WO2012154759A2 - Genetically engineered growth factor variants - Google Patents

Genetically engineered growth factor variants Download PDF

Info

Publication number
WO2012154759A2
WO2012154759A2 PCT/US2012/036975 US2012036975W WO2012154759A2 WO 2012154759 A2 WO2012154759 A2 WO 2012154759A2 US 2012036975 W US2012036975 W US 2012036975W WO 2012154759 A2 WO2012154759 A2 WO 2012154759A2
Authority
WO
WIPO (PCT)
Prior art keywords
protein
cell
noc
dimer
protein construct
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/036975
Other languages
English (en)
French (fr)
Other versions
WO2012154759A3 (en
Inventor
Cynthia Bamdad
Benoit J. SMAGGHE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Minerva Biotechnologies Corp
Original Assignee
Minerva Biotechnologies Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Minerva Biotechnologies Corp filed Critical Minerva Biotechnologies Corp
Priority to JP2014510413A priority Critical patent/JP2014517690A/ja
Priority to CA2835453A priority patent/CA2835453A1/en
Priority to EP12782984.4A priority patent/EP2707021B1/en
Priority to CN201280034119.XA priority patent/CN103930439A/zh
Priority to AU2012253652A priority patent/AU2012253652B2/en
Priority to EP12841648.4A priority patent/EP2768945B1/en
Priority to JP2014537191A priority patent/JP6466170B2/ja
Priority to CN201811288611.5A priority patent/CN109456932A/zh
Priority to CA2852244A priority patent/CA2852244C/en
Priority to AU2012326137A priority patent/AU2012326137B2/en
Priority to CN201280062509.8A priority patent/CN103998598A/zh
Priority to PCT/US2012/060684 priority patent/WO2013059373A2/en
Publication of WO2012154759A2 publication Critical patent/WO2012154759A2/en
Priority to IL229316A priority patent/IL229316B/en
Anticipated expiration legal-status Critical
Priority to US14/077,061 priority patent/US20140065113A1/en
Priority to IL232107A priority patent/IL232107B/en
Publication of WO2012154759A3 publication Critical patent/WO2012154759A3/en
Priority to JP2016231442A priority patent/JP2017074054A/ja
Priority to US16/447,812 priority patent/US20200062812A1/en
Priority to JP2020122592A priority patent/JP2020182483A/ja
Priority to JP2021211485A priority patent/JP2022046658A/ja
Priority to JP2023216113A priority patent/JP2024038024A/ja
Priority to US18/640,690 priority patent/US20240294590A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction

Definitions

  • the present application relates to the field of growth factor variants and methods for controlling the multimerization of such growth factors.
  • proteins In biological systems, proteins often make up complicated signaling cascades that direct the cell to behave in a particular way.
  • a common way that cells are directed to begin the process of dividing is that a protein (ligand) binds to the extra cellular domain of a transmembrane protein receptor wherein binding of the ligand to the extra cellular domain confers a change in the conformation of the receptor.
  • the ligand-induced conformational change can take place in the extra cellular domain, the intra cellular domain or both and results in a change in which proteins or molecules are able to bind to the receptor.
  • This outside to inside signaling is a common mechanism that is used to signal cells to divide, initiate programmed cell death and many other processes.
  • One commonly used mechanism that regulates the activity of growth factor receptors is ligand-induced dimerization of the receptor's extra cellular domain which in turn brings the intracellular tails close together which makes a good docking site for modifying proteins such as kinases that initiate a signaling cascade that eventuates in a signal to the cell's nucleus that causes the cell to divide.
  • Ligand-induced dimerization of the extra cellular domain of growth factor receptors is often accomplished through the binding of ligand dimers; that is two ligands non- covalently bind to each other to form homo- or hetero-dimers which then bind to two receptors that are either the same (homo) or different (hetero).
  • ligand-induced receptor dimerization is NM23 dimers binding to and dimerizing the extra cellular domain of MUC1*, which is the truncated form of the MUC1 transmembrane protein that is tumor and stem cell specific.
  • the ligand is a monomer, dimer or a higher order multimer is a function of, among other things, its concentration.
  • the dimeric form of the ligand activates the growth factor receptor.
  • there are feedback loops wherein the higher order multimers turn off the function that is promoted by the dimer.
  • the NM23 dimer activates pluripotent growth but the NM23 hexamer turns off pluripotent growth and initiates differentiation.
  • the CI protein of Phage lambda turns on transcription of one set of genes when it is bound to DNA as a tetramer but turns off transcription of those genes when, as a function of increased concentration, the CI protein becomes an octamer.
  • the problem is that it is very difficult to express and isolate a specific multimer and even more difficult to maintain that multimerization state when it is added to a biological system or expressed within a biological system. Therefore, it would be advantageous to be able to generate ligands that exist exclusively in a specific multimerization state, or prefer that multimerization state, such as dimers or that prefer dimerization.
  • NM23 mutants have been reported that prefer dimer formation, the portion that exists as the active dimer relative to the inactive hexamer varies greatly, particularly when expressed as the recombinant protein, depending on the cell that is expressing it, concentration, and a number protein expression conditions that are difficult or impossible to control. Therefore, it would be beneficial to develop methods, including recombinant methods, which would result in a higher percentage of or more stable populations of dimeric forms of NM23 or NM23 mutants.
  • the invention overcomes the above-mentioned problems, and provides genetic variants of proteins, chimeras, and single chain constructs that produce proteins that prefer a specific multimerization state.
  • the present invention is directed to a recombinantly made protein construct that preferentially forms a specific multimer.
  • the multimerization state may be its biologically active state.
  • the multimerization state may be a dimer.
  • the multimerization state may be its inactive state.
  • the multimerization state may be a higher order multimer.
  • the protein may be a growth factor or a transcription factor.
  • the dimer form may be a homodimer or a heterodimer.
  • the protein may be a mammalian protein, such as human protein or mouse protein.
  • the protein construct may comprise two monomers or fragments of the monomers, wherein such may be linked together through a linker peptide, thus forming a monomer- linker-monomer construct.
  • the monomelic protein may be NM23, such as HI, H2 or H7 isoforms.
  • the monomer may be NM23 or a mutant thereof that favors forming dimer and inhibits formation of higher order multimers.
  • the mutant NM23 may be S120G or P96S or NM23 and P96S.
  • the monomer may be NM23 or a mutant thereof that favors forming dimer, wherein one to ten C-terminal amino acids are deleted. One to six C-terminal amino acids may be deleted.
  • the linker may include GS, GS2, GS3, IgGl hinge region, or IgG2a hinge region or combination thereof.
  • the protein construct according may include
  • the specific multimer may be formed by recombinantly connecting a protein monomer to a second component.
  • the specific multimer may be fonned between the second components.
  • the second component may be a linker peptide or a protein or protein fragment.
  • the multimer may be formed between the second components via a chemical bond.
  • the multimer may be formed between the second components via a covalent bond.
  • the covalent bond may be a disulfide bond.
  • the multimer may be a dimer.
  • the second component may be a IgGl hinge or IgG2a hinge or a combination thereof.
  • the protein construct may be NM23-S120G-IgGlh, bNM23-S120G- IgG2ah, or NM23 S120G IgGlFc.
  • the multimer in another aspect, in the protein construct according to above, may be formed between the second components via a non-covalent bond.
  • the second component may be a protein that has high affinity to bind to another protein.
  • the second component may be all or a portion of Fc region of an antibody, Fos or Jun.
  • the Fc region may be IgGlFc.
  • the second component may be able to homo-dimerize or hetero-dimerize.
  • cysteines may be inserted into the protein to promote multimer formation via disulfide bonds.
  • the second component may be a fragment of the Fc domain of an IgM antibody.
  • an amino acid sequence that facilitates entrance into a cell or into the nucleus of the cell may be included.
  • an amino acid sequence that facilitates secretion of the protein construct from its expressing host cell may be included
  • the present invention is also directed to an isolated nucleic acid that includes any of the protein constructs discussed above.
  • the nucleic acid may further comprise a sequence that encodes amino acid sequence that facilitates entrance into a cell or into the nucleus of the cell.
  • the nucleic acid may further include a sequence that encodes amino acid sequence that facilitates secretion of the protein from its expressing host cell.
  • the nucleic acid may include nucleic acid encoding NM23 or a mutant thereof that favors dimer formation.
  • the present invention is directed to an expression vector that includes any of the nucleic acids discussed above.
  • the vector may be a plasmid or a virus.
  • the present invention is directed to a host cell that includes the vector as discussed above.
  • the present invention is directed to a method for proliferating cells that includes transfecting or transducing the cells with the vectors discussed herein.
  • the cell may be a stem or progenitor cell.
  • the invention is directed to a method for inducing pluripotency in a somatic cell that includes transfecting or transducing the cells with the vector described herein.
  • the present invention is directed to a method of treating a patient suffering from a condition that would be alleviated by treatment with administration of immature cells, comprising:
  • nucleic acid sequence of one or more of the genes in the vector may be native to the cell and may have been modified.
  • the present invention is directed to a method for altering expression of a targeted gene that includes the steps of:
  • the above method may include further the step of (iii) designing the nucleic acid to insert at a location near the promoter site of the targeted gene.
  • the targeted cell may be stem or progenitor cell.
  • the progenitor cell may be hematopoietic cell.
  • the progenitor cell may be B-cell or B-cell precursor.
  • the invention is directed to the above method, which further comprises engineering multimerization state of the transcription factor so as to promote the active state, if it is desired to have the gene of interest expressed and not in the active state if it is desired to suppress the gene of interest.
  • the present invention is directed to a method of healing or alleviating an illness that could benefit from increased production of stem or progenitor cell, that includes administering to a patient suffering from or at risk of developing a disease, genetic defect or unhealthy condition the cell described above.
  • the cell may be a fertilized or unfertilized egg.
  • the cell may be a stem or progenitor cell.
  • the cell may be obtained from the patient to be treated.
  • the cell may be an iPS cell.
  • the cell may be an iPS cell from the patient to be treated.
  • the present invention is directed to a method for identifying growth factor mutant that prefers dimerization and resists formation of higher order multimers, that includes determining affinity of binding of the growth factor to a target receptor, wherein higher order multimers do not bind to the target receptor with the same affinity as the dimer.
  • the growth factor may be NM23 and the target receptor may be MUC1*.
  • the target receptor may be a MUC1 * extra cellular domain peptide that may be PSMGFR peptide having the sequence of
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA SEQ ID NO: l.
  • the invention is directed to a protein according to above, which is genetically engineered to resist dimer formation.
  • the protein may be genetically engineered to prefer formation of higher order multimers.
  • the protein may be genetically engineered to prefer formation of tetramers, pentamers or hexamers.
  • the higher order multimer comprises protein genetically fused to Fc portions of an IgM antibody.
  • the protein may be a growth factor.
  • the protein may be NM23.
  • the protein may be a transcription factor.
  • the protein may be p53.
  • the present invention is directed to methods and compositions that increase a specific multimerization state of a protein.
  • the methods can be applied to any protein for which a multimer is the active form, in particular wherein the active form is a dimer.
  • One method for making ligands multimeric is to make constructs for recombinant proteins that are already connected. For example, single chain proteins wherein two or more monomers are connected either directly or via a linker that may vary in length or sequence to obtain the desired biological activity.
  • Another method for making ligands that are multimeric is to make recombinant chimeras wherein each monomer is connected to a portion of a protein that multimerizes.
  • the proteins Fos and Jun interact so that these proteins could be genetically connected to ligands that may be the same or different in order to cause the dimerization of the resultant chimeras.
  • the Fc regions of antibodies dimerize. When ligand-Fc region chimeras are made, they dimerize and can mimic the activity of a naturally occurring dimeric ligand.
  • ligand multimers are via chemical coupling of two or more monomeric ligands.
  • a bifunctional linker can be used to chemically couple two protein ligands to make homo or hetero dimers.
  • the multimerization state that is preferred for enhancing a natural biological interaction, such as activating a growth factor receptor is a dimer.
  • the ligand that is made dimeric or made to prefer dimer formation is NM23.
  • NM23 isoforms HI (NME1), H2 (NME2) and H7 (NME7) are preferred, with HI especially preferred.
  • the NM23 is of human origin.
  • an approach for inhibiting growth is to use one of the above mentioned methods to make multimers of the ligand, wherein more than two ligands are connected together or encouraged to form higher order multimers. It is also common that ligands that bind to specific nucleic acid sequences, only do so when they are in the dimeric state.
  • the above mentioned methods can be used to make variants of these proteins or small molecules such that they preferentially form dimers, in particular, when binding to nucleic acids. To inhibit nucleic acid binding, variants that prefer formation of higher order multimers can be generated.
  • the ligands that are designed to form higher order multimers can interact with the wild type protein to inhibit the ability of the native protein to form dimers.
  • NM23-H1 binds to the MUC1* growth factor receptor and induces dimerization which triggers growth, survival and pluripotency.
  • Native NM23 exists as a monomer, dimer, tetramer or hexamer, depending on its sequence and concentration. Recombinant NM23 can be refolded or purified such that populations of dimers can be isolated. Mutations of NM23-H1 that prefer dimer formation and resist the formation of tetramers and hexamers have been isolated from human cancers.
  • an approach for the inhibition of cancerous growth would be to identify NM23 mutants that prefer the formation of higher order multimers, which do not induce growth and pluripotency. Especially preferred would be those mutants that are able to recruit wild type NM23 into their multimers so that they would not form the cancer-associated dimers.
  • NM23 in dimeric form binds to the MUC1* receptor on stem and progenitor cells. Binding to MUC 1 * facilitates endocytosis of NM23 dimers after which they are translocated to the nucleus, where NM23 binds to DNA as a dimer to regulate transcription of genes involved in the growth and pluri- as well as multi-potency of stem and progenitor cells. Therefore, it is an important application of the invention to use the methods described to make NM23 variants that prefer dimer formation for use in the growth, maintenance and induction of pluripotency. That is, NM23 variants that prefer dimer formation can be used in vitro, ex vivo and in vivo to promote the growth of stem and progenitor cells and to maintain pluripotency or multipotency.
  • the invention also includes administration of these NM23 variants to a patient for the treatment of conditions that would benefit from treatment with immature cells, including stem and progenitor cells.
  • NM23 and NM23 variants can be administered to a patient either systemically or locally.
  • the invention also includes using methods of the invention, which influence a protein to be in a specific multimerization state to carry out a biological function that is not conferred by the monomer or some other multimer, in vitro, or in vivo in a patient, in an egg fertilized or unfertilized or in stem cells for research or destined for therapeutic use, and for the induction of pluripotency or induction of cells to a less mature state.
  • the nucleic acids that encode the NM23 variants are used, for example as a part of an expression vector.
  • the NM23 variant is designed to be positioned near a target gene.
  • the NM23 variant can be designed to be inserted into or near the gene of interest.
  • a patient's own cell which may be an iPS cell or a partial iPS cell, bears a corrected gene or an inserted gene; nucleic acids that code for one or more of the NM23 variants that prefer dimerization are inserted into the same cells, to promote the proliferation of said cells either in vitro, ex vivo or in vivo.
  • these methods are used in conjunction with methods that correct a genetic defect or disease condition by selectively propagating a specific cell population.
  • dimeric NM23 can be made to be expressed in cells that express the fetal form of hemoglobin or a corrected gene for the treatment of sickle cell anemia.
  • these methods are used to stimulate growth of a cell in a gene therapy setting.
  • either the growth promoting multimer or the growth inhibiting multimer is used to increase or decrease production of specific cell types.
  • NM23 and NM23 variants also promote the growth of stem and progenitor cells of other mammals.
  • mouse stem and progenitor cells proliferate in the presence of NM23 dimers whether wild type protein or a variant of the protein or whether of human or mouse origin.
  • Figure 1 is a graph of cancer cell growth measured as a function of bivalent or monovalent antibody concentration, showing that it is dimerization of the MUC1* receptor that stimulates growth.
  • the addition of bivalent antibody produces the characteristic bell-shaped growth curve indicative of growth factor receptor dimerization.
  • the growth of MUC1- negative HEK 293 cells was not impacted by either the bivalent or monovalent Fab Anti- MUCl*.
  • the bivalent antibody was added in excess, there is one bivalent antibody bound to each receptor rather than one bivalent antibody dimerizing every two receptors and thus inhibits growth.
  • Figure 2 shows an overlay of FPLC traces that characterize the different multimerization states of either wild type NM23 (WT) or three different preparations of mutant NM23-S120G.
  • the wild type NM23 shows a single peak that corresponds to the molecular weight of the hexamer and a shoulder corresponding to higher order multimers.
  • One preparation of NM23-S120G (labeled "mixed") that was not refolded, has the dominant peak that corresponds to the dimer and a lesser peak of tetramers.
  • Another preparation of NM23-S120G (“hexamer”) that was also not refolded has the major peak of hexamers with shoulder of higher order multimers.
  • a refolded preparation of NM23-S120G (“dimer”) is comprised mostly of dimers.
  • Figure 3a shows photographs of non-reducing gels of NM23-WT, NM23-S120G- mixed, NM23-S120G-hexamer and NM23-S120G-dimer, which show the multimerization state of the wild type protein and the three different preparations of the S120G mutant
  • b) shows an overlay of Surface Plasmon Resonance (SPR) measurements showing the ability of the four different NM23s to bind to a MUC1* extra cellular domain peptide (PSMGFR) attached to the SPR chip surface.
  • SPR Surface Plasmon Resonance
  • Human ES (embryonic stem) cells were cultured in either (d) NM23-S120G-dimer, (e) NM23-S120G-hexamer, (f) NM23-WT, or (g) NM23-S120G-dimer plus the MUC 1 * extra cellular domain peptide (PSMGFR) to competitively inhibit binding of the NM23 dimer to the MUC 1 * receptor on the stem cell surface.
  • PSMGFR extra cellular domain peptide
  • Figure 4 shows a native, non-denaturing gel that shows the multimerization state of NM23-WT versus three different preparations of recombinant NM23-S120G.
  • Figure 5 shows SPR measurements of A) NM23 wild type (WT) and B) a preparation of NM23-S120G-"mixed” that produced 60% dimer. Protein was injected at five different concentrations. Results show that 8-times more NM23-S120G-mixed protein bound to a MUC1* extra cellular domain peptide surface than NM23-WT. Because the wild type protein is a hexamer, the number of RUs must be divided by 3 to compare to the amount of dimer that bound. Although both wild type and S120G-dimer show a concentration dependence in binding, the amount of wild type hexamer that bound is so small that it may still be within the noise range of the system.
  • Figure 6(a) shows a photograph of a non-reducing gel loaded with NM23 single chain variants in the presence or absence of added DTT (dithiothreitol) to reduce disulfide bonds. Dimers are indicated by red boxes. In the absence of DTT, there are some higher molecular weight species, which may be because the protein was loaded onto the gel at roughly 1000-times the concentration that is used for culturing cells, (b) shows a photograph of a reducing gel shows that the NM23 single chain variants migrate through the gel with the expected molecular weight of dimers.
  • DTT dithiothreitol
  • Figure 7 shows PAGE characterization of the purification of single chain variants NM23 S120G IgGlh and NM23 S120G IgG2ah using a non-reducing gel to avoid disruption of disulfide bonds.
  • Figure 8 shows PAGE characterization of the purification of the fusion chimera variant NM23 S120G IgGlFc using a non-reducing gel to avoid disruption of disulfide bonds.
  • Figure 9 shows PAGE characterization of refolded fusion chimera variant NM23 S120G IgGlFc using a non-reducing gel to avoid disruption of disulfide bonds, where the variant runs with the molecular weight of a dimer and also using a reducing gel which shows that in the absence of the disulfide binds, the fusion variant runs with the apparent molecular weight of a monomer.
  • Figure 10 shows FPLC (a) and non-reducing SDS-PAGE (b) characterization of the fusion chimera variant NM23-S120G-IgGlFc.
  • Figure 11 shows FPLC (a) and non-reducing SDS-PAGE (b) of refolded NM23- S120G-GS2 that shows major populations of dimer.
  • (c-e) show photographs of human ES cells, BGOlv/hOG line, that were cultured in 8nM of the NM23 variant NM23-S120G-GS2, which was not refolded or purified, in minimal stem cell media on Matrigel (c and d) and on a cell culture plate coated with anti-MUCl * antibody, MN-C3 (e). These data show that NM23-S120G-GS2 does not need to be refolded or purified before use.
  • Figure 12 shows FPLC (a) and non-reducing SDS-PAGE (b) of refolded NM23- S120G -IgGlh noC that shows major populations of dimer.
  • (c-e) shows photographs of human ES cells, BGOlv/hOG line, that were cultured in 8nM of the NM23 variant NM23- S120G -IgGlh noC, which was not refolded or purified, in minimal stem cell media on Matrigel (c and d) and on a cell culture plate coated with anti-MUCl * antibody, MN-C3 (e).
  • Figure 13 shows FPLC (a) and non-reducing SDS-PAGE (b) of refolded NM23- S120G -IgGlh /IgG2ah noC that shows major populations of dimer.
  • (c-e) shows photographs of human ES cells, BGOlv/hOG line, that were cultured in 8nM of the NM23 variant NM23- S120G -IgGlh /IgG2ah noC, which was not refolded or purified, in minimal stem cell media on Matrigel (c and d) and on a cell culture plate coated with anti-MUCl * antibody, MN-C3 (e). These data show this variant does not need to be refolded or purified before use.
  • Figures 14(a) to 14(h) show SDS-PAGE characterization using non-reducing gels and corresponding FPLC traces for NM23 single chain variants NM23-P96SAC1 (a, b), NM23-P96SAC2 (c, d), NM23-P96SAC6 (e, f) and NM23-P96S (g, h), which were not refolded or purified.
  • NM23-P96SAC2 and NM23-P96SAC6 have their major peaks in the dimer range and thus are preferred. These data show that these variants do not need to be refolded or purified before use.
  • Figure 15 shows photographs of human ES cells, BGOlv/hOG line, that were cultured in 8nM of an NM23 variant in minimal stem cell media on Matrigel (a, b, d, e) and on a cell culture plate coated with anti-MUCl* antibody, MN-C3 (c, f);
  • (a-c) variant is P96SAC2;
  • (d-f) variant is P96SAC6.
  • Figure 16 shows that the major population of NM23-S 120G (refolded,"RS") exists as a dimer as shown in the FPLC trace (a) and verified by a non-reducing PAGE (b). Dimer only fractions purified by FPLC were pooled and used at 8nM in minimal stem cell media to grow human ES cells, BGOlv/hOG line, (c-e) photographs of the human stem cells show that cultured in 8nM of the NM23 variant produces pluripotent stem cells whether on Matrigel (c, d) or on a cell culture plate coated with anti-MUCl* antibody, MN-C3 (e).
  • RS refolded
  • Figure 17 shows photographs of human ES cells (H9 line) cultured in minimal stem cell media plus either refolded and purified NM23-S120G RS (a-d) or the single chain construct S120G-GS2 that is expressed as the dimer and does not need to be refolded and purified.
  • S120G-GS2 was added either in the presence (e-h) or absence (i-1) of added DTT.
  • the images show that stem cells cultured in the single chain variant grow as well as they do in the dimer fraction of the refolded and purified NM23-S120G-RS.
  • Cells are undifferentiated and pluripotent stem cells as evidenced by the lack of thickening and darkening of the cell masses.
  • FIG 18 shows photographs of human ES cells (H9 line) cultured in NM23- S120G-IgGlh noC in minimal stem cell media.
  • This NM23 variant is expressed as the dimer and does not require further processing or refolding to ensure that it is in the dimer state.
  • S120G-IgGlh noC was added either in the presence (a-d) or absence (e-h) of added DTT.
  • the images show that stem cells cultured in the single chain variant grow as well as they do in the dimer fraction of the refolded and purified S120G RS (compare to Figure 17a-17d). Cells are undifferentiated and pluripotent stem cells as evidenced by the lack of thickening and darkening of the cell masses.
  • Figure 19 shows photographs of human ES cells (H9 line) cultured in minimal stem cell media plus either refolded and purified NM23-S120G RS (a-d) or the single chain construct (NM23) S120G-IgGlh/IgG2ah noC that is expressed as the dimer and does not need to be refolded and purified.
  • S120G-IgGlh/IgG2ah noC was added either in the presence (e-h) or absence (i-1) of added DTT.
  • the images show that stem cells cultured in the single chain variant grow as well as they do in the dimer fraction of the refolded and purified NM23-S120G RS (compare to Figure 17a-17d).
  • Cells are undifferentiated and pluripotent stem cells as evidenced by the lack of thickening and darkening of the cell masses.
  • Figure 20 shows a graph that plots the growth of human stem cells cultured in either the refolded and purified dimer only fraction of NM23-S120G or NM23 variants that are designed to spontaneously form dimers or are single chain constructs comprised of two NM23 monomers. In each case, 200,000 cells were plated and cells were counted 4 days later. The graph shows that the variants that do not require refolding or further purification of dimer population cause stem cells to proliferate as well or better than NM23-S120G-RS that has been refolded to form a majority of dimers and further purified by FPLC (compare to Figure 17a-17d).
  • Figure 21 shows a graph that plots the growth of human stem cells cultured in either the refolded and purified dimer only fraction of NM23-S120G-RS or NM23 variants that are designed to spontaneously form dimers or are single chain constructs comprised of two NM23 monomers.
  • the graph shows that the variants cause stem cells to proliferate as well or better than NM23-S120G-RS and that the effect persists over several passages.
  • Figure 22 is a graph of RT-PCR measurements of gene expression of the NM23 variants compared to the refolded and purified NM23-S120G-RS.
  • Gene expression analysis shows that culturing cells in the NM23 variants designed to spontaneously form dimers, express the pluripotency genes to the same or higher levels as the refolded and purified dimer only populations of NM23.
  • Figure 23 shows photographs of the nuclear localization of NM23-S120G-RS which is the single point mutation that favors dimerization but must be refolded and purified to obtain a population of mostly dimer.
  • (a-c) cells are stained with fluorescently labeled anti-NM23 antibody;
  • White arrows indicate presence of NM23 in the nucleus
  • (g) is the 488 fluorescent control
  • (h) is a bar graph showing the quantification of NM23 in the nucleus for conditions a-c and shows that adding exogenous NM23-S120G RS to the culture media causes internalization of the NM23 and translocation to the nucleus. Note that there is more NM23 in the nucleus when added at 16nM than when added at 128nM, which is consistent with our findings that at too high a concentration, the NM23 dimers bind to every MUC1* receptor, rather than the NM23 dimers binding to and dimerizing two MUC1 * receptors.
  • Figure 24 shows photographs of the nuclear localization of NM23 variant NM23- S120G IgGlh /IgG2ah noC. a) no exogenous NM23 variant added; b) 16nM of the NM23 variant; c) 128nM of the NM23 variant, (a-c) cells are stained with fluorescently labeled anti- NM23 antibody; (d-f) overlay of DAPI nuclear stain and the fluorescently labeled NM23.
  • White arrows indicate presence of NM23 in the nucleus
  • (g) is the 488 fluorescent control
  • (h) is a bar graph showing the quantification of NM23 in the nucleus for conditions a-c and shows that adding exogenous NM23 S120G IgGlh /IgG2ah noC variant to the culture media causes internalization of the NM23 and translocation to the nucleus.
  • Figure 25 shows photographs of mouse embryonic stem (ES) cells that have been cultured in on inactivated MEF feeder cell layers for two days in mouse ES cell minimal medium supplemented with either mLIF or NM23-S120G-RS. The images show that mouse ES cells grow as well using NM23 dimers as the only growth factor as they do in the standard mouse stem cell media with m LIF as the basic growth factor.
  • ES mouse embryonic stem
  • Figure 26 shows photographs of non-reducing SDS-PAGE characterization of NM23 variants NM23-S120G-GS2, NM23-S120G-IgGlh noC and NM23-S120G- IgGlh/IgG2ah noC that have not been refolded, compared to NM23-WT and NM23-S120G (non-refolded), a) shows that on a non-reducing gel, variants NM23-S120G-GS2, NM23- S120G-IgGlh noC and NM23-S120G-IgGlh/IgG2ah noC that have not been refolded or purified exist as the dimer in contrast to the wild type protein that runs with an apparent molecular weight of a monomer.
  • NM23 hexamers run at the molecular weight of monomers on non-reducing gels because higher order NM23 multimers do not depend on disulfide
  • Figure 27 shows examples of recombinantly produced NM23 variants. It is noted that affinity tags, such as (Histidine)6, Strep Tagil, and so forth are optional elements.
  • Figure 28 shows photographs of human stem cells cultured in NM23 variants that had been refolded (denoted by the "R” in figure labels).
  • the NM23 variants used at 8nM were NM23-S120G-RS (a,e), NM23-S120G-GS2 (b,f), NM23-S120G-IgGlh noC (c,g), and NM23-S120G-IgGlh/IgG2ah noC (d,h).
  • the cell morphology is consistent with pluripotent stem cells, as they are round and not fibroblast in shape and they are a single layer devoid of thickening or darkening which are indicative of cell differentiation.
  • multimer refers to a plurality of monomers that are covalently linked together or non-covalently fused to each other.
  • higher order multimer refers to a plurality of monomers that are covalently linked together or non-covalently fused to each other, which is greater than a dimer.
  • nucleotide symbols other than a, g, c, t they follow the convention set forth in WIPO Standard ST.25, Appendix 2, Table 1, wherein k represents t or g; n represents a, c, t or g; m represents a or c; r represents a or g; s represents c or g; w represents a or t and y represents c or t.
  • NM23 S120G (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 S120G (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96S (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96S (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 P96S/S120G (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96S/S120G (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC1 (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC1 (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC2 (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC6 (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC6 (cloned between Ndel and Xhol) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC1 /S120G (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC2 /S120G (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • NM23 P96SAC6 /S120G (cloned between Ndel and Agel) tagged with histidine cluster at the C-terminus
  • IgGlh no C linker modified hinge portion of an Fc region of an antibody
  • IgG2ah no C linker modified hinge portion of an Fc region of an antibody
  • NM23 S120G IgGlFc (NM23-X connected to the Fc region of an antibody )
  • NM23 S120G IgGlh (NM23-X connected to only modified hinge portion of the Fc region of an antibody)
  • NM23 S120G IgG2ah (NM23-X connected to only modified hinge portion of the Fc region of an antibody)
  • the present invention discloses methods for making proteins that preferentially form specific multimer(s), wherein the specific multimer has a desired biological function that the monomer or some other multimer of the protein does not have.
  • the specific multimer has a desired biological function that the monomer or some other multimer of the protein does not have.
  • many growth factors exert their growth promoting function only when they are in the dimeric form. These may be homo or hetero-dimers.
  • methods of the invention are used to enhance growth by increasing the amount of dimers of the growth factors.
  • the desired biological function is to inhibit growth, for example, of cancer, then the growth factors would be engineered or mutants selected that resist dimer formation.
  • Methods of the invention that generate proteins or variants of the native protein that are more likely to exist in the desired multimeric form, that which results in a desired biological function, but which function is not conferred by the monomer or other multimeric form, can be used in vitro, ex vivo or in vivo.
  • the variant that prefers a specific multimerization state can be expressed and optionally purified, then used for cell culture, particularly for the culture of stem and progenitor cells, including hematopoietic stem and progenitor cells and other immature cells of the bone marrow or other in vitro uses.
  • the expressed and optionally purified multimer- specific variants can be used to treat a patient by administering topically via a cream, suave, bandage, and the like, or administered as a systemic treatment such as by oral ingestion, injection, and the like.
  • the parent protein is NM23 and the multimer- specific variant prefers dimer formation, optionally inhibits formation of the tetramer or hexamer and otherwise increases the amount of dimer that is present over a wide range of protein concentrations.
  • nucleic acids encoding the multimer-specific variant can be introduced into a cell, using any one of a variety of methods known to those skilled in the art, such as homologous recombination, stable or transient transfection or transduction, viral transduction, such as by using lentiviruses or retroviruses, including self-inactivating vectors, including self- inactivating lentiviral vectors and self-inactivating retroviral vectors.
  • the cell is a stem cell or an iPS cell, which may be derived from the patient or from a donor. The resultant cells may be transplanted into a patient before or after in vitro expansion.
  • nucleic acid manipulations are performed to correct a genetic abnormality in the cell that has also been transfected or transduced to express the multimer- specific variant.
  • the protein is NM23 and the multimer-specific variant prefers dimerization and inhibits the formation of higher order multimers, with the net effect that the population of the expressed protein has an increased amount of dimer, over a wide range of concentrations, compared to the parent protein.
  • the NM23 dimers which are growth factors, will drive the expansion of the cell even after transplantation into the patient.
  • the genetic disorder to be treated is sickle cell anemia and treatment includes stimulating the growth of cells that express the fetal form of hemoglobin or the corrected gene for the adult form.
  • the growth factor variant can be inserted into the cell so that it is only transiently expressed, for example by using a self-inactivating viral vector.
  • the multimer-specific variant which in a preferred embodiment is an NM23 variant that prefers dimer formation, can be permanently inserted into the genome.
  • the cell can also be transfected or transduced to express MUCl, or a fragment of MUCl, including MUCl chimeras, or MUCl*, wherein the extra cellular domain has been truncated to included essentially most or all of the PSMGFR sequence.
  • nucleic acid of the variant at the 5' end is modified to include a leader sequence that causes the cell to secrete the expressed protein.
  • sequences are known to those skilled in the art and commonly include sequences derived from antibodies, see Example 13.
  • leader sequences that cause an expressed protein to be secreted from the cell. Any of these sequences or others known to those skilled in the art can be added to the nucleic acid sequence of the variant so that the expressed protein is secreted from the cell. Optionally, the sequence is added to the N-terminus or 5' of the nucleic acid sequence. In this way, the NM23 mutants, deletions, single chain variants and fusion protein chimeras can readily be used in vitro and ex vivo, as well as in vivo.
  • pelB pectate lyase B of Erwinia carotovora
  • Cells transfected or transduced to express the growth factor variant can be somatic cell, a stem cell, including hematopoietic stem cells and progenitor cells, or iPS cells.
  • somatic cells such as fibroblasts or dermablasts are transduced with nucleic acids that encode an NM23 variant that prefers dimer formation.
  • the NM23 variant nucleic acids may be transduced along with one or more genes that cause the host cell to revert to a more immature state. These other genes may include but not limited to Oct4, Sox2, Nanog, Klf4, Lin28 and c-Myc.
  • the cells can be transfected or transduced to express the NM23 variant temporarily, such that it will drive the expansion of that cell type for a limited amount of time, or permanently using methods such as stable transfection or homologous recombination and the like.
  • the methods of the invention can act to provide a growth factor that is constitutively active or more active than the native growth factor to stimulate the proliferation of a specific population of cells, which may carry a genetic mutation or correction.
  • one recombinant variant that increases the percentage of a specific multimeric state of a growth factor is carried on the same nucleic acid, plasmid, or expression vector that carries the sequence of the corrected gene or gene to be expressed.
  • a multimer that does not stimulate growth may be used.
  • the invention also includes the use of these methods, in patients, in cells destined for transplant in patients, in blastocysts and embryos as well as in fertilized or unfertilized eggs, which may be used for in vitro fertilization.
  • the growth factor is NM23 wherein the dimer form activates growth and higher order multimers such as tetramers and hexamers turn off the NM23 mediated pathway that stimulates growth and induces or maintains pluripotency.
  • NM23 dimers promote stem and progenitor cell growth and pluripotency and also promote the growth of cancer cells.
  • the hexamer or tetramer form of NM23 does not promote stem or cancer cell growth. Therefore, methods of the invention that result in variants that prefer dimer formation are used to promote stem cell, progenitor cell and/or cancer cell growth.
  • the higher order NM23 multimers can be used to induce differentiation.
  • NM23 variants can be further modified to carry a toxin to target the killing of cancer cells.
  • NM23 is a ligand of MUC1* which is present at the surface of many different cancer cells.
  • One example is the use of the ribosome-inactivating protein called saporin.
  • saporin is not able to enter the cell, but when coupled to another protein that binds to the cell surface, the saporin/protein complex can be internalized and is toxic to the cell.
  • MUC1 or truncated forms of MUC1, including MUC1 * wherein the extra cellular domain includes primarily the sequence of the PSMGFR peptide can be optionally expressed either in vitro or in vivo along with the NM23 variant.
  • MUC1 or MUC1 truncations, or MUC1 variants can similarly be expressed from the same expression plasmid as NM23 and optionally a gene desired to be expressed.
  • the growth factor receptor itself is engineered to be in a specific multimerization state in order to either promote or inhibit growth.
  • the growth factor receptor is MUC 1 * and the preferred multimer is a dimer.
  • One method of generating proteins that prefer a specific multimerization state is to identify mutants of that protein that prefer the formation of that specific multimerization state. For example, Table 1 lists some of the NM23 mutations that encourage the formation of dimers.
  • Linkers can vary in length and sequence.
  • the linker is 5-100 amino acids.
  • the linker is 10-75 amino acids.
  • the linker is either 10 amino acids or 43 amino acids.
  • the sequence of a linker can vary from a flexible (GGGGS )n type linker to any sequence known or suspected to be flexible in a natural protein, including modifications of native sequences, wherein several mutations intended to increase flexibility or solubility are inserted. Table 2 lists some preferred linker sequences.
  • Table 3 lists some preferred single chain constructs wherein two monomers are recombinantly connected via a linker.
  • the linker sequence itself tends to form homo or hetero dimers.
  • portions of the Fc region of antibodies dimerize with another Fc region.
  • Chimeric proteins consisting of a portion of the parent protein plus a portion of a protein that naturally dimerizes are variants that prefer dimer formation.
  • chimeras that use Fc sequences from IgM proteins would prefer the formation of higher order multimers such as the characteristic pentamer.
  • Modified hinge regions of antibodies fused to NM23 mutant monomers preferentially form dimers and are described in detail herein.
  • protein dimers are achieved by genetically making the protein of interest a fusion chimera wherein it is fused to a protein or protein fragment that has a dimerization domain.
  • Ligands that are multimeric can be generated by making recombinant chimeras wherein each monomer is connected to a portion of a protein that multimerizes.
  • the proteins Fos and Jun interact so that they could be recombinantly connected to ligands that may be the same or different in order to cause the dimerization of the resultant chimeras.
  • Table 3 lists preferred constructs, some of which are chimeras.
  • Cysteines can be inserted into the protein of interest such that dimer formation is encouraged via formation of disulfide bonds.
  • the invention also includes inserting cysteines into linkers, whether comprised of natural amino acids or unnatural polymers or small molecules, to facilitate dimerization.
  • Table 4 contains a list of preferred variants, whose dimerization is enhanced by the introduction of cysteines.
  • ligand multimers are via chemical coupling of two or more monomeric ligands.
  • a bifunctional linker can be used to chemically couple two protein ligands to make homo or hetero dimers.
  • the linker can be a chemical cross linker or similar that facilitates dimerization via covalent coupling of two monomers to form homo or hetero dimers.
  • the same can be accomplished by chemically coupling the proteins when they are in dimeric state, for example, immobilizing target protein in a defined geometry, for example on a SAM and chemically coupling the proteins either directly or indirectly via a linker while they are confined in a geometry that mimics dimerization state.
  • dimers can be isolated then a coupling agent is added to directly couple two proteins together either directly or via a linker.
  • Yet another method for making multimeric ligands is to identify small molecules that bind to the target receptor and then synthesize multimers of the small molecule.
  • the multimerization state that is preferred for enhancing a natural biological interaction, such as the activity of a growth factor is a dimer.
  • the ligand that is made dimeric or made to prefer dimer formation is NM23.
  • NM23 isoforms HI, H2 and H7 (NME7) are preferred, with HI especially preferred.
  • the NM23 is human. Also preferred for use with methods for increasing growth factor activity are mutants that enhance dimerization and optimally resist formation of higher order multimers.
  • NM23-S120G and NM23-P96S mutants have been reported to prefer dimer formation and to resist the formation of tetramers and hexamers which do not activate the MUC1 * growth factor receptor and do not bind to nucleic acids to induce expression of genes involved in pluripotency and cancer.
  • NM23-S120G mutant we discovered that it is preferred that the protein be denatured and refolded to obtain significant populations of dimer.
  • the fraction of the P96S mutant that existed as a dimer was increased by denaturation and refolding. C-terminal deletions disrupt regions that participate in the formation of the higher order multimers and thus increase the portion of the protein that is in dimeric form.
  • C-terminal deletions of NM23 wild type or mutants is preferred for increasing the percentage and stability of dimer populations.
  • C-terminal deletion of mutants such as S120G and/or P96S, that already prefer dimer formation are especially preferred.
  • Deletion of 1-6 amino acids from the C-terminus of NM23 is especially preferred.
  • the invention also includes purposely introducing mutations and identifying those that either increase or decrease the propensity to form dimers. For example, to enhance growth factor activity wherein the growth factor is active when in dimeric form, mutations that prefer dimer formation are identified and preferred. For inhibiting growth factor activity, mutations that resist formation of dimers or prefer formation of tetramers or hexamers are preferred.
  • Either site directed or random mutagenesis can be used wherein those that favor dimer formation are identified by a variety of methods including but not limited to structural analysis such as crystal structure, ability to support, induce or maintain pluripotency in stem cells, ability to bind to MUC1 * peptide that includes essentially the PSMGFR peptide sequence.
  • structural analysis such as crystal structure, ability to support, induce or maintain pluripotency in stem cells, ability to bind to MUC1 * peptide that includes essentially the PSMGFR peptide sequence.
  • NM23 variants that favor dimer formation can be identified for example by using phage display and standard random mutagenesis wherein the desired mutants are identified by their ability to bind to stem cells or the MUC1 * peptide.
  • NM23 variants and similar multimer- specific variants of the invention can be further modified with sequences that increase the variant's ability to penetrate the cell membrane.
  • the ligand monomers that are genetically engineered to prefer dimer formation may be the wild type protein or a mutant or truncation that prefers dimer formation or resists the formation of higher order multimers.
  • NM23 is meant to be exemplary and the invention also includes the use of these methods, linkers, linker sequences and/or use of portions of other proteins or molecules for increasing activity of other agents that exert their effects when in dimeric form.
  • transcription factors Another type of protein for which the multimerization state is important is transcription factors. It is common that transcription factors that bind to specific nucleic acid sequences, only do so when they are in the dimeric state. However, some transcription factors, such as tumor suppressor p53, bind DNA as a tetramer. Still other transcription factors exert a specific transcription function only when they exist as octamers. Methods of the invention can be used to make variants of these transcription factors to increase the desired activity, for example by making transcription factor variants that prefer dimerization.
  • an approach for inhibiting growth is to use one of the above mentioned methods to make multimers of the ligand, wherein more than two ligands are connected together or encouraged to form higher order multimers.
  • variants that prefer formation of higher order multimers can be generated.
  • the ligands that are designed to form higher order multimers can interact with the wild type protein to inhibit the ability of the native protein to form dimers.
  • NM23 binds to the MUC1 * growth factor receptor and induces dimerization which triggers growth, survival and pluripotency.
  • NM23 can exist as a monomer, dimer, tetramer or hexamer, depending on its sequence and concentration. Recombinant NM23 can be refolded or purified such that populations of dimers can be isolated. Mutations of NM23 that prefer dimer formation and resist the formation of tetramers and hexamers have been isolated from human cancers.
  • an approach for the inhibition of cancerous growth would be to identify NM23 mutants that prefer the formation of higher order multimers, which do not induce growth and pluripotency. Especially preferred would be those mutants that are able to recruit wild type NM23 into their multimers so that they would not form the cancer-associated dimers.
  • MUC1* growth factor receptor is activated by ligand induced dimerization of its extra cellular domain.
  • Bivalent antibodies raised against the extra cellular domain of MUC1* (PSMGFR sequence:
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA SEQ ID NO: l
  • GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA SEQ ID NO:2
  • the dose response curve is a classic bell-shaped curve that is characteristic of Class I growth factor receptors that are activated by dimerization. The bell-shaped curve is caused when growth increases as dimerization of MUC1* increases but when the NM23 dimers or the bivalent antibodies are in excess, each receptor is bound by one, rather than two growth factors. This actually blocks dimerization of the growth factor receptor and results in a decrease in growth.
  • NM23 mutant S120G was previously isolated from a human neuroblastoma. It was reported that the mutant NM23 preferred dimer formation and resisted the formation of higher order multimers, specifically the tetramers and hexamers that wild type NM23 is known to form. Other NM23 mutants that were reported to prefer dimerization were the P96S mutation and deletions at the C-terminus of 1-6 amino acids.
  • NM23-WT wild type
  • S120G or P96S mutants are made as recombinant proteins
  • their multimerization state depends on sequence, how it is expressed, how it is collected and purified, as well as concentration.
  • many expression/purification methods resulted in populations comprised exclusively of tetramers and hexamers.
  • Other methods of protein expression produced NM23 populations that were comprised of hexamer, tetramer and a small dimer population.
  • One method for expressing and purifying NM23 mutants that results in significant populations of dimer involved denaturing the expressed protein and then refolding it.
  • the dimer population was further purified by size exclusion chromatography (FPLC) as described in Example 4 herein.
  • FPLC size exclusion chromatography
  • FPLC Characterization of NM23-WT or three different preparations of mutant S120G was carried out by FPLC ( Figure 2).
  • FPLC show that wild type, NM23-WT, was comprised almost exclusively of hexamers, as was one of the preparation of the mutant, "NM23-si2oo- hexamer" S120G, wherein the soluble fraction of the expressed protein was used.
  • mutant S120G was performed in which the expressed protein was denatured then refolded according to the method described in Example 3b.
  • FPLC showed that preparation, "NM23-si20G-dimer", was comprised only of dimer and monomer with the dimer portion being 80% of the population.
  • Figure 3a shows that on a non-reducing gel, the NM23 dimer runs with an apparent molecular weight of about 40kDa, while both the monomer and hexamer run with an apparent molecular weight of about 20kDa, indicating that the dimer is stabilized by disulfide bonds while the hexamer is not.
  • SPR Surface Plasmon Resonance
  • Figure 3b shows an overlay of Surface Plasmon Resonance (SPR) measurements show vast differences in the ability of the four different NM23 preparations to bind to a MUC 1 * extra cellular domain peptide (PSMGFR) attached to the SPR chip surface.
  • SPR Surface Plasmon Resonance
  • Results show that the amount of binding of NM23 to its cognate receptor, MUC1*, is a function of how much dimer is present in the sample.
  • SPR measures protein mass at the chip- solution interface, so if the hexamer bound to the MUC 1 * peptide surface, it would yield an SPR signal 3-times greater than if a dimer bound.
  • the amount of NM23-WT or NM23-S120G-hexamer that bound to the MUC1* peptide was about 12-times less than the amount of NM23-S120G-dimer that bound.
  • an irrelevant peptide was immobilized on the same chip and a minimal amount of background binding resulted, which was subtracted from the measurement shown.
  • the amount of binding generated by the NM23-WT and NM23-S120G-hexamer (both comprised almost exclusively of hexamer) -lOORUs is often considered to be within the noise of the system.
  • NM23-S120G-dimer, NM23-WT, or NM23-S120G-hexamer were separately added to nanoparticles bearing MUCl* ecd peptides (PSMGFR).
  • PSD1* ecd peptides PEGFR
  • Figure 3c shows that only the dimer form of NM23 binds to its cognate receptor MUC1* peptide, making the solution turn from pink to blue/gray.
  • NM23-S120G mutant, which expressed as virtually all hexamer, bound at all to the MUC1* peptide and the solution remained pink and indistinguishable from the control "no protein", in which no NM23 protein was added.
  • the Fab of anti-MUC 1 * antibody which was raised against the PSMGFR peptide, was added to competitively inhibit binding of ligands to the peptide. As can be seen in the figure, the Fab inhibited the interaction of NM23 dimers and MUC 1 * peptide, showing that it was specific binding.
  • Differentiating stem cells have a different morphology than pluripotent stem cells and appear as thickened, darkened areas of cells, whereas pluripotent stem cells grow in a single bright layer of cells.
  • NM23-S120G dimer preparation of NM23-S120G (d) was able to support the undifferentiated growth of stem cells.
  • Wild type NM23 (f) caused the stem cells to begin differentiating after three days, while NM23-S120G-hexamers had even more differentiation (e).
  • the greatest amount of differentiation occurred as the result of competitively inhibiting the interaction between NM23 dimers and the MUC1* receptor (g).
  • NM23-WT is comprised mostly of all hexamer
  • the NM23-S120G-hexamer prep has a small population of dimer but is comprised mostly of hexamer.
  • the NM23-S120G-dimer prep is comprised mostly of dimer but has a small portion of tetramer.
  • the "NM23-S120G-mixed" preparation that was shown by FPLC to be comprised of 60% dimer (see Figure 2) was tested along with NM23-WT comprised mostly of hexamer (Figure 2) to determine their ability to bind to the MUCl* eCc i peptide (PSMGFR) using Surface Plasmon Resonance (SPR).
  • each protein at five different concentrations, was separately flowed over a chip that was coated with the PSMGFR peptide.
  • the overlay of SPR traces shown in Figure 5 shows that roughly 8-times more "NM23-S120G-mixed" protein bound to a MUC1* extra cellular domain peptide surface than NM23-WT.
  • the wild type protein is a hexamer, the number of RUs must be divided by 3 to compare to the amount of dimer that bound.
  • both wild type and S120G-dimer show a concentration dependence in binding, the amount of wild type hexamer that bound is so small that it may still be within the noise range of the system.
  • NM23 mutants, deletion mutants and engineered variants that prefer dimer formation are ideal for the growth, maintenance and induction of pluripotency or multipotency, for example in somatic cells, as well as for the numerous applications disclosed herein.
  • Nucleic acids encoding these variants can also be transfected into cells to promote the growth of these cells.
  • Exemplary variants of proteins that prefer a specific dimerization state compared to the native protein were made, characterized and tested for their ability to function as the specific multimer.
  • the NM23 variants that have increased populations of stable dimer compared to the wild type protein that were made and tested are listed in Tables 1, 3 and 4. Figure 27 also provides examples of such constructs.
  • Tables 1, 3 and 4 list NM23 mutants that prefer dimer formation, engineered constructs wherein two NM23 wild type or mutant monomers are connected via a linker to form a dimer, and NM23 fusion proteins that preferentially form dimers.
  • Table 3 lists and describes NM23 variants that were generated, expressed, characterized and tested for their ability to mimic the behavior of native NM23 dimers, and particularly to test their ability to mimic the behavior of NM23-S120G-dimers that were 80% or greater in dimer form.
  • the methods used to generate the constructs, express the protein, and refold in some cases are described in Examples 2, 3, 9, and 10. Methods used to test the function of the variants produced are described in Examples 5-7 and 11-12.
  • Figure 6 shows photographs of non-reducing (a) and reducing (b) gels for a number of the NM23 variants described in Table 3.
  • the reducing gel shows that these single chain constructs run with an apparent molecular weight that is approximately equal to the molecular weight of an NM23 dimer,
  • the non-reducing gel shows that at very high concentrations, some higher order multimers exist but are eliminated by reducing conditions such as within a cell or by the addition of DTT.
  • Figure 7 shows PAGE analysis of the purification of two more single chain NM23 variants that are dimers.
  • Figures 8 and 9 show gels that confirm expression and purification of NM23-S120G-IgGl Fc, a variant that is not a single chain construct but preferentially forms dimers and is described in Table 4.
  • Figure 10a shows the FPLC characterization of the NM23-S120G-IgGl Fc variant and shows that a subpopulation of dimer is formed which can be increased by protein refolding and/or by FPLC purification of the dimer fractions, highlighted in the non-reducing gel of Figure 10b.
  • Pluripotent human stem cells were cultured in NM23 variants and their ability to promote undifferentiated stem cell growth and to inhibit spontaneous differentiation of the cells was determined. Both human BGOlv/hOG and H9 embryonic stem cells were cultured in minimal stem cell media plus 8nM of either our standard NM23-S120G-RS or an NM23 variant. In all cases, the NM23 variants tested fully supported pluripotent stem cell growth. Cell morphology was typical of undifferentiated stem cells and was devoid of thickened or darkened areas that denote differentiation, see Figures 11-13, 15-19.
  • FIG. 22 compares expression levels of pluripotency genes Oct4 and Nanog plus MUC 1 and NM23 in stem cells that had been cultured in the NM23 variants for at least 4 passages.
  • the graph of Figure 22 shows that, for cells grown in the NM23 variants, the expression levels of these key indicators of pluripotency are the same or better than for cells cultured in NM23-S120G-RS, which is a population of pure dimers.
  • NM23 dimers mediate the growth of MUCl *-positive cancer cells and human pluripotent stem cells, which are all MUCl *-positive.
  • MUC 1* -positive cancer cells are incubated in media that contains NM23 in dimer form, the NM23 dimers bind to the MUC1 * receptor, become internalized and within 30-60 minutes are translocated to the nucleus where they likely function as transcription factors.
  • Figure 23 shows confocal images of cancer cells incubated in the presence or absence of either 0, 16nM or 128nM NM23-S120G-RS (100% dimer population). Cells were then stained with the nuclear stain DAPI and an anti-NM23 antibody was then added to the cells and a fluorescently labeled secondary antibody. Note that endogenous NM23 is also stained by the antibodies. However, there is only detectable NM23 in the nucleus when it is added exogenously as a dimer. Optimal concentrations for enhancing cell growth and for nuclear localization for NM23-S120G were previously determined to be between 8nM and 64nM.
  • each NM23 dimer binds to each MUC1* receptor rather than 1 dimer binding to and dimerizing two MUC1* receptors.
  • Figure 23 (b, e) shows NM23 in the nucleus as indicated by the white arrows.
  • Figure 24 shows confocal images of the same experiment except that the NM23 that has been added exogenously is the single chain "dimer" variant NM23-S120G- IgGlh/IgG2ah noC, which is two NM23-S120G monomers linked by a modified IgGl and IgG2a hinge regions, without cysteines, see Example 9e.
  • the NM23 single chain variant readily translocates to the nucleus (b, e), as indicated by the white arrows.
  • NM23 variants that are either single chain constructs or fusion proteins like those listed in Tables 3 and 4 represent an improvement over the state of the art because they increase the portion of dimer formed, increase dimer stability, and importantly can be expressed as a pseudo dimer in a cell or an organism, where expression and refolding methods required to form dimers of mutants that "prefer dimer formation" could not be done.
  • any of the mutants, deletions and/or single chain or fusion chimeras of the invention can be made to be secreted by expressing cells for use in vitro, ex vivo and/or in vivo.
  • Sequences that cause expressed proteins to be secreted are known to those skilled in the art. Particularly, sequences derived from antibodies are added to the N-terminus of the protein or to the 5 'end of the gene of interest.
  • the expression cell type need not be limited to E. coli and also includes mammalian cells, mammalian expression cells, yeast, somatic cells, stem cells, iPS cells or cells undergoing induction of pluripotency or induction to a less mature state than the starting cell.
  • NM23 mutants or variants thereof, be limited to use with human cells or in humans.
  • MUC 1 * has great sequence homology among mammals as does NM23.
  • Figure 25 shows that mouse embryonic stem cells grow as well in human NM23 dimers as they do in the standard mouse LIF.
  • Table 2 shows the various linkers that can be used with any ligand but with NM23 variants shown in Table 1 in preferred embodiments.
  • Table 2 also lists the portions of proteins that were genetically fused to ligand monomers listed in Table 1 to form constitutively active forms of the protein, which in an especially preferred embodiment is NM23.
  • mutants and variants that also favor dimer formation or stabilization.
  • another NM23 mutant that is easier to express and maintain as stable dimer is the P96S mutation.
  • Another approach to making variants that form or stabilize dimers is to delete regions of the protein that participate in the formation of the higher order multimers such as the tetramers and hexamers. For example, in NM23-H1 , the C-terminus promotes formation of tetramers and hexamers.
  • Deletions of 1-9 amino acids at the C-terminus are preferred for generating NM23 variants that have increased activity, including increased growth factor activity, increased binding to MUC 1 * growth factor receptor and/ or increased binding to nucleic acids that regulate expression of other pluripotency and multipotency genes.
  • CA2 amino acids are deleted (CA2) from the C-terminus of human NM23-H1.
  • 6 amino acids are deleted (CA6).
  • the protein can be made with one or more mutations plus deletions.
  • one NM23 variant that, when expressed as the recombinant protein, has a soluble fraction that is mostly dimer is NM23-P96S-CA6.
  • This NM23 is ideal for stimulation of stem or progenitor cell growth because it does not need to be denatured and refolded, has a major portion of the soluble fraction that is a dimer, and dimer populations that can be further purified by size exclusion chromatography remain stable for long periods of time.
  • Figure 14 c, d, e, and f show gel and FPLC trace of NM23-P96S-CA2 and NM23- P96S-CA6, respectively. Construct design and protein expression and purification are described in Example 2c.
  • Figure 15 shows photos of human ES cells that have been propagated using NM23-P96S-CA2 and NM23-P96S-CA6 in minimal media.
  • Figure 22 shows gene expression of these human stem cells after being propagated with this NM23 variant.
  • NM23-P96S-CA6 Gene expression levels are compared to growth of the same human embryonic cell line in either: a) bFGF and conditioned media from fibroblast feeder cells; b) NM23-S 120G refolded and purified as a homogeneous population of dimer; or c) NM23-P96S-CA6. These results confirm that stem cells cultured in both forms of NM23 are comparable at the genetic level. [00390] Other NM23 variants listed in Tables 1, 3 and 4 were generated as described in Examples 2 and 9. Figures 11-13 and 15-19 show that they effectively promoted the growth of human stem cells.
  • NM23 dimers Because the membrane proximal regions of MUC1, namely the MUC1* or PSMGFR region and the self-aggregation domain (IBR), are highly conserved among mammals, we tested and confirmed that NM23 dimers also promote the growth and maintenance of mouse stem cells. The invention also includes that NM23 dimers and in particular the variants described herein will act to maintain as well as induce pluripotency and multi-potency in human as well as mouse cells.
  • NM23 variants described herein can also be used as a vehicle for drug delivery for the treatment of MUC1* -positive cancers.
  • cytotoxic agents can be chemically coupled to the NM23 or NM23 variant.
  • Toxins may be genetically engineered such that they are attached to the NM23.
  • the NM23 variant can be modified, for example with cysteine or with certain enzyme-specific sequences that facilitate specific coupling of therapeutic agents to the NM23 variants.
  • NM23 in dimeric form binds to the MUC1* receptor on stem and progenitor cells. Binding to MUC 1 * facilitates endocytosis of NM23 dimers after which they are translocated to the nucleus, where NM23 binds to DNA as a dimer to regulate transcription of genes involved in the growth and maintaining pluripotency as well as multi-potency of stem and progenitor cells. Therefore, in one aspect, the invention is directed to using the methods described herein to make NM23 variants that prefer dimer formation for use in the growth, maintenance and induction of pluripotency.
  • NM23 variants that prefer dimer formation can be used in vitro to promote the growth of stem and progenitor cells and to maintain pluripotency or multipotency.
  • the invention also includes administration of these NM23 variants to a patient for the treatment of conditions that would benefit from treatment with immature cells, including stem and progenitor cells.
  • NM23 and NM23 variants can be administered to a patient either systemically or locally.
  • the invention also includes using similar methods to form multimers that are not dimers, such as higher order multimers including but not limited to tetramers or hexamers.
  • the multimers need not be the active state of the protein.
  • a patient is treated with an inactive form of a growth factor.
  • the inactive form is a hexamer.
  • the patient is a cancer patient and is treated with NM23 in hexameric form.
  • NM23 hexamers can be obtained by expressing the natural protein.
  • variants in which 4-6 monomers are connected using linkers and chimera strategies described herein More preferred are variants in which 4-6 monomers are connected using linkers and chimera strategies described herein.
  • linkers and chimera strategies described herein.
  • NM23 -antibody fragment chimeras wherein the Fc portion or the hinge region is taken from an IgM antibodies such that the NM23 would favor formation of pentamers.
  • Example 1 The MUC1* growth factor receptor is activated by ligand induced dimerization
  • Class I growth factor receptors are activated by ligand-induced dimerization of their extra cellular domain.
  • MUC1* positive cells ZR75-30 breast cancer cells with either the bivalent anti-MUCl* antibody or the monovalent Fab of the same antibody.
  • the graph of Figure 1 shows that the bivalent antibody stimulates growth until it is added at an excess concentration, when rather than ever bivalent antibody dimerizing two receptors, there is an antibody bound to each one receptor. This inhibits growth.
  • the addition of the Fab of the same antibody caused inhibition of cell growth and induced cell death.
  • MUC1* -negative HEK-293 cells K293 were not affected by either the bivalent or the monovalent Fab of the anti-MUCl* antibody.
  • NM23wt was amplified by polymerase chain reaction (PCR) using the following primers: [00402] Forward 5'-atcgatcatatggccaactgtgagcgtacctt-3' (SEQ ID NO:3)
  • the fragment was then purified, digested (Ndel, Xhol) and cloned between Ndel and Xhol restriction sites of the expression vector pET2 lb.
  • NM23-H1 mutant S120G (serine #120 mutated to a glycine) was made using the GeneTailorTM Site-directed mutagenesis system (Life Technologies) following the manufacturer instructions using the following primers: 5'-gcaggaacattatacatggcggtgattctg-3' (SEQ ID NO:5) and 5'-gccatgtataatgttcctgccaacttgtat-3' (SEQ ID NO:6).
  • Figure 2 shows overlay of FPLC traces comparing multimerization state of the wild type protein to the non- refolded S120G mutant and the refolded S120G.
  • Figures 3-5 show that only the dimeric form of the protein binds to MUC1* (not the hexamer) and only the dimer is able to support pluripotent stem cell growth.
  • Figure 16 shows non-reducing SDS-PAGE characterization and corresponding FPLC trace for the expressed and refolded protein as well as photographs of human stem cells, showing the NM23-S120G ability to support pluripotent stem cell growth.
  • Example 2c NM23 P96S and deletion constructs.
  • NM23 P96S AC 1 was amplified using the following primers: 5'- atcgatcatatggccaactgtgagcgtaccttc -3' (SEQ ID NO:9) and 5'-gtggtgaccggtatagatccagttctgagcaca-3' (SEQ ID NO:10).
  • NM23 P96S AC2 was amplified using the following primers: 5'-atcgatcatatggccaactgtgagcgtaccttc-3' (SEQ ID NO: 11) and 5'-gtggtgaccggtgatccagttctgagcacagct-3' (SEQ ID NO:12).
  • NM23 P96S AC6 was amplified using the following primers: 5'-atcgatcatatggccaactgtgagcgtaccttc-3' (SEQ ID NO: 13) and 5'-gtggtgaccggtagcacagctcgtgtaatctacca-3' (SEQ ID NO:14).
  • the resulting fragments were purified, digested (Ndel, Agel) and cloned between Ndel and Agel restriction sites of the expression vector pET21b.
  • the pET21b was previously modified by replacing the Xhol restriction by Agel using an overlap PCR method. Optimal dimer formation was observed when NM23-P96S was cloned between Ndel and Xhol.
  • Figure 14 shows non-reducing SDS-PAGE characterization and corresponding FPLC traces for these expressed proteins, wherein the proteins were not refolded or FPLC purified.
  • Figure 15 shows their ability to support pluripotent stem cell growth.
  • Example 3a Protein expression and optional refolding/purification.
  • LB broth Lia-Bertani broth
  • OD600 OD600
  • recombinant protein expression was induced with 0.4mM Isopropyl- -D-thio-galactoside (IPTG, Gold Biotechnology) and culture was stopped after 5h.
  • cell pellet was resuspended with running buffer: PBS pH7.4, 360 mM NaCl and 80 mM imidazole.
  • lysozyme (1 mg/mL, Sigma), MgCl 2 (0.5mM) and DNAse (0.5 ug/mL, Sigma) was added.
  • Cell suspension was incubated on a rotating platform (275 rpm) for 30 min at 37°C and sonicated on ice for 5 min.
  • Insoluble cell debris was removed by centrifugation (20000 rpm for 30 min at 4°c).
  • the cleared lysate was then applied to a Ni- NTA column (Qiagen) equilibrated with the running buffer. The column was washed (8CV) before eluting the protein off the column with the running buffer (6CV) supplemented with 420 mM imidazole.
  • Example 3b Optional protein denaturation for subsequent refolding.
  • the elution fractions were pooled and denatured by adding lvol of lOOmM Tris pH 8.0 + 8M urea, the solution was concentrated by half and another vol of lOOmM Tris pH 8.0 + 8M urea was added. This cycle was repeated until final urea concentration was ⁇ 7M. The protein was then refolded by dialysis.
  • Specific multimers can be further purified from a mixed pool using size exclusion chromatography, also called FPLC.
  • the dimer was further purified by size exclusion chromatography (Superdex 200) "FPLC".
  • FPLC fractions that were essentially 100% dimer were collected and pooled and aliquoted and stored at -80°C and are referred to herein as NM23-S120G-RS or S120G-RS.
  • the fractions containing the dimer were pooled,
  • Figure 2 shows the overlay of the FPLC traces that characterize the multimer composition of NM23-WT compared to NM23-S120G purified from the soluble fraction of a first preparation of the expressed protein (labeled here as NM23-si20G-hexamer), the soluble fraction of a second preparation (labeled here as NM23- si20G-mixed), or a preparation of S120G that was denatured and refolded (labeled here as NM23-si20G-dimer). 500 ul of each sample was loaded onto a Superdex 200 10/300 GL.
  • NM23-WT was at 0.17 mg/ml
  • NM23- S i 2 oG-hexamer was loaded at 0.19 mg/ml
  • NM23- S I 2 OG- mixed was loaded at 0.10 mg/ml
  • NM23-si 2 oG-dimer was loaded at 0.15 mg/ml.
  • NM23- WT and NM23-si 2 oG-hexamer have their major peak at 96 kDa, which corresponds to the molecular weight of an NM23 hexamer; NM23-si 2 oG-mixed and NM23-si 2 oG-dimer both have their major peak at 29 KDa, which corresponds to the dimer, however, the relative proportion of dimer in the refolded preparation, NM23-si 2 oG-dimer, is far greater than the fraction isolated from the soluble portion.
  • Example 5 Surface Plasmon Resonance (SPR) to test the ability of different NM23 multimers to bind to a MUC1* extra cellular domain peptide (PSMGFR) that was immobilized on an SPR chip.
  • SPR Surface Plasmon Resonance
  • NM23-S120G plus NM23-WT wild type were tested for their ability to bind to a MUC1* extra cellular domain peptide (PSMGFR sequence) using techniques of surface plasmon resonance.
  • the different preparations were first analyzed by FPLC to characterize them according to which multimers they formed.
  • FPLC analysis of the NM23 species that were tested is shown in Figure 2 and described above in Example 4.
  • the samples were also analyzed by gel electrophoresis on a non-reducing gel that does not disrupt disulfide binds, see Figure 3a.
  • NM23-S120G dimers show up on a non-reducing gel at approximately 40 KDa.
  • SPR Surface Plasmon Resonance
  • Biacore 3000 instrument Bare gold Biacore chips were coated with self-assembled monolayers (SAMs) according to methods of Bamdad, C. The use of variable density self-assembled monolayers to probe the structure of a target molecule. Biophys J. 1998 Oct;75(4): 1989-96. NTA- Ni-tri-ethylene glycol SAMs were formed to present 3.8% NTA-Ni, which binds to and captures histidine-tagged proteins. Histidine tagged PSMGFR peptide (MUCl* ecd peptide) was flowed over the chip surface and immobilized to saturation. Next, each of four different preparations of NM23-S120G were injected over a stable peptide surface.
  • SAMs self-assembled monolayers
  • SPR Surface Plasmon Resonance
  • the amount of NM23-WT or NM23-S120G-hexamer that bound to the MUC1* peptide was about 12-times less than the amount of NM23-S120G-dimer that bound.
  • an irrelevant peptide was immobilized on the same chip and a minimal amount of background binding resulted, which was subtracted from the measurement shown.
  • the amount of binding generated by the NM23-WT and NM23-S120G-hexamer (both comprised almost exclusively of hexamer) -lOORUs is often considered to be within the noise of the system.
  • the overlay of SPR traces shown in Figure 5 shows that roughly 8-times more "NM23- S120G-mixed" protein bound to a MUC1* extra cellular domain peptide surface than NM23- WT. Because the wild type protein is a hexamer, the number of RUs must be divided by 3 to compare to the amount of dimer that bound. Although both wild type and S120G-dimer show concentration dependence in binding, the amount of wild type hexamer that bound is so small that it may still be within the noise range of the system. Taken together, these SPR experiments indicate that the hexamer form of NM23 does not bind to the MUC1* receptor.
  • Example 6 Nanoparticle experiment is performed to further test the ability of NM23 dimers versus NM23 hexamers to bind to the MUCl* eC d peptide (PSMGFR).
  • NTA-Ni SAMs were formed on gold nanoparticles according to the methods of Thompson et al, dx.doi.org/10.1021/am200459a I ACS Appl. Mater. Interfaces 2011, 3, 2979-2987.
  • gold nanoparticles are coated with self-assembled monolayers (SAMs) that have NTA-Ni-thiols incorporated into the SAM.
  • SAMs self-assembled monolayers
  • the NTA-Ni moiety captures histidine-tagged proteins. If proteins immobilized on the nanoparticles recognize each other and draw the attached nanoparticles close together, an intrinsic property of the nano gold causes the solution to turn from the characteristic pink to blue.
  • NM23-S120G- dimer, NM23-WT, or NM23-S120G-hexamer were separately added to nanoparticles bearing MUCl*ecd peptides (PSMGFR).
  • the Fab of anti-MUC 1 * antibody which was raised against the PSMGFR peptide, was added to competitively inhibit binding of ligands to the peptide. As can be seen in the figure, the Fab inhibited the interaction of NM23 dimers and MUC 1 * peptide, showing that it was specific binding.
  • Example 7 Functional test of the ability of NM23 dimers versus hexamers to promote pluripotent stem cell growth
  • NM23, -WT, S120G-hexamer and S120G-dimer were tested for their ability to promote undifferentiated stem cell growth.
  • Human embryonic stem cells (H9) were cultured in minimal stem cell media (this media described in Example 8 below) that contained 8nM of one of the NM23 preparations.
  • the free MUCl* ecd peptide (PSMGFR) was added to competitively inhibit binding of NM23-S120G-dimers to the MUC1* receptor which is on all pluripotent stem cells.
  • the cells were plated at 200,000 cells per well of a 6- well plate that had been coated with an anti-MUCl* monoclonal antibody (MN-C3) to make the stem cells adhere. Media was changed every 48 hours as is typical. Photographs were taken on Day 4. Olympus IX 71 inverted microscope The results are shown in the photograph of Figure 3(d-g). Differentiating stem cells have a different morphology than pluripotent stem cells and appear as thickened, darkened areas of cells, whereas pluripotent stem cells grow in a single bright layer of cells. As can be seen in the figure, only the dimer preparation of NM23-S120G (d) was able to support the undifferentiated growth of stem cells.
  • MN-C3 anti-MUCl* monoclonal antibody
  • Wild type NM23 caused the stem cells to begin differentiating after three days, while NM23-S120G-hexamers had even more differentiation (e). However, the greatest amount of differentiation occurred as the result of competitively inhibiting the interaction between NM23 dimers and the MUC1* receptor (g).
  • the H9 stem cells were cultured in the standard 4 ng/mL bFGF plus 50% MEF condition media added to minimal stem cell media, wherein the stem cells were plated over a layer of Matrigel.
  • the NM23-S120G-RS as well as the NM23 variants performed as well or better than these controls.
  • NM23-WT is comprised essentially of all hexamer
  • the NM23-S120G-hexamer prep has a small population of dimer but is comprised mostly of hexamer.
  • the NM23-S120G-dimer prep is comprised mostly of dimer but has a small portion of tetramer.
  • NM23 with or without the mutations such as S120G, P96S, or C-terminal deletions can be engineered to prefer dimer formation by making a construct that links two protein monomers.
  • NM23-S120G or other mutation that makes the protein resist formation of tetramers and hexamers is preferred.
  • Table 2 gives the DNA sequence followed by the encoded amino acid sequence.
  • Figure 6 shows reducing and non-reducing SDS-PAGE characterization of single chain variants that had been refolded. The gels confirm that each runs with the apparent molecular weight of the monomer-linker-monomer.
  • the non-reducing gel shows minor populations of higher order multimers dependent on disulfide formation which was eliminated by addition of DTT, which like the cytoplasm produces a reducing environment.
  • a (GGGGS)x2 linker was introduced in frame of NM23 S120G (3') by PCR using the following primers:
  • NM23 S120G fragment was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Nhel/Xhol) and cloned in frame, between the Nhel and Xhol restrictions sites of the previously cloned NM23 S120G containing the (GGGGS)x2 linker.
  • the expressed protein can be purified and/or refolded, for in vitro applications, using the optional refolding protocol of Example 3b, with optional addition of l-5mM DTT.
  • Figure 11 shows FPLC analysis (a), SDS-PAGE characterization of the refolded protein (b) and the ability of the non-refolded, non-purified protein to support pluripotent stem cell growth (c-e).
  • Figure 17 shows the ability of this variant to support pluripotent stem cell growth without having to be refolded or purified.
  • Figure 26 shows photographs of non-reducing SDS-PAGE characterization of this variant, which has not been refolded, which shows that the major population is the dimer and it is essentially devoid of hexamer and other higher order multimers.
  • a (GGGGS)x3 linker was introduced in frame of NM23 S120G (3') by PCR using the following primers:
  • NM23 S120G fragment was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Nhel/Xhol) and cloned in frame, between the Nhel and Xhol restrictions sites of the previously cloned NM23 S120G containing the (GGGGS)x3 linker.
  • the expressed protein can be purified and/or refolded, for in vitro applications, using the optional refolding protocol of Example 3b, with optional addition of l-5mM DTT.
  • Example 9c NM23-S120G-IgGlh noC (modified hinge region of IgGl without cysteines)
  • a modified hinge region of IgGl without cysteine was introduced in frame of NM23 S120G (3') by 2 successive PCR reactions. First the following couple of primers were used:
  • NM23 S120G fragment was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Nhel/Xhol) and cloned in frame, between the Nhel and Xhol restrictions sites of the previously cloned NM23 S120G containing the modified hinge region linker.
  • the expressed protein can be purified and/or refolded, for in vitro applications, using the optional refolding protocol of Example 3b, with optional addition of 1 -5mM DTT.
  • Figures 7 shows purification of the expressed protein over a nickel column.
  • Figure 12 shows FPLC analysis (a), SDS-PAGE characterization of the refolded protein (b) and the ability of the non-refolded, non-purified protein to support pluripotent stem cell growth (c-e).
  • Figure 18 shows the ability of this variant to support pluripotent stem cell growth without having to be refolded or purified.
  • Figure 26 shows photographs of non-reducing SDS-PAGE characterization of this variant, which has not been refolded, which shows that the major population is the dimer and it is essentially devoid of hexamer and other higher order multimers.
  • Example 9d NM23 S120G IgG2a noC (modified hinge region of IgG2a without cysteines)
  • a modified hinge region of IgG2a without cysteine was introduced in frame of NM23 S120G (3') by 2 successive PCR reactions. First the following couple of primers were used:
  • NM23 S120G fragment was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Nhel/Xhol) and cloned in frame, between the Nhel and Xhol restrictions sites of the previously cloned NM23 S120G containing the modified hinge region linker.
  • the expressed protein can be purified and/or refolded, for in vitro applications, using the optional refolding protocol of Example 3b, with optional addition of 1 -5mM DTT.
  • Figures 7 shows purification of the expressed protein over a nickel column.
  • Figure 12 shows FPLC analysis (a), SDS-PAGE characterization of the refolded protein (b) and the ability of the non-refolded, non-purified protein to support pluripotent stem cell growth (c-e).
  • Example 9e NM23 S120G IgGlh/IgG2ah noC (modified hinge region of IgGl and IgG2a without cysteines)
  • PCR fragment was purified and used as template in a second PCR reaction using the following primers:
  • PCR fragment was purified and used as template in a fourth PCR reaction using the following primers:
  • NM23 S120G fragment was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Nhel/Xhol) and cloned in frame, between the Nhel and Xhol restrictions sites of the previously cloned NM23 S120G containing both IgGl and IgG2a modified hinge region linker.
  • the expressed protein can be purified and/or refolded, for in vitro applications, using the optional refolding protocol of Example 3b, with optional addition of l-5mM DTT.
  • Figure 13 shows FPLC analysis (a), SDS-PAGE characterization of the refolded protein (b) and the ability of the non-refolded, non-purified protein to support pluripotent stem cell growth (c-e).
  • Figure 18 shows the ability of this variant to support pluripotent stem cell growth without having to be refolded or purified.
  • Figure 26 shows photographs of non-reducing SDS-PAGE characterization of this variant, which has not been refolded, which shows that the major population is the dimer and it is essentially devoid of hexamer and other higher order multimers.
  • a fusion protein in which NM23-wt or preferably S120G mutant is genetically fused to a protein that naturally dimerizes is another method of producing an NM23 variant that prefers dimer formation and if the S120G mutation is included the resultant dimers will resist forming the higher order multimers such as tetramers and hexamers.
  • One way to do this is to fuse NM23, or a portion of NM23 that binds to the MUCl* peptide, to the Fc portion of an antibody.
  • the Fc portion of antibodies homo-dimerizes via disulfide bonds between cysteines.
  • This construct consists of the NM23-S120G protein connected to the Fc region of an IgG antibody.
  • the fusion protein can be purified over a protein A or Protein G column. Cleavage with Pepsin cleaves the Fc region and releases the portion just below the Cysteines.
  • Example 10a NM23 S120G-IgGl Fc (NM23 fused to the Fc region antibody)
  • NM23 S120G was amplified by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Ndel, Xhol) and cloned between Ndel and Xhol restriction sites of the expression vector pET21b.
  • the Fc region of IgGl was amplified by PCR using the following primers:
  • the fragment was then purified, digested (Xhol) and cloned in frame (at the Xhol restriction site) of the previously cloned NM23 S120G.
  • the expressed protein can be purified and/or refolded, for in vitro applications. If protein is in inclusion bodies: after harvesting the cells by centrifugation (6000 rpm for 10 min at 4°C), cell pellet was resuspended with running buffer: lOOmM NaF ⁇ PC , lOmM Tris pH 8.0, 10 mM imidazole and 8M urea. The solution was incubated on a rotating platform (275 rpm) for 30min at 37°C and sonicated on ice for 5 min.
  • protein expression can be directed to the periplasm of the expressing cell which has been shown to favor disulfide bond formation and allowing the protein to be folded correctly and soluble.
  • Figures 8-10 show the purification, SDS-PAGE and FPLC characterization of this variant.
  • Example 10b NM23 S120G IgGlh (NM23 fused to the hinge region of IgGl)
  • the IgGl hinge region was fused 3' to NM23 S120G by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Ndel, Xhol) and cloned between Ndel and Xhol restriction sites of the expression vector pET21b.
  • the expressed protein can be purified and/or refolded, for in vitro applications as described in Example 10a.
  • Example 10c NM23 S120G IgG2ah( NM23 fused to the hinge region of
  • the IgG2a hinge region was fused 3' to NM23 S120G by polymerase chain reaction (PCR) using the following primers:
  • the fragment was then purified, digested (Ndel, Xhol) and cloned between Ndel and Xhol restriction sites of the expression vector pET21b.
  • the expressed protein can be purified and/or refolded, for in vitro applications as described in Example 10a.
  • NM23 variants that were generated were first tested for their ability to form dimers.
  • the single chain constructs should migrate through a reducing SDS-PAGE gel with the molecular weight of the monomer-linker-monomer.
  • the single chain variants migrate with the apparent molecular weight of the dimer, while the higher order multimers generally run with the apparent molecular weight of the monomer.
  • the characteristic tetramers and hexamers do not depend on disulfide bonds to multimerize, while dimers of native NM23, NM23-S120G and NM23-P96S and other variants do depend on disulfide bonds.
  • Native gels and FPLC were also used to determine the multimerization state of the variants.
  • Example lib Ability to promote pluripotent stem cell growth
  • Either H9 or BGOlv/hOG embryonic stem cells were plated onto either Matrigel coated or anti-MUCl* (MN-C3) antibody coated 6-well cell culture plates at a density of 200,000 cells per well.
  • the cells were cultured in minimal stem cell media (see Example 8) to which was added 8nM NM23-S120G-RS or an NM23 variant of the invention.
  • Media was changed every 24 hours for the BGOlv/hOG cells and every 48 hours for the H9 cells.
  • a Rho kinase inhibitor was added at each media change for the BGOlv/hOG cells but only for the first 48 hours for the H9 cells.
  • Cells were cultured for four days and then photographed under magnification. Figures 11-13 and 15-19 show the results.
  • the cell morphology indicates that the cells are undifferentiated in that they are a single layer devoid of clumping or darkening.
  • Example 11c Growth rate of stem cells cultured in NM23 variants
  • the growth rate of stem cells cultured in media containing the NM23 variants was compared to the growth rate of identical cells cultured in NM23-S120G "RS" that had been refolded and then purified by FPLC so that the isolated fractions were essentially 100% dimer.
  • 200,000 stem cells all drawn from the same source human ES - BGOlv/hOG were cultured in either NM23- S120G RS or one of the NM23 variants shown in Figures 20 and 21.
  • Example lid RT-PCR analysis of expression levels of pluripotency genes in stem cells cultured in NM23 variants
  • FIG. 22 compares expression levels of pluripotency genes Oct4 and Nanog plus MUC1 and NM23 in stem cells that had been cultured in the NM23 variants for at least 4 passages.
  • the graph of Figure 22 shows that, for cells grown in the NM23 variants, the expression levels of these key indicators of pluripotency are the same or better than for cells cultured in NM23-S120G RS, which is a population of pure dimers.
  • RNA samples were collected. The cells were pelleted and frozen at -70°C. Total RNA was extracted from the samples using TRIzol ® Reagent. Quantification of NANOG, OCT4, MUCl, NM23 and GAPDH in the RNA samples was performed using TaqMan ® One Step RT-PCR Master Mix Reagents. The real-time PCR data were analyzed using the comparative C t method. The relative amount of each transcript in each sample was obtained by computing the difference between the target C t and the corresponding GAPDH (AC t ). A second normalization was performed by subtracting the RS sample AC t from all the others in the data set (AAC t ).
  • Example lie Ability of NM23 variants to penetrate cell membrane and translocate to the nucleus
  • NM23 dimers mediate the growth of MUCl* -positive cancer cells and human pluripotent stem cells, which are all MUCl *-positive.
  • MUCl* -positive cancer cells are incubated in media that contains NM23 in dimer form, the NM23 dimers bind to the MUCl * receptor, become internalized and within 30-60 minutes are translocated to the nucleus where they likely function as transcription factors.
  • Figure 23 shows confocal images of cancer cells incubated in the presence or absence of either 0, 16nM or 128nM NM23-S120G RS (100% dimer population). Cells were then stained with the nuclear stain DAPI and an anti-NM23 antibody was then added to the cells and a fluorescently labeled secondary antibody. Note that endogenous NM23 is also stained by the antibodies. However, there is only detectable NM23 in the nucleus when it is added exogenously as a dimer. Optimal concentrations for enhancing cell growth and for nuclear localization for NM23-S120G were previously determined to be between 8nM and 64nM.
  • each NM23 dimer binds to each MUCl * receptor rather than 1 dimer binding to and dimerizing two MUCl* receptors.
  • Figure 23 (b, e) shows NM23 in the nucleus as indicated by the white arrows.
  • Figure 24 shows confocal images of the same experiment except that the NM23 that has been added exogenously is the single chain "dimer" variant NM23-S120G-IgGlh/IgG2ah noC, which is two NM23-S120G monomers linked by a modified IgGl and IgG2a hinge regions, without cysteines, see Example 9e.
  • the NM23 single chain variant readily translocates to the nucleus (b, e), as indicated by the white arrows.
  • T47D breast cancer cells were initially plated onto collagen- coated 8-well chambers containing 10% FBS RPMI media for 24 hrs followed by serum- starvation (1% FBS RPMI) for 24 hrs, at 37°C, 5 % C0 2 . Subsequently T47D cells were incubated with 16 nM or 128 nM NM23 S I 2 OGRS or NM23i gG i/igG 2 a in 10 % FBS RPMI for 30 minutes. T47D cells were then fixed in 4% paraformaldehyde.
  • NM23 supports proliferation of mouse ES cells with pluripotent colony morphology.
  • Mouse ES cells (129/S6, EMD Millipore, Billerica, MA) were cultured on inactivated MEF feeder cell layers for two days in mouse ES cell minimal medium (mESC- MM) supplemented with either 1,000 U/mL recombinant mLIF (a, c) (EMD Millipore) or 16 nM NM23-S120G-RS (b, d), and photographed at low magnification under phase-contrast illumination. Size bars indicate 500 microns. In both cases, single cells and colonies consisting of just a few cells on day 1 give rise to larger multicellular oval colonies with bright, defined edges typical of pluripotent mouse ES cells.
  • mESC-MM consists of KnockOut D-MEM basal medium, 15% KnockOut Serum Replacement, IX GlutaMax I, IX OptiMEM non-essential amino acids, 0.1 mM B-ME (Life Technologies, Carlsbad, CA), and IX Penicillin/Streptomycin (Lonza, Allendale, NJ).
  • Results are shown in Figure 25 and demonstrate that mouse stem cells grow equally well in NM23 (human) as they do in mouse stem cell media with mouse LIF as the growth factor. Therefore, NM23 variants described herein can be used in mouse cell systems and mouse NM23 and NM23 variants can be used in human cell systems.
  • Example 13 Generation of constructs that are secreted by the expressing cell
  • any of the mutants, deletions and/or single chain or fusion chimeras of the invention can be made to be secreted by the expressing cells for use in vitro, ex vivo and/or in vivo.
  • Sequences that cause expressed proteins to be secreted are known to those skilled in the art. Particularly, sequences derived from antibodies are added to the N-terminus of the protein or to the 5 'end of the gene of interest.
  • the expression cell type need not be limited to E. coli and also includes mammalian cells, mammalian expression cells, yeast, somatic cells, stem cells, iPS cells or cells undergoing induction of pluripotency or induction to a less mature state than the starting cell.
  • Example 14 Comparison of recombinant NM23-WT, S120G and variants of the invention without refolding
  • NM23 variants of the invention are designed to spontaneously form stable dimers without the necessity of denaturation and refolding which cannot be done in an in vivo setting.
  • NM23-WT, NM23-S120G and variants NM23-S120G-GS2 IgGlh-noC, IgGlh/IgG2ah-noC were expressed and without denaturation or refolding were characterized by non-reducing SDS-PAGE.
  • the gel of Figure 26 shows that only the protein variants migrate as dimer.
  • the wild type NM23 and the NM23-S120G (non refolded) run with the apparent molecular weight of the monomer on a non-reducing gel.
  • the NM23 hexamer runs as a monomer on non-reducing gels because its multimerization does not depend on disulfide bonds but has been shown by FPLC to actually be the hexamer (see Figures 2,3a, and 4 for comparison).
  • Example 15 Identification of mutants that prefer dimerization and resist formation of higher order multimers.
  • Mutations that promote cancer or stem cell growth can be identified by sequencing NM23 from several cancers.
  • the S120G mutant was isolated from a neuroblastoma.
  • the limiting factor is the amount of time to screen the many possible mutations in a cell-based assay.
  • a convenient method for testing mutants for their ability to form dimers and also resist formation of higher order multimers is to test the mutants for their ability to bind to the MUC1* peptide. As we have shown, NM23 tetramers and hexamers do not bind to MUC1* peptide.
  • An assay that simultaneously identifies mutants that form dimers but not tetramers and hexamers is a nanoparticle assay in which the MUC1* peptide is loaded onto gold nanoparticles.
  • each mutant is added to the peptide-bearing nanoparticles. If the mutant readily forms dimers, the dimeric NM23 binds to the particle-immobilized MUC 1 * peptides and draws the particles close together which causes the particle solution to change from pink to blue. If the mutants are added at high concentration, the mutants that are still able to form tetramers and hexamers will do so, which will not bind to the peptides and the solution will remain pink. Therefore, mutants that prefer dimer formation and do not form the inactive hexamers are readily identified because they will turn the nanoparticle solution blue even when added at high concentrations of for example more than 500nM.
  • Example 16 Human BGOlv/hOG embryonic stem cells were plated on to Vita plates coated with 12.5ug per well of a monoclonal anti-MUCl* antibody (MN-C3) at a cell density of 100,000 cells per well of a 6-well cell culture plate. The cells were cultured for 2 days in NM23 variants that had been refolded according to the optional refolding protocol of Example 3.
  • MN-C3 monoclonal anti-MUCl* antibody
  • NM23 variants used at 8nM in minimal stem cell media were NM23-S120G-RS (a,e), NM23-S120G-GS2 ("R" in figure denotes refolded) (b,f), NM23-S120G-IgGlh noC (c,g), and NM23-S120G-IgGlh/IgG2ah noC (d,h).
  • NM23-S120G-RS a,e
  • NM23-S120G-GS2 ("R” in figure denotes refolded)
  • c,g NM23-S120G-IgGlh noC
  • d,h NM23-S120G-IgGlh/IgG2ah noC

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Diabetes (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2012/036975 2011-05-09 2012-05-08 Genetically engineered growth factor variants Ceased WO2012154759A2 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
JP2014510413A JP2014517690A (ja) 2011-05-09 2012-05-08 遺伝子操作した成長因子変異体
CA2835453A CA2835453A1 (en) 2011-05-09 2012-05-08 Genetically engineered growth factor variants
EP12782984.4A EP2707021B1 (en) 2011-05-09 2012-05-08 Genetically engineered growth factor variants
CN201280034119.XA CN103930439A (zh) 2011-05-09 2012-05-08 基因工程生长因子变异体
AU2012253652A AU2012253652B2 (en) 2011-05-09 2012-05-08 Genetically engineered growth factor variants
CN201280062509.8A CN103998598A (zh) 2011-10-17 2012-10-17 用于干细胞增殖和诱导的培养基
PCT/US2012/060684 WO2013059373A2 (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
JP2014537191A JP6466170B2 (ja) 2011-10-17 2012-10-17 幹細胞の増殖及び誘導用の培地
CN201811288611.5A CN109456932A (zh) 2011-10-17 2012-10-17 用于干细胞增殖和诱导的培养基
CA2852244A CA2852244C (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
AU2012326137A AU2012326137B2 (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
EP12841648.4A EP2768945B1 (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
IL229316A IL229316B (en) 2011-05-09 2013-11-07 Genetically engineered growth factor variants
US14/077,061 US20140065113A1 (en) 2011-05-09 2013-11-11 Genetically engineered growth factor variants
IL232107A IL232107B (en) 2011-10-17 2014-04-13 Methods for stimulating the growth of stem cells or progenitor cells, for inducing the return of cells to a lower degree of maturity and for creating stem cell populations
JP2016231442A JP2017074054A (ja) 2011-10-17 2016-11-29 幹細胞の増殖及び誘導用の培地
US16/447,812 US20200062812A1 (en) 2011-05-09 2019-06-20 Nucleic acid encoding genetically engineered growth factor variants
JP2020122592A JP2020182483A (ja) 2011-10-17 2020-07-17 幹細胞の増殖及び誘導用の培地
JP2021211485A JP2022046658A (ja) 2011-10-17 2021-12-24 幹細胞の増殖及び誘導用の培地
JP2023216113A JP2024038024A (ja) 2011-10-17 2023-12-21 幹細胞の増殖及び誘導用の培地
US18/640,690 US20240294590A1 (en) 2011-05-09 2024-04-19 Nucleic acid encoding genetically engineered growth factor variants

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161484052P 2011-05-09 2011-05-09
US61/484,052 2011-05-09

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/077,061 Continuation US20140065113A1 (en) 2011-05-09 2013-11-11 Genetically engineered growth factor variants

Publications (2)

Publication Number Publication Date
WO2012154759A2 true WO2012154759A2 (en) 2012-11-15
WO2012154759A3 WO2012154759A3 (en) 2014-05-01

Family

ID=47139949

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/036975 Ceased WO2012154759A2 (en) 2011-05-09 2012-05-08 Genetically engineered growth factor variants

Country Status (8)

Country Link
US (3) US20140065113A1 (enExample)
EP (1) EP2707021B1 (enExample)
JP (5) JP2014517690A (enExample)
CN (2) CN112028985A (enExample)
AU (1) AU2012253652B2 (enExample)
CA (1) CA2835453A1 (enExample)
IL (1) IL229316B (enExample)
WO (1) WO2012154759A2 (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2016514099A (ja) * 2013-02-20 2016-05-19 ミネルバ バイオテクノロジーズ コーポレーション Nme阻害剤、及びnme阻害剤を使用する方法
US12195728B2 (en) 2011-03-17 2025-01-14 Minerva Biotechnologies Corporation Method for making pluripotent stem cells
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2835453A1 (en) * 2011-05-09 2012-11-15 Minerva Biotechnologies Corporation Genetically engineered growth factor variants
WO2016061396A1 (en) * 2014-10-16 2016-04-21 Counsyl, Inc. Variant caller
CA3172530A1 (en) 2021-02-25 2022-09-01 Spencer PARK Ror1 targeting chimeric antigen receptor
CN117736272B (zh) * 2024-02-19 2024-04-30 四川省医学科学院·四川省人民医院 一种具有促成骨功能的生物活性多肽

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1991005793A1 (en) * 1989-10-18 1991-05-02 The United States Of America, As Represented By The Secretary, U.S. Department Of Commerce Production and use of human nm23 protein and antibodies therefor
US5958671A (en) * 1996-04-23 1999-09-28 Presidents And Fellows Of Harvard College Methods and compositions for regulating T cell subsets by modulating transcription factor activity
US20050112607A1 (en) * 1999-01-23 2005-05-26 Bamdad Cynthia C. Rapid and sensitive detection of protein aggregation
US7550143B2 (en) * 2005-04-06 2009-06-23 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
ATE407697T1 (de) * 1999-07-13 2008-09-15 Bolder Biotechnology Inc Erythropoietin immunglobulin fusionsproteine
BR0013231A (pt) * 1999-08-09 2002-07-23 Lexigen Pharm Corp Complexos citocina-anticorpo múltiplos
US20020169290A1 (en) * 2000-11-02 2002-11-14 Claus Bornaes New multimeric interferon beta polypeptides
WO2002036626A1 (en) * 2000-11-02 2002-05-10 Maxygen Aps Single-chain multimeric polypeptides
US7829084B2 (en) * 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
US20030008820A1 (en) * 2001-03-27 2003-01-09 Massachusetts Institute Of Technology Methods and products related to FGF dimerization
EP1353182A3 (en) * 2002-04-12 2004-02-04 Smithkline Beecham Corporation Method of predicting cell-based assay results using binding profiles
WO2004028551A1 (en) * 2002-09-24 2004-04-08 The Burnham Institute Novel agents that modulate eph receptor activity
US7700097B2 (en) * 2003-06-27 2010-04-20 Biogen Idec Ma Inc. Purification and preferential synthesis of binding molecules
US20050054752A1 (en) * 2003-09-08 2005-03-10 O'brien John P. Peptide-based diblock and triblock dispersants and diblock polymers
BRPI0507174A (pt) * 2004-01-28 2008-04-01 Syntonix Pharmaceuticals Inc proteìnas de fusão hormÈnio-fc (fsh-fc) heterodiméricas estimuladoras de folìculo para o tratamento da infertilidade
CN105837690A (zh) * 2006-06-12 2016-08-10 新兴产品开发西雅图有限公司 具有效应功能的单链多价结合蛋白
CN101652469B (zh) * 2006-12-06 2014-04-16 米纳瓦生物技术公司 用于鉴定和操作细胞的方法
KR20110044992A (ko) * 2008-07-02 2011-05-03 이머전트 프로덕트 디벨롭먼트 시애틀, 엘엘씨 TGF-β 길항제 다중-표적 결합 단백질
EP4201421A1 (en) * 2008-10-09 2023-06-28 Minerva Biotechnologies Corporation Method for inducing pluripotency in cells
EP2440652B1 (en) * 2009-06-11 2019-11-27 Minerva Biotechnologies Corporation Methods for culturing stem and progenitor cells
WO2011103049A2 (en) * 2010-02-16 2011-08-25 Immune Disease Institute, Inc. Method for screening receptors/ligands interactions
JP6196163B2 (ja) * 2011-03-17 2017-09-13 ミネルバ バイオテクノロジーズ コーポレーション 多能性幹細胞を作製する方法
CA2835453A1 (en) * 2011-05-09 2012-11-15 Minerva Biotechnologies Corporation Genetically engineered growth factor variants

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP2707021A4 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12195728B2 (en) 2011-03-17 2025-01-14 Minerva Biotechnologies Corporation Method for making pluripotent stem cells
JP2016514099A (ja) * 2013-02-20 2016-05-19 ミネルバ バイオテクノロジーズ コーポレーション Nme阻害剤、及びnme阻害剤を使用する方法
JP2019206527A (ja) * 2013-02-20 2019-12-05 ミネルバ バイオテクノロジーズ コーポレーション Nme阻害剤、及びnme阻害剤を使用する方法
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof

Also Published As

Publication number Publication date
JP2024056702A (ja) 2024-04-23
EP2707021B1 (en) 2024-02-21
JP6717725B2 (ja) 2020-07-01
US20240294590A1 (en) 2024-09-05
WO2012154759A3 (en) 2014-05-01
JP2022031824A (ja) 2022-02-22
IL229316B (en) 2020-02-27
JP2017061471A (ja) 2017-03-30
AU2012253652B2 (en) 2017-07-06
JP2020039359A (ja) 2020-03-19
AU2012253652A1 (en) 2013-11-28
EP2707021C0 (en) 2024-02-21
JP2014517690A (ja) 2014-07-24
CA2835453A1 (en) 2012-11-15
IL229316A0 (en) 2014-01-30
EP2707021A2 (en) 2014-03-19
EP2707021A4 (en) 2015-08-05
US20140065113A1 (en) 2014-03-06
CN103930439A (zh) 2014-07-16
CN112028985A (zh) 2020-12-04
US20200062812A1 (en) 2020-02-27

Similar Documents

Publication Publication Date Title
US20240294590A1 (en) Nucleic acid encoding genetically engineered growth factor variants
JP6783797B2 (ja) 抗がん融合ポリペプチド
JP5787757B2 (ja) Fgfr細胞外ドメイン酸性領域突然変異タンパク質
JP6170435B2 (ja) 改変ノッチンペプチドを含む融合タンパク質及びその使用
KR102113809B1 (ko) 조직 재생을 유도하기 위한 펩티드 및 그의 이용
JP6901834B2 (ja) Sirp−アルファ変異体構築物及びその使用
JP6809789B2 (ja) 疾患の治療または予防に用いるためのファクター1およびファクター2タンパク質、およびその阻害剤
TWI237056B (en) Fusion protein having enhanced in vivo activity of erythropoietin
CA2658231C (en) Method of producing recombinant tat-hoxb4h protein for use as a stimulant of hematopoiesis in vivo
RS58839B1 (sr) Muteini lipokalina u suzama koji vezuju il-4 r alfa
AU2015205918A1 (en) Methods for increasing thermogenic adipocytes
JP2018526033A (ja) キメラ抗原受容体およびその使用
WO2017083545A1 (en) Nkg2d decoys
JP2017505141A (ja) 長時間作用型インスリンおよびその使用
JP2018538356A (ja) 組織修復のための二重特異性治療用タンパク質
AU2019202199A1 (en) NME inhibitors and methods of using NME inhibitors
KR20160142372A (ko) 항-nme 항체
JP2021526835A (ja) 二機能性および三機能性融合タンパク質およびその使用
JP2014517690A5 (enExample)
CN109996817A (zh) 扭转原肠胚形成多肽及其用途
CN101914161B (zh) 抑制肿瘤生长的融合蛋白HGFα-Fc及其用途
JP2022525661A (ja) 組換えccnドメインタンパク質および融合タンパク質
KR20200100588A (ko) 재조합 폴리펩티드에서의 조작된 o-당화 및 이의 용도
US20220177548A1 (en) Methods and Compositions for Treating Melanoma
WO2005079859A1 (ja) 標的指向性運搬体

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12782984

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2835453

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014510413

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2012253652

Country of ref document: AU

Date of ref document: 20120508

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2012782984

Country of ref document: EP