniformly quiescent state.
  • Memory T cells have been shown to be heterogeneous and to comprise at least two subsets, endowed with different migratory capacity and effector function; effector memory T cells (TEM) and central memory T cells (CTM).
  • TEM resemble the effector cells generated in the primary response in that they lack the lymph node-homing receptors L-selectin and CCR7 and express receptors for migration into inflamed tissues.
  • TCM express L-selectin and CCR7 and lack immediate effector function. These cells have a low activation threshold and, upon restimulation in secondary lymphoid organs, proliferate and differentiate to effectors.
  • the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention is capable of eliciting, inducing or boosting an antigen-specific immune response.
  • the immune response is a strong T cell immune response, for example a strong CD8+ and CD4+ T cell response.
  • the T cell immune response is a protective T cell immune response.
  • the T cell immune response is long lasting and persists for at least 1, 2, 5, 10, 15, 20, 25 or more years.
  • the immune response induced is a memory T cell immune response.
  • the viral vector of the second aspect of the present invention or immunogenic composition according to the third aspect of the present invention may be
  • the viral vector or immunogenic composition thereof are administered as part of a single, double or triple vaccination strategy. They may also be administered as part of a homologous or heterologous prime-boost immunisation regime.
  • the vaccination strategy or immunisation regime may include second or subsequent administrations of the viral vector or immunogenic composition of the present invention.
  • the second administration can be administered over a short time period or over a long time period.
  • the doses may be administered over a period of hours, days, weeks, months or years, for example up to or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more weeks or 0.25, 0.5, 0.75, 1, 5, 10, 15, 20, 25, 30, 35 or 40 or more years after the first administration.
  • the second administration occurs at least 2 months after the first administration.
  • the second administration occurs up to 10 years after the first administration.
  • the viral vector and/or immunogenic composition may be administered alone or in combination with other viral or non-viral DNA/protein vaccines.
  • Preferred examples include MVA, FP9 and other adenoviral vector vaccines.
  • the viral vector and/or immunogenic composition may be administered to the subject by oral (including by inhalation), parenteral, mucosal (e.g. buccal, sublingual, nasal), rectal or transdermal administration.
  • the viral vector and/or immunogenic composition may be administered to an isolated host cell or sample from a subject by contacting the cell(s) with the viral vector or immunogenic composition in vitro under conditions that facilitate the transduction of the host cell with the viral vector.
  • the viral vector and immunogenic composition of the present invention are not limited to the delivery of nucleic acid sequences encoding antigens.
  • Many diseases, including cancer, are associated with one or more deleterious mutant alleles in a patient's genome.
  • Gene therapy is a process involving the insertion of genes into the patient's cells or tissues to replace the deleterious mutant or non-functional allele(s) with 'normal' or functional allele(s).
  • a functional allele is inserted into a non-specific location within the genome to replace the non-functional allele.
  • the non-functional allele may be swapped for the functional allele through homologous recombination. Subsequent expression of the functional allele within the target cell restores the target cell to a normal state and thus provides a treatment for the disease.
  • the 'normal' or functional allele(s) may be inserted into a patient's genome using a viral vector.
  • the present invention therefore also provides the use of the viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention in gene therapy.
  • This method preferably comprises the step of administering to said animal a viral vector according to the second aspect of the present invention or the immunogenic composition according to the third aspect of the present invention.
  • the vector of the present invention may comprise an exogeneous nucleotide sequence encoding the functional or 'normal' protein, the non-functional or 'mutant' version of which is associated with a disease or condition.
  • the target cell is a somatic cell.
  • the subject to be treated is preferably mammalian. Preferred mammals include chickens, other poultry, cows, sheep, goats, pigs, wild boar, buffalo, bison, horses, camelids, deer, elephants, badgers, possums, cats, lions, monkeys and humans.
  • a fifth aspect of the present invention provides a polynucleotide sequence encoding the viral vector according to the second aspect of the present invention.
  • the polynucleotide sequence comprises the sequence of SEQ ID NO. 38 or a sequence substantially identical thereto.
  • the polynucleotide may additionally comprise the exogeneous nucleotide sequence of interest.
  • a sixth aspect of the present invention provides a host cell transduced or infected with the viral vector according to the second aspect of the present invention. Following transduction or infection, the host cell will express the exogeneous nucleotide sequence in the nucleic acid molecule to produce the molecule of interest, in addition to any other adenoviral proteins encoded by the nucleic acid molecule. Preferably, the host cell is stably transduced and suitable for viral propagation.
  • the host cell may be an isolated host cell, part of a tissue sample from an organism, or part of a multicellular organism or organ or tissue thereof.
  • the host cell is a somatic cell.
  • the host cell is not a stem cell, more particularly an embryonic stem cell, more particularly a human embryonic stem cell.
  • the host cell may be selected from the group consisting of an antigen-presenting dendritic cell, langerhans cell, macrophage, B cell, lymphocyte, leukocyte, myocyte and fibroblast.
  • the host cell is an animal cell, more preferably a mammalian cell.
  • Preferred mammals include chickens, other poultry, cows, sheep, goats, pigs, wild boar, buffalo, bison, horses, camelids, deer, elephants, badgers, possums, cats, lions, monkeys and humans.
  • the fifth aspect of the present invention also encompasses an animal transduced or infected with the viral vector according to the second aspect of the present invention.
  • the animal comprises one or more cells transformed or transfected with the viral vector according to the second aspect of the present invention.
  • the animal is a mammal.
  • Preferred mammals include chickens, other poultry, cows, sheep, goats, pigs, wild boar, buffalo, bison, horses, camelids, deer, elephants, badgers, possums, cats, lions, monkeys and humans.
  • the present invention provides a method of producing the viral vector according to the second aspect of the present invention.
  • the method comprises the step of incorporating a nucleotide sequence derived from AdY25 into a Bacterial Artificial Chromosome (BAC) to produce an Ad-BAC vector.
  • BAC Bacterial Artificial Chromosome
  • BACs are present within E. Coli in single copy conferring increased genetic stability.
  • the single copy BAC vectors permit very precise modifications to be made to the viral genome by recombineering (recombination mediated genetic engineering).
  • incorporation of the nucleotide sequence derived from AdY25 into a Bacterial Artificial Chromosome comprises the steps of: constructing a BAC rescue vector comprising regions of homology to the left and right flanks of the viral nucleotide sequence;
  • the nucleotide sequence incorporated into the BAC rescue vector comprises the sequence of SEQ ID NO. 1 or SEQ ID NO. 38 or a sequence substantially identical thereto.
  • the method additionally comprises the step of further modifying the Ad- BAC vector genome.
  • further modifications may be carried out by GalK recombineering. This technique, pioneered by Saren Warming and colleagues, utilises the GalK gene for both positive and negative selection of recombinant clones .
  • SW102 E. Coli cells, in which recombination may be performed have been specifically engineered to lack the GalK gene which is required for the utilisation of galactose as the sole carbon source.
  • Gene deletion is performed by recombination between the vector genome and a PCR amplified GalK cassette, flanked by 50bp regions of homology either side of the gene targeted for deletion.
  • Selection on mimimal media containing only galactose should ensure that only recombinants containing the GalK gene (in place of the target gene) should grow.
  • Replacement of GalK with a different gene sequence can be performed in a similar fashion, this time using GalK for negative selection.
  • the addition of 2-deoxygalactose (DOG) to selection media will select clones in which GalK has been replaced since the product of GalK, galactokinase, metabolises DOG into a product that is highly toxic to E. Coli.
  • the host cell is BJ5183 E. Coli for steps i) to iii) above and SW102 for further modifications.
  • an extra homology flank is included downstream of the adenovirus El region to enable simultaneous deletion of El, as described in Example 1.
  • the method further includes deletion of the E3 region of the Ad-BAC vector genome.
  • Deletion of the E3 region may be carried out by GalK recombineering, as described in Example 2.
  • the method further includes modifying the E4 region to optimise vector growth and yield.
  • the entire native E4 locus is replaced with the E40rf6 gene from AdHu5.
  • the native E4 locus is replaced with E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5, and the E40rfl , E40rf 2 and E40rf 3 coding regions from AdY25, as described in Example 3.
  • the method further includes introducing phage lambda site specific recombination sites attRl and attR2 at the Ad El locus as part of an Invitrogen Gateway ® destination cassette.
  • phage lambda site specific recombination sites attRl and attR2 at the Ad El locus as part of an Invitrogen Gateway ® destination cassette.
  • Such a modification enables the efficient directional insertion of vaccine transgenes.
  • Transgenes could also be inserted by recombineering, In-Fusion ® , conventional ligation or gap repair.
  • An eighth aspect of the present invention provides a Bacterial Artificial Chromosome (BAC) clone comprising a polynucleotide sequence encoding the viral vector according to the second aspect of the present invention.
  • BAC Bacterial Artificial Chromosome
  • the BAC clone comprises:
  • the viral vector according to the second aspect of the present invention may be replicated in a transformed cell line or helper virus (gutless vector system) which, if necessary, comprises the complement of any genes deleted from the virus.
  • genes may be deleted from the virus in order to hinder replication in host cells, but are of course required in order to replicate the viral vector to produce immunogenic compositions according to the second aspect of the present invention.
  • the present invention provides host cells comprising a Bacterial Artificial
  • Chromosome in accordance with the eighth aspect of the present invention, and suitable for propagation thereof.
  • host cells are bacteria, most preferably E.coli.
  • E.coli E.coli strains DH10B and SW102 9 .
  • a ninth aspect of the present invention therefore provides a packaging cell or cell line producing or capable of producing the viral vector according to the second aspect of the present invention.
  • the packaging cell or cell line comprises one or more nucleotide sequences which encode the viral vector of the second aspect of the present invention. Expression of these sequences results in the production of the viral vector.
  • Some of the required genes may be provided by infection of the cell or cell line with a viral vector according to the second aspect.
  • the cell comprises the complement of any genes deleted or functionally deleted from the viral vector.
  • the cell comprises the complement of the AdY25 El gene.
  • the cell is an HEK293 cell or a PER.C6 ® cell.
  • modification of the E4 locus of the adenoviral vector to include the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5 increased the rate of hexon production, increasing the sensitivity of anti-hexon titre to allow quantification of the infectious titre of the viral vector, in particular those viral vectors developed for clinical use which do not contain a fluorescent marker gene.
  • this modification was surprisingly found to increase the yield and rate of growth of the vector.
  • One of skill in the art would appreciate that such a modification is expected to have a beneficial effect on a wide variety of adenoviruses, and not simply those derived from AdY25.
  • a tenth aspect of the present invention therefore provides an adenoviral vector other than AdHu5 comprising a nucleic acid molecule, wherein said nucleic acid molecule comprises heterologous E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • said native E4 locus is deleted and replaced with heterologous E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • nucleic acid molecule may comprise the native coding regions in addition to heterologous E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5.
  • the native coding regions are E40rfl, E40rf2 and E40rf3.
  • Preferred adenoviral vectors are selected from the group consisting of AdY25 and AdY68.
  • the adenoviral vector according to the tenth aspect lacks and El and an E3 locus.
  • E. coli strain SW102 9 (a derivative of DH10B) containing bacterial artificial chromosomes (BACs) containing the cloned genome of AdChOXl (pBACe3.6 AdChOxl (E4 modified) TIPeGFP, cell line name "AdChOxl (E4 modified) TIPeGFP"
  • BACs bacterial artificial chromosomes
  • pBACe3.6 AdChOxl (E4 modified) TIPeGFP, cell line name "AdChOxl (E4 modified) TIPeGFP” was deposited by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Cultures (ECACC) at the Health Protection Agency Culture Collections, Health Protection Agency, Porton Down, Salisbury SP4 OJG, United Kingdom under the Budapest Treaty and designated by provisional accession no. 12052403.
  • the vector AdChOxl is derived from chimpanzee adenovirus Y25, with deletion of El region, E3 region, modification of E4 region and insertion of TIPeGFP model antigen into El locus.
  • the E. coli containing the BAC is a class I genetically modified organism.
  • the BAC propagates within the bacteria during replication and can be maintained by selection with chloramphenicol.
  • the E. coli strain SW102 containing the bacterial artificial chromosomes into which the genomes are cloned can be propagated in Luria-Bertani broth or agar containing 12 ⁇ g/mL chloramphenicol at 32°C.
  • the genome may be modified by genetic engineering in E. coli according to standard methods, as described in the specification, e.g. to insert an alternative recombinant antigen in place of TIPeGFP.
  • Converting the BAC clones of the viral genomes into viruses can be carried out by the following steps.
  • the E. coli host is propagated and the BAC DNA is purified from the bacteria according to standard methods.
  • the DNA is linearised with the restriction endonuclease Pmel and transfected into HEK293 cells (or a similar El complementing cell line).
  • the resulting adenovirus can then be propagated and purified for use as a vaccine, for example. All of these reagents and cells are publicly available. If the deposition were rescued, the resulting virus would be a class I genetically modified organism.
  • a specific embodiment of the fifth aspect of the present invention provides a polynucleotide sequence encoding an adenoviral vector according to the second aspect of the present invention, wherein said polynucleotide sequence comprises or consists of the polynucleotide sequence of the viral vector AdChOXl, deposited in a BAC contained in E.coli strain SW102 9 by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Cultures (ECACC) at the Health Protection Agency Culture Collections, Health Protection Agency, Porton Down, Salisbury SP4 OJG, United Kingdom under the Budapest Treaty and designated by provisional accession no.12052403.
  • the deposited BAC additionally comprises a transgene encoding the antigen TIPeGFP.
  • the polynucleotide sequence comprises or consists of the polynucleotide sequence of the viral vector AdChOXl, deposited in a BAC contained in E.coli strain SW102 9 by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Culture
  • polynucleotide sequence for AdChOXl preferably does not include the sequence encoding the TIPeGFP antigen.
  • a further embodiment of the present invention provides a host cell transduced with the viral vector according to the second aspect of the present invention, wherein said host cell is preferably a bacterium, more preferably E.coli strain SW102 9 containing a bacterial artificial chromosome (BAC) containing the cloned genome of AdChOXl deposited by Isis Innovation Limited on 24 May 2012 with the European Collection of Cell Cultures (ECACC) at the Health Protection Agency Culture Collections, Health Protection Agency, Porton Down, Salisbury SP4 OJG, United Kingdom under the Budapest Treaty and designated by provisional accession no.12052403.
  • the deposited BAC additionally comprises a transgene encoding the antigen TIPeGFP.
  • the polynucleotide sequence for AdChOXl preferably does not include the sequence encoding the TIPeGFP antigen.
  • Such a host cell may be used for BAC propagation.
  • a specific embodiment of the seventh aspect of the present invention provides a method of producing the viral vector according to the second aspect of the present invention by generating a molecular clone of AdY25 in a Bacterial Artificial
  • BAC Chromosome
  • the deposited BAC additionally comprises a transgene encoding the antigen TIPeGFP.
  • the polynucleotide sequence for AdChOXl preferably does not include the sequence encoding the TIPeGFP antigen.
  • a specific embodiment of the eighth aspect of the present invention provides a Bacterial Artificial Chromosome (BAC) clone comprising the polynucleotide sequence according to the fifth aspect of the present invention, wherein said BAC is the BAC containing the cloned genome of AdChOXl, deposited in E.coli strain
  • the deposited BAC additionally comprises a transgene encoding the antigen TIPeGFP.
  • the polynucleotide sequence for AdChOXl preferably does not include the sequence encoding the TIPeGFP antigen.
  • Example 1 Generation of a molecular clone of AdY25 in a Bacterial Artificial Chromosome
  • Wild type chimpanzee adenovirus AdY25 was obtained from Goran Wadell of Umea University, Sweden. The virus was propagated to high titer in HEK293 cells and the viral DNA phenol extracted and sequenced. The nucleotide sequence of the wild type AdY25 virus is found in SEQ ID NO. 1. Based on the sequencing data, a BAC 'rescue vector' was constructed containing regions of homology to the left and right flanks of the viral genome (homology flanks were PCR amplified from viral DNA). Homologous recombination was then performed in BJ5183 E. Coli cells between viral DNA and the linearised rescue vector to incorporate the viral genome crizo the BAC vector.
  • Phage lambda site specific recombination sites attRl and attR2 were introduced at the Ad El locus as part of an Invitrogen Gateway ® destination cassette to enable the efficient directional insertion of vaccine transgenes.
  • a modified destination cassette was ligated into the ⁇ s/SI restriction site introduced at the El locus during isolation of the genomic clone.
  • the resulting ⁇ 1 Ad-BAC vector was screened by both PCR and restriction digest before replication incompetent clones were transfected into El complementing HEK293 cells, where the new vector demonstrated the ability to produce infectious virions capable of replication and cytopathic effect in HEK293 cells.
  • Example 2 Deletion of the adenoviral E3 region
  • the ⁇ 1 Ad-BAC vector genome produced in accordance with Example 1 was further modified using GalK recombineering to delete the adenoviral E3 region and thus increase the insert capacity of the new vector by approximately 5kb.
  • the E3 region was deleted by recombination between the vector genome and a PCR amplified GalK cassette, flanked by 50bp regions of homology either side of the E3 gene. Recombination was performed in SW102 E. coli cells, which have been specifically engineered to lack the GalK gene which is required for the utilisation of galactose as the sole carbon source. Recombinant cells were selected using mimimal media containing only galactose, in which only recombinants containing the GalK gene in place of the E3 locus were able to grow 6 .
  • Example 3 Modification of the E4 region and effects thereof i) Modification of E4 region
  • the E4 locus of the ⁇ ⁇ 3 Ad-BAC vector genome produced in accordance with Example 2 was then modified.
  • the E4 region was deleted by recombination in SW102 E. Coli cells between the vector genome and a PCR-amplified GalK cassette, flanked by 50bp regions of homology either side of the E4 gene.
  • Recombinant cells were selected using mimimal media containing only galactose.
  • the GalK gene was then replaced with the required E4 open reading frames from AdHu5 and AdY25 in a similar manner to provide the 5 constructs listed in Figure 3C.
  • Recombinant cells comprising the gene in place of the GalK gene were then selected using media comprising 2-deoxygalactose (DOG) 6 .
  • DOG 2-deoxygalactose
  • HEK293 cells were infected with the following viral vectors at a multiplicity of infention of 9 and incubated at 37°C for 48 hours before harvesting: i) AdHu5 ("Ad5")
  • AdChOXl AdY25 E4 AdHu5 E40rf 4, 6, 6/7
  • Infectious titre of the harvested material was measured by quantifying GFP positive foci 48 hours post infection.
  • the infectious titre of the AdY25-based viral vector comprising the wildtype E4 locus was significantly lower than that of AdHu5.
  • Modification of the viral vector to replace the wildtype E4 locus with the E40rf6 gene from AdHu5 signficantly increased the infectious titre.
  • Replacement of the wildtype E4 locus with the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5 signficantly increased the infectious titre.
  • Replacement of the wildtype E4 locus with the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5 and the E40rfl, E40rf2 and E40rf3 coding regions from AdY25 (to create ChAdOXl) surprisingly further increased the infectious titre.
  • An anti-hexon immunostaining assay has now been developed that enables visualisation of infected cells in which the viral hexon protein is being expressed.
  • This assay uses a polyclonal anti-hexon antibody so can be used to titer virtually any adenovirus vaccine vector and we have found the assay to be reliable and consistent for both AdHu5 and AdCh63 based vectors. It does of course rely on the assumption that the rate of hexon production relative to transgene expression is consistent between vectors.
  • the titers of GFP-expressing AdY25-derived viral vectors were compared by GFP and anti-hexon based assays. Titers were assessed at 48 hours post infection for AdHu5, AdC63, AdY25 E4 wildtype, and constructs A - E as described in Figure 3C, all expressing the TIPeGFP antigen.
  • TIP is essentially an epitope string consisting of a number of strong murine T cell epitopes including Pb9 (a dominant CD8+ epitope from malarial antigen PbCSP) and PI 5 (a strong CD4+ epitope from M. tuberculosis antigen 85 A).
  • Pb9 a dominant CD8+ epitope from malarial antigen PbCSP
  • PI 5 a strong CD4+ epitope from M. tuberculosis antigen 85 A.
  • the TIP epitope string is fused to the 5' end of eGFP which enables transgene expression to be visualised directly and simplifies vaccine titration.
  • Figure 3B illustrates the ratio of GFP foci to anti-hexon titer.
  • GFP titers were approximately twice as sensitive as anti-hexon titers.
  • the sensitivity of the anti-hexon assay varied considerably with E4 modification.
  • anti-hexon titers were over 40 fold less sensitive than GFP titers after 48hrs, suggesting that the rate of hexon production is considerably slower than for AdHu5 and AdCh63 vectors. This was to be expected, given the poor yield of AdY25 E4 wildtype vector.
  • construct A (Y25Ad5E40rf6) was still 30 fold less sensitive by anti-hexon than by GFP.
  • construct E (“ChAdOXl”), in which the wildtype E4 locus was replaced with the E40rf4, E40rf6 and E40rf6/7 coding regions from AdHu5, and the E40rfl, E40rf2 and E40rf3 coding regions from AdY25.
  • the ratio of marker gene to hexon titre for ChAdOXl viral vectors expressing TIPeGFP was measured using GFP and mCherry fluorescent transgenes in order to control for the sensitivity of the fluorescent detection. The results are provided in Figure 3D. In both cases, the marker generhexon titre ratio was approximately twofold, and thus the particular marker gene used did not affect the resulting marker gene:hexon titre ratio.
  • the marker gene:hexon titre ratio for the ChAdOXl vector is the same as that for HAdV-5, indicating that the E4 modification to the ChAdOXl vector has been optimised.
  • mice (4/group) were immunised intramuscularly with 10 9 infectious units (ifu) of each of the following viral vectors, all expressing the TIPeGFP antigen: i) AdCh63;
  • SEAP Secreted Placental Alkaline Phosphatase.
  • Recombinant adenoviruses were incubated with five serial dilutions of serum in FBS-DMEM before infection. The final serum dilutions were 1 : 18, 1 :72, 1 :288, 1 :1 152, 1 :4608; each serum sample was tested in duplicate.
  • Supernatants were collected and assayed for SEAP concentration using CSPD (Tropix) according to the manufacturer's instructions. Luminescence intensity was measured using a Varioskan flash luminometer (Thermo Scientific).
  • Neutralization titers were defined as the serum dilution required to reduce SEAP concentration by 50% compared to wells infected with virus alone. Neutralization titer was calculated by linear interpolation of adjacent values.
  • Example 7 Humoral immunogenicity of AdY25-based vectors Balb/c mice (6/group) were immunised with 10 8 infectious units of either of the following vectors, both expressing TIPeGFP: i) ⁇ ⁇ 3 AdCh68; or
  • mice After 56 days post prime, mice were boosted with 10 6 pfu MVA-TIPeGFP. Serum was collected 50days post-prime and 10 days post-boost to compare pre- and post- boost anti-GFP antibody responses. Responses were measured by endpoint ELISA. Statistical analyses were performed by one way ANOVA.
  • a transgene encoding the Mycobacterium tuberculosis protein Ag85A was inserted into the El locus of ChAdOXl under control of the human cytomegalovirus immediate early promoter, using the BAC technology as described in Example 1.
  • the nucleotide sequence of the transgene (SEQ ID NO. 42) encodes residues 1 to 323 of the antigen, encoded by a sequence optimised to human codon usage (nucleotides 103 to 1071), fused at the N-terminus to tPA (the signal peptide from human tissue plasminogen activator)(nucleotides 1 to 102) and at the C-terminus to a PK tag (nucleotides 1072 to 1 104).
  • the amino acid sequence of the Ag85A antigen is provided in SEQ ID N0.43.
  • the BAC clone was transfected into HEK293 cells and the virus vector was amplified, purified and titred using the anti-hexon immunostaining assay described in Example 3. '
  • the immunogenicity of the vector was assessed in Balb/c mice immunized with varying doses, expressed in infectious units, of the vaccine, administered
  • a transgene encoding the nucleoprotein (NP) and matrix protein 1 (Ml) of influenza A virus was inserted into the El locus of ChAdOXl under control of the human cytomegalovirus major immediate early promoter, using the BAC technology as described in Example 1.
  • the nucleotide sequence of the transgene (SEQ ID NO. 46) encodes the influenza A nucleoprotein (nucleotides 1 to 1494) fused to the matrix protein 1 (nucleotides 1516 to 2274) and separated by a linker (nucleotides 1495 to 1515).
  • the amino acid sequence of the NPM1 fusion protein is provided in SEQ ID NO. 47.
  • the BAC clone was transfected into HEK293 cells and the virus vector was amplified, purified and titred using the anti-hexon immunostaining assay described in Example 3.
  • a similar vector based on human adenovirus type 5 (HAdV-5) was similarly generated and titred for comparative purposes.
  • the immunogenicity of the vector was assessed in Balb/c mice immunized with varying doses, expressed in infectious units, of the vaccine, administered
  • ChAdOXl -NPM1 vaccine has recently been produced for human clinical trials according to current good manufacturing practice at the University of Oxford Clinical Biomanufacturing Facility. This indicates the suitability of the vector for deployment as a medical product. References
  • MVLPALPAPPVCDSQNECVGWLGVAYSAVVDVIRAAAHEGVYIEPEARGRLDALREWIYYN YYTERSKRRDRRRRSVCHARTWFCFRKYDYVRRSIWHDTTTNTISVVSAHSVQ SEP ID NO. 42 (.Mycobacterium tuberculosis protein Ag85A - nucleic acid sequence
  • SEP ID NO. 43 Mycobacterium tuberculosis protein Ag85A -amino acid sequence
  • SEP ID NO. 44 synthetic peptide corresponding to the known immunodominant CD8+ T cell H-2 d restricted epitopes in Ag85A - pi 1
  • WYDQSGLSV SEQ ID NO. 45 synthetic peptide corresponding to the known immunodominant CD4 + T cell H-2 d restricted epitopes in Ag85A - pi 5
  • SEQ ID NO. 46 nucleoprotein (NP) and matrix protein 1 (Ml) of influenza A virus - nucleic acid sequence
  • SEQ ID NO. 47 (nucleoprotein (NP) and matrix protein 1 (Ml) of influenza A virus ammo acid sequence)
  • SEP ID NO. 48 immunodominant CD8 + T cell H-2 d restricted epitope in NP

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Developmental Biology & Embryology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Reproductive Health (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/GB2012/000467 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors Ceased WO2012172277A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
CN201280036659.1A CN103930551B (zh) 2011-05-25 2012-05-25 猴腺病毒和杂合腺病毒载体
BR112013030222A BR112013030222A2 (pt) 2011-05-25 2012-05-25 vetor
CA2837274A CA2837274C (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
SG2013087747A SG195181A1 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
ES12723726.1T ES2659183T3 (es) 2011-05-25 2012-05-25 Adenovirus símico y vectores adenovirales híbridos
US14/119,413 US9714435B2 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
EP17204780.5A EP3321367B1 (en) 2011-05-25 2012-05-25 Hybrid adenoviral vectors
AU2012270144A AU2012270144B2 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
NO12723726A NO2714916T3 (enExample) 2011-05-25 2012-05-25
JP2014511948A JP6230527B2 (ja) 2011-05-25 2012-05-25 サルアデノウイルス及び雑種アデノウイルスベクター
DK12723726.1T DK2714916T3 (en) 2011-05-25 2012-05-25 ABEADENOVIRUS AND HYBRID ADENOVIRUS VECTORS
EP12723726.1A EP2714916B1 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
RU2013152648/10A RU2013152648A (ru) 2011-05-25 2012-05-25 Аденовирус обезьян и гибридные аденовирусные векторы
ZA2013/09016A ZA201309016B (en) 2011-05-25 2013-12-02 Simian adenovirus and hybrid adenoviral vectors
US15/628,277 US10646587B2 (en) 2011-05-25 2017-06-20 Simian adenovirus and hybrid adenoviral vectors
US16/849,301 US11857640B2 (en) 2011-05-25 2020-04-15 Simian adenovirus and hybrid adenoviral vectors
FR21C1026C FR21C1026I1 (fr) 2011-05-25 2021-06-28 Adenovirus simien et vecteurs adenoviraux hybrides
NO2021028C NO2021028I1 (no) 2011-05-25 2021-07-07 Chimpanzee Adenovirus encoding the SARS-CoV-2 Spike glycoprotein ChAdOx1-S
US18/511,357 US20240181078A1 (en) 2011-05-25 2023-11-16 Simian Adenovirus and Hybrid Adenoviral Vectors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1108879.6 2011-05-25
GBGB1108879.6A GB201108879D0 (en) 2011-05-25 2011-05-25 Vector

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/119,413 A-371-Of-International US9714435B2 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors
US15/628,277 Continuation US10646587B2 (en) 2011-05-25 2017-06-20 Simian adenovirus and hybrid adenoviral vectors

Publications (2)

Publication Number Publication Date
WO2012172277A1 true WO2012172277A1 (en) 2012-12-20
WO2012172277A4 WO2012172277A4 (en) 2013-04-04

Family

ID=44279666

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2012/000467 Ceased WO2012172277A1 (en) 2011-05-25 2012-05-25 Simian adenovirus and hybrid adenoviral vectors

Country Status (16)

Country Link
US (4) US9714435B2 (enExample)
EP (2) EP2714916B1 (enExample)
JP (1) JP6230527B2 (enExample)
CN (1) CN103930551B (enExample)
AU (1) AU2012270144B2 (enExample)
BR (1) BR112013030222A2 (enExample)
CA (1) CA2837274C (enExample)
DK (1) DK2714916T3 (enExample)
ES (1) ES2659183T3 (enExample)
FR (1) FR21C1026I1 (enExample)
GB (1) GB201108879D0 (enExample)
NO (2) NO2714916T3 (enExample)
RU (1) RU2013152648A (enExample)
SG (2) SG195181A1 (enExample)
WO (1) WO2012172277A1 (enExample)
ZA (1) ZA201309016B (enExample)

Cited By (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2015519058A (ja) * 2012-05-18 2015-07-09 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 亜科eサルアデノウイルスa1302、a1320、a1331及びa1337ならびにそれらの使用
GB2549809A (en) * 2016-06-23 2017-11-01 Univ Oxford Innovation Ltd Vector
WO2018167486A1 (en) 2017-03-15 2018-09-20 Oxford Biomedica (Uk) Limited Method
WO2018215766A1 (en) 2017-05-26 2018-11-29 Oxford University Innovation Limited Compositions and methods for inducing an immune response
WO2020025642A1 (en) 2018-08-03 2020-02-06 Ludwig Institute For Cancer Research Ltd. Viral vectors encoding cancer/testis antigens for use in a method of prevention or treatment of cancer
WO2020074908A2 (en) 2018-10-10 2020-04-16 Oxford University Innovation Limited Treatment and prevention of malaria
WO2020095038A1 (en) 2018-11-06 2020-05-14 Oxford University Innovation Limited Compositions and methods
GB202019455D0 (en) 2020-12-10 2021-01-27 Chancellor Masters And Scholars Of The Univ Of Oxford Method for producing virus
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
US11096999B2 (en) 2014-07-30 2021-08-24 Oxford University Innovation Limited Treatment and prevention of malaria
WO2021165667A1 (en) 2020-02-17 2021-08-26 Vaxbio Ltd 2019-ncov (sars-cov-2) vaccine
WO2021181100A1 (en) 2020-03-13 2021-09-16 Oxford University Innovation Limited Compositions and methods for inducing an immune response
WO2021181121A1 (en) 2020-03-12 2021-09-16 Oxford University Innovation Limtied Stabilised viral fusion proteins
WO2021228842A1 (en) 2020-05-11 2021-11-18 Janssen Pharmaceuticals, Inc. Stabilized coronavirus spike protein fusion proteins
WO2022002894A1 (en) 2020-06-29 2022-01-06 Janssen Vaccines & Prevention B.V. Vaccine combination against respiratory syncytial virus infection
WO2022009121A1 (en) 2020-07-07 2022-01-13 Spicona Inc. Sars-cov-2 and influenza combination vaccine
WO2022008438A1 (en) 2020-07-06 2022-01-13 Janssen Pharmaceuticals, Inc. Stabilized corona virus spike protein fusion proteins
WO2022058700A1 (en) 2020-09-15 2022-03-24 Imperial College Innovations Limited Treatment of idiopathic pulmonary fibrosis
WO2022084663A1 (en) 2020-10-20 2022-04-28 The Chancellor, Masters And Scholars Of The University Of Oxford Compositions and methods for inducing an immune response
WO2022096901A1 (en) 2020-11-09 2022-05-12 Imperial College Innovations Limited Treatment of pulmonary arterial hypertension
WO2022123030A1 (en) 2020-12-10 2022-06-16 The Chancellor, Masters And Scholars Of The University Of Oxford Method for purifying virus
US11384122B2 (en) 2020-01-31 2022-07-12 Janssen Pharmaceuticals, Inc. Compositions and methods for preventing and treating coronavirus infection—SARS-CoV-2 vaccines
WO2022175477A1 (en) 2021-02-19 2022-08-25 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion rsv fb antigens
WO2022175479A1 (en) 2021-02-19 2022-08-25 Janssen Vaccines & Prevention B.V. Vaccine combinations against respiratory syncytial virus strain a and b infections
WO2022180007A1 (en) 2021-02-23 2022-09-01 Janssen Vaccines & Prevention B.V. Trimer stabilizing hiv envelope protein mutation
US11447566B2 (en) 2018-01-04 2022-09-20 Iconic Therapeutics, Inc. Anti-tissue factor antibodies, antibody-drug conjugates, and related methods
WO2022207839A2 (en) 2021-04-01 2022-10-06 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion piv3 f proteins
WO2022219333A1 (en) 2021-04-13 2022-10-20 Imperial College Innovations Limited Signal peptides
WO2022234283A1 (en) 2021-05-07 2022-11-10 Astrazeneca Uk Limited Compositions and methods for inducing an immune response
US11504421B2 (en) 2017-05-08 2022-11-22 Gritstone Bio, Inc. Alphavirus neoantigen vectors
EP4010017A4 (en) * 2020-04-23 2022-12-07 Fed. State Budgetary Institution "Nat. Res. Centre for Epidemiology and Microbiology named after the Honorary Academician N.F. Gamaleya" of the .... Immunobiological agent for inducing specific immunity against severe acute respiratory syndrome virus sars-cov-2
WO2023020939A1 (en) 2021-08-17 2023-02-23 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
US11591619B2 (en) 2019-05-30 2023-02-28 Gritstone Bio, Inc. Modified adenoviruses
WO2023026182A1 (en) 2021-08-24 2023-03-02 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
WO2023047349A1 (en) 2021-09-24 2023-03-30 Janssen Pharmaceuticals, Inc. Stabilized coronavirus spike protein fusion proteins
WO2023047348A1 (en) 2021-09-24 2023-03-30 Janssen Pharmaceuticals, Inc. Stabilized corona virus spike protein fusion proteins
WO2023105221A1 (en) 2021-12-07 2023-06-15 Vaccitech (Uk) Limited Vaccine boost methods and compositions
WO2023111725A1 (en) 2021-12-14 2023-06-22 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
WO2023110618A1 (en) 2021-12-16 2023-06-22 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion hmpv fusion proteins
WO2023156505A1 (en) 2022-02-17 2023-08-24 Janssen Vaccines & Prevention B.V. Trimer stabilizing hiv envelope protein mutations r304v, n302m and t320l
US11771747B2 (en) 2020-08-06 2023-10-03 Gritstone Bio, Inc. Multiepitope vaccine cassettes
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2024061757A1 (en) 2022-09-23 2024-03-28 Janssen Vaccines & Prevention B.V. Pre-fusion human piv1 f proteins
WO2024061759A1 (en) 2022-09-23 2024-03-28 Janssen Vaccines & Prevention B.V. Stabilized coronavirus s proteins
WO2024074584A1 (en) 2022-10-06 2024-04-11 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion piv3 f proteins
WO2024092028A2 (en) 2022-10-25 2024-05-02 Vaccitech North America, Inc. Combination treatment regimes for treating cancer
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
WO2024157026A2 (en) 2023-01-27 2024-08-02 Oxford University Innovation Limited Vaccine
WO2024184649A1 (en) 2023-03-07 2024-09-12 Imperial College Innovations Limited Synthetic promoters
WO2024213890A1 (en) 2023-04-14 2024-10-17 Imperial College Innovations Limited Oligonucleotide decoy
WO2024218165A1 (en) 2023-04-17 2024-10-24 Barinthus Biotherapeutics (Uk) Limited Hpv viral vector vaccine
WO2025052130A1 (en) 2023-09-05 2025-03-13 Oxford University Innovation Limited Monoclonal antibody directed to reticulocyte-binding protein homologue 5 (pfrh5)
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2025149656A1 (en) 2024-01-11 2025-07-17 Cancer Research Technology Ltd Treatment and prevention of lung cancer
WO2025168946A1 (en) 2024-02-09 2025-08-14 Oxford University Innovation Limited Pfrh5 immunogen

Families Citing this family (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201108879D0 (en) * 2011-05-25 2011-07-06 Isis Innovation Vector
CA2903582C (en) 2013-03-14 2021-06-08 Salk Institute For Biological Studies Oncolytic adenovirus compositions
BE1024420B1 (fr) * 2015-06-12 2018-02-19 Glaxosmithkline Biologicals Sa Polynucleotides et polypeptides d'adenovirus
WO2017147265A1 (en) 2016-02-23 2017-08-31 Salk Institute For Biological Studies High throughput assay for measuring adenovirus replication kinetics
JP7015551B2 (ja) 2016-02-23 2022-02-15 ソーク インスティテュート フォー バイオロジカル スタディーズ ウイルス動態への影響を最小限にするための治療用アデノウイルスにおける外因性遺伝子発現
CA3045892A1 (en) 2016-12-12 2018-06-21 Salk Institute For Biological Studies Tumor-targeting synthetic adenoviruses and uses thereof
CN106916851A (zh) * 2017-03-01 2017-07-04 广州恩宝生物医药科技有限公司 一种复制缺陷型人14型腺病毒载体及其制备方法和应用
AU2019251356B2 (en) 2018-04-09 2025-06-12 Salk Institute For Biological Studies Oncolytic adenovirus compositions with enhanced replication properties
GB201814141D0 (en) * 2018-08-30 2018-10-17 Univ Oxford Innovation Ltd Method and compositions for producing a virus
CN109797168A (zh) * 2018-09-28 2019-05-24 广州佰芮慷生物科技有限公司 一种重组腺病毒的表达载体SAd23-L
CN109602901B (zh) * 2019-01-08 2022-05-27 成都迈科康生物科技有限公司 一种带状疱疹病毒疫苗及其制备方法和应用
CA3141454A1 (en) 2019-05-22 2020-11-26 Aelix Therapeutics, S.L. Dosage regimens for vaccines
KR20220011685A (ko) * 2019-05-22 2022-01-28 길리애드 사이언시즈, 인코포레이티드 Tlr7 조절 화합물과 hiv 백신의 조합
AU2020384323A1 (en) 2019-11-14 2022-06-02 Aelix Therapeutics, S.L. Dosage regimens for vaccines
TWI867224B (zh) * 2020-06-08 2024-12-21 中央研究院 重組抗體或片段,以及其用途
MX2022002609A (es) * 2020-08-22 2022-06-08 Federal State Budgetary Institution National Res Centre For Epidemiology And Microbiology Named Afte Vector de expresion para el desarrollo de un agente inmunobiologico para inducir inmunidad especifica contra el virus de sindrome respiratorio agudo grave sars-cov-2 (variantes).
EP4255503A4 (en) * 2020-12-04 2025-08-06 COMPOSITIONS AND METHODS OF USE THEREOF
WO2024084441A1 (en) 2022-10-19 2024-04-25 Aelix Therapeutics, S.L. Combination hiv vaccine
WO2025017540A1 (en) 2023-07-20 2025-01-23 Aelix Therapeutics, S.L. Method of treatment of hiv infection with vaccine
CN117089577B (zh) * 2023-08-21 2024-06-25 暨南大学 重组的猴腺病毒、病毒载体及构建方法

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003046124A2 (en) * 2001-11-21 2003-06-05 The Trustees Of The University Of Pennsylvania Simian adenovirus nucleic acid and amino acid sequences, vectors containing same, and methods of use
US20040136963A1 (en) * 2001-06-22 2004-07-15 The Trustees Of The University Of Pennsylvania Simian adenovirus vectors and methods of use
WO2009073104A2 (en) * 2007-11-28 2009-06-11 The Trustees Of The University Of Pennsylvania Simian e adenoviruses sadv-39, -25. 2, -26, -30, -37, and -38

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3650939A (en) 1964-11-12 1972-03-21 Ppg Industries Inc Alkali chlorine cell
CA2271450A1 (en) 1999-05-12 2000-11-12 Stuart Energy Systems Inc. Hydrogen fuel replenishment process and apparatus
US20070205342A1 (en) 2002-01-23 2007-09-06 Edward Gabriel Slip drive for leveling devices
US7481858B2 (en) 2005-02-25 2009-01-27 Societe Bic Hydrogen generating fuel cell cartridges
PL1711518T3 (pl) * 2004-01-23 2010-06-30 St Di Richerche Di Biologia Molecolare P Angeletti S P A Nośniki szczepionek pochodzące od szympansich adenowirusów
US7617018B2 (en) 2004-10-18 2009-11-10 Innovative Design Solutions Platform attitude adjustment augmentation method and apparatus
US7178337B2 (en) 2004-12-23 2007-02-20 Tassilo Pflanz Power plant system for utilizing the heat energy of geothermal reservoirs
CN100578676C (zh) * 2005-01-12 2010-01-06 明基电通股份有限公司 可调式升降支撑装置
WO2007104792A2 (en) * 2006-03-16 2007-09-20 Crucell Holland B.V. Recombinant adenoviruses based on serotype 26 and 48, and use thereof
EP1998804B1 (en) * 2006-03-27 2014-04-16 Crucell Holland B.V. Compositions comprising a recombinant adenovirus and an adjuvant
EP2152889B1 (en) * 2007-05-29 2017-03-15 Nature Technology Corporation Vectors and methods for genetic immunization
CA2754906C (en) * 2009-03-10 2021-02-09 Baylor Research Institute Antigen presenting cell targeted fusion proteins comprising a linker for increased stability
GB201108879D0 (en) * 2011-05-25 2011-07-06 Isis Innovation Vector

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040136963A1 (en) * 2001-06-22 2004-07-15 The Trustees Of The University Of Pennsylvania Simian adenovirus vectors and methods of use
WO2003046124A2 (en) * 2001-11-21 2003-06-05 The Trustees Of The University Of Pennsylvania Simian adenovirus nucleic acid and amino acid sequences, vectors containing same, and methods of use
WO2009073104A2 (en) * 2007-11-28 2009-06-11 The Trustees Of The University Of Pennsylvania Simian e adenoviruses sadv-39, -25. 2, -26, -30, -37, and -38

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
BUCHBINDER ET AL., LANCET, vol. 372, November 2008 (2008-11-01)
DATABASE EMBL [Online] 28 November 2001 (2001-11-28), "Simian adenovirus 25, complete genome.", XP002682896, retrieved from EBI accession no. EMBL:AF394196 Database accession no. AF394196 *
DUDAREVA ET AL., VACCINE, vol. 27, 2009, pages 3501 - 3504
FARINA ET AL., J. VIROL, December 2001 (2001-12-01), pages 11603 - 11613
HAVENGA ET AL., J.G.V., vol. 87, 2006, pages 2135 - 214
HILLIS ET AL: "Serologic classification of chimpanzee adenoviruses by hemagglutination and hemagglutination inhibition.", THE JOURNAL OF IMMUNOLOGY, vol. 103, no. 5, 1 November 1969 (1969-11-01), pages 1089 - 1095, XP055037310, ISSN: 0022-1767 *
MATTHEW D. J. DICKS ET AL: "A Novel Chimpanzee Adenovirus Vector with Low Human Seroprevalence: Improved Systems for Vector Derivation and Comparative Immunogenicity", PLOS ONE, vol. 7, no. 7, 1 January 2012 (2012-01-01), pages e40385 - e40385, XP055037313, ISSN: 1932-6203, DOI: 10.1371/journal.pone.0040385 *
R. WIGAND ET AL., INTERVIROLOGY, vol. 130, 1989, pages 1
ROY ET AL., HUM. GEN. THER., vol. 15, 2004, pages 519 - 530
WARMING ET AL., NUC. ACID. RES, vol. 133, 2005, pages 4
WARMING, S. ET AL., NUCLEIC ACIDS RES, vol. 33, no. 4, 24 February 2005 (2005-02-24), pages E36

Cited By (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2015519058A (ja) * 2012-05-18 2015-07-09 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 亜科eサルアデノウイルスa1302、a1320、a1331及びa1337ならびにそれらの使用
US11096999B2 (en) 2014-07-30 2021-08-24 Oxford University Innovation Limited Treatment and prevention of malaria
CN109790548B (zh) * 2016-06-23 2024-03-22 牛津大学创新有限公司 腺病毒载体
US11970709B2 (en) 2016-06-23 2024-04-30 Oxford University Innovation Limited Adenoviral vector
EP3943604A1 (en) 2016-06-23 2022-01-26 Oxford University Innovation Limited Adenoviral vector
KR20190020131A (ko) * 2016-06-23 2019-02-27 옥스포드 유니버시티 이노베이션 리미티드 아데노바이러스 벡터
GB2549809B (en) * 2016-06-23 2019-04-03 Univ Oxford Innovation Ltd Vector
CN109790548A (zh) * 2016-06-23 2019-05-21 牛津大学创新有限公司 腺病毒载体
AU2017282102B2 (en) * 2016-06-23 2023-03-23 Oxford University Innovation Limited Adenoviral vector
GB2549809A (en) * 2016-06-23 2017-11-01 Univ Oxford Innovation Ltd Vector
US11306325B2 (en) 2016-06-23 2022-04-19 Oxford University Innovation Limited Adenoviral vector
KR102205908B1 (ko) 2016-06-23 2021-01-22 옥스포드 유니버시티 이노베이션 리미티드 아데노바이러스 벡터
US12365920B2 (en) 2016-06-23 2025-07-22 Oxford University Innovation Limited Adenoviral vector
WO2017221031A1 (en) * 2016-06-23 2017-12-28 Oxford University Innovation Limited Adenoviral vector
WO2018167486A1 (en) 2017-03-15 2018-09-20 Oxford Biomedica (Uk) Limited Method
US11427645B2 (en) 2017-03-15 2022-08-30 Oxford Biomedica (Uk) Limited 5T4-targeting agents and methods
US11504421B2 (en) 2017-05-08 2022-11-22 Gritstone Bio, Inc. Alphavirus neoantigen vectors
US11510973B2 (en) 2017-05-08 2022-11-29 Gritstone Bio, Inc. Alphavirus antigen vectors
US12109257B2 (en) 2017-05-08 2024-10-08 Gritstone Bio, Inc. Alphavirus neoantigen vectors
WO2018215766A1 (en) 2017-05-26 2018-11-29 Oxford University Innovation Limited Compositions and methods for inducing an immune response
US11447566B2 (en) 2018-01-04 2022-09-20 Iconic Therapeutics, Inc. Anti-tissue factor antibodies, antibody-drug conjugates, and related methods
US12215167B2 (en) 2018-01-04 2025-02-04 Iconic Therapeutics Llc Anti-tissue factor antibodies, antibody-drug conjugates, and related methods
JP2021532791A (ja) * 2018-08-03 2021-12-02 ラディック インスティテュート フォア キャンサー リサーチ リミテッドLudwig Institute For Cancer Research Ltd がんの予防または治療方法において使用するためのがん/精巣抗原をコードするウイルスベクター
WO2020025642A1 (en) 2018-08-03 2020-02-06 Ludwig Institute For Cancer Research Ltd. Viral vectors encoding cancer/testis antigens for use in a method of prevention or treatment of cancer
JP2024150469A (ja) * 2018-08-03 2024-10-23 ラディック インスティテュート フォア キャンサー リサーチ リミテッド がんの予防または治療方法において使用するためのがん/精巣抗原をコードするウイルスベクター
WO2020074908A2 (en) 2018-10-10 2020-04-16 Oxford University Innovation Limited Treatment and prevention of malaria
WO2020095038A1 (en) 2018-11-06 2020-05-14 Oxford University Innovation Limited Compositions and methods
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
US12098383B2 (en) 2019-05-30 2024-09-24 Gritstone Bio, Inc. Modified adenoviruses
US11591619B2 (en) 2019-05-30 2023-02-28 Gritstone Bio, Inc. Modified adenoviruses
EP4458975A2 (en) 2019-09-30 2024-11-06 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
US11384122B2 (en) 2020-01-31 2022-07-12 Janssen Pharmaceuticals, Inc. Compositions and methods for preventing and treating coronavirus infection—SARS-CoV-2 vaccines
US11498944B2 (en) 2020-01-31 2022-11-15 Janssen Pharmaceuticals, Inc. Compositions and methods for preventing and treating coronavirus infection—SARS-CoV-2 vaccines
WO2021165667A1 (en) 2020-02-17 2021-08-26 Vaxbio Ltd 2019-ncov (sars-cov-2) vaccine
WO2021181121A1 (en) 2020-03-12 2021-09-16 Oxford University Innovation Limtied Stabilised viral fusion proteins
WO2021181100A1 (en) 2020-03-13 2021-09-16 Oxford University Innovation Limited Compositions and methods for inducing an immune response
EP4010017A4 (en) * 2020-04-23 2022-12-07 Fed. State Budgetary Institution "Nat. Res. Centre for Epidemiology and Microbiology named after the Honorary Academician N.F. Gamaleya" of the .... Immunobiological agent for inducing specific immunity against severe acute respiratory syndrome virus sars-cov-2
IL290787B1 (en) * 2020-04-23 2024-08-01 Federal State Budgetary Institution National Res Centre For Epidemiology And Microbiology Named Afte Immunobiological agent and method of using it for inducing specific immunity against the severe respiratory syndrome virus SARS-CoV-2 (embodiment)
WO2021228842A1 (en) 2020-05-11 2021-11-18 Janssen Pharmaceuticals, Inc. Stabilized coronavirus spike protein fusion proteins
WO2022002894A1 (en) 2020-06-29 2022-01-06 Janssen Vaccines & Prevention B.V. Vaccine combination against respiratory syncytial virus infection
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2022008438A1 (en) 2020-07-06 2022-01-13 Janssen Pharmaceuticals, Inc. Stabilized corona virus spike protein fusion proteins
WO2022009121A1 (en) 2020-07-07 2022-01-13 Spicona Inc. Sars-cov-2 and influenza combination vaccine
US11771747B2 (en) 2020-08-06 2023-10-03 Gritstone Bio, Inc. Multiepitope vaccine cassettes
WO2022058700A1 (en) 2020-09-15 2022-03-24 Imperial College Innovations Limited Treatment of idiopathic pulmonary fibrosis
WO2022084663A1 (en) 2020-10-20 2022-04-28 The Chancellor, Masters And Scholars Of The University Of Oxford Compositions and methods for inducing an immune response
WO2022096901A1 (en) 2020-11-09 2022-05-12 Imperial College Innovations Limited Treatment of pulmonary arterial hypertension
WO2022123033A1 (en) 2020-12-10 2022-06-16 The Chancellor, Masters And Scholars Of The University Of Oxford Method for producing virus
WO2022123030A1 (en) 2020-12-10 2022-06-16 The Chancellor, Masters And Scholars Of The University Of Oxford Method for purifying virus
GB202019455D0 (en) 2020-12-10 2021-01-27 Chancellor Masters And Scholars Of The Univ Of Oxford Method for producing virus
WO2022175477A1 (en) 2021-02-19 2022-08-25 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion rsv fb antigens
WO2022175479A1 (en) 2021-02-19 2022-08-25 Janssen Vaccines & Prevention B.V. Vaccine combinations against respiratory syncytial virus strain a and b infections
WO2022180007A1 (en) 2021-02-23 2022-09-01 Janssen Vaccines & Prevention B.V. Trimer stabilizing hiv envelope protein mutation
WO2022207839A2 (en) 2021-04-01 2022-10-06 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion piv3 f proteins
WO2022219333A1 (en) 2021-04-13 2022-10-20 Imperial College Innovations Limited Signal peptides
WO2022234283A1 (en) 2021-05-07 2022-11-10 Astrazeneca Uk Limited Compositions and methods for inducing an immune response
WO2023020939A1 (en) 2021-08-17 2023-02-23 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
WO2023026182A1 (en) 2021-08-24 2023-03-02 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
WO2023047349A1 (en) 2021-09-24 2023-03-30 Janssen Pharmaceuticals, Inc. Stabilized coronavirus spike protein fusion proteins
WO2023047348A1 (en) 2021-09-24 2023-03-30 Janssen Pharmaceuticals, Inc. Stabilized corona virus spike protein fusion proteins
WO2023105221A1 (en) 2021-12-07 2023-06-15 Vaccitech (Uk) Limited Vaccine boost methods and compositions
WO2023111725A1 (en) 2021-12-14 2023-06-22 Janssen Pharmaceuticals, Inc. Sars-cov-2 vaccines
WO2023110618A1 (en) 2021-12-16 2023-06-22 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion hmpv fusion proteins
WO2023156505A1 (en) 2022-02-17 2023-08-24 Janssen Vaccines & Prevention B.V. Trimer stabilizing hiv envelope protein mutations r304v, n302m and t320l
WO2024061757A1 (en) 2022-09-23 2024-03-28 Janssen Vaccines & Prevention B.V. Pre-fusion human piv1 f proteins
WO2024061759A1 (en) 2022-09-23 2024-03-28 Janssen Vaccines & Prevention B.V. Stabilized coronavirus s proteins
WO2024074584A1 (en) 2022-10-06 2024-04-11 Janssen Vaccines & Prevention B.V. Stabilized pre-fusion piv3 f proteins
WO2024092028A2 (en) 2022-10-25 2024-05-02 Vaccitech North America, Inc. Combination treatment regimes for treating cancer
WO2024157026A2 (en) 2023-01-27 2024-08-02 Oxford University Innovation Limited Vaccine
WO2024184649A1 (en) 2023-03-07 2024-09-12 Imperial College Innovations Limited Synthetic promoters
WO2024213890A1 (en) 2023-04-14 2024-10-17 Imperial College Innovations Limited Oligonucleotide decoy
WO2024218165A1 (en) 2023-04-17 2024-10-24 Barinthus Biotherapeutics (Uk) Limited Hpv viral vector vaccine
WO2025052130A1 (en) 2023-09-05 2025-03-13 Oxford University Innovation Limited Monoclonal antibody directed to reticulocyte-binding protein homologue 5 (pfrh5)
WO2025149656A1 (en) 2024-01-11 2025-07-17 Cancer Research Technology Ltd Treatment and prevention of lung cancer
WO2025168946A1 (en) 2024-02-09 2025-08-14 Oxford University Innovation Limited Pfrh5 immunogen

Also Published As

Publication number Publication date
FR21C1026I1 (fr) 2021-08-06
WO2012172277A4 (en) 2013-04-04
SG10201604179VA (en) 2016-07-28
CN103930551B (zh) 2017-05-24
AU2012270144B2 (en) 2017-03-16
EP2714916B1 (en) 2018-01-10
ZA201309016B (en) 2014-08-27
GB201108879D0 (en) 2011-07-06
US20240181078A1 (en) 2024-06-06
EP2714916A1 (en) 2014-04-09
US11857640B2 (en) 2024-01-02
US20200360533A1 (en) 2020-11-19
US10646587B2 (en) 2020-05-12
RU2013152648A (ru) 2015-06-27
BR112013030222A2 (pt) 2016-12-06
ES2659183T3 (es) 2018-03-14
CA2837274A1 (en) 2012-12-20
CA2837274C (en) 2021-05-25
CN103930551A (zh) 2014-07-16
NO2714916T3 (enExample) 2018-06-09
US20180000966A1 (en) 2018-01-04
DK2714916T3 (en) 2018-02-19
US9714435B2 (en) 2017-07-25
NO2021028I1 (no) 2021-07-07
EP3321367A2 (en) 2018-05-16
SG195181A1 (en) 2013-12-30
EP3321367A3 (en) 2018-07-25
US20150044766A1 (en) 2015-02-12
JP6230527B2 (ja) 2017-11-15
EP3321367B1 (en) 2021-09-29
JP2014516536A (ja) 2014-07-17

Similar Documents

Publication Publication Date Title
US20240181078A1 (en) Simian Adenovirus and Hybrid Adenoviral Vectors
US12365920B2 (en) Adenoviral vector
AU2012270144A1 (en) Simian adenovirus and hybrid adenoviral vectors
JP7113924B2 (ja) 組み換え改変ワクシニアウイルスアンカラ(mva)フィロウイルスワクチン
Imler Adenovirus vectors as recombinant viral vaccines
HK40068020A (en) Adenoviral vector
HK40006989B (en) Adenoviral vector
HK40049268A (en) Intrinsic system for viral vector transgene regulation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12723726

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2837274

Country of ref document: CA

Ref document number: 2014511948

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2012270144

Country of ref document: AU

Date of ref document: 20120525

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013152648

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14119413

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013030222

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013030222

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20131125