WO2012138927A2 - Method for the generation of compact tale-nucleases and uses thereof - Google Patents

Method for the generation of compact tale-nucleases and uses thereof Download PDF

Info

Publication number
WO2012138927A2
WO2012138927A2 PCT/US2012/032426 US2012032426W WO2012138927A2 WO 2012138927 A2 WO2012138927 A2 WO 2012138927A2 US 2012032426 W US2012032426 W US 2012032426W WO 2012138927 A2 WO2012138927 A2 WO 2012138927A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
domain
compact talen
terminus
dna
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/032426
Other languages
English (en)
French (fr)
Other versions
WO2012138927A3 (en
Inventor
Philippe Duchateau
Alexandre Juillerat
Julien Valton
Claudia BERTONATI
Jean-Charles Epinat
George H. Silva
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DK12725896.0T priority Critical patent/DK2694091T3/da
Priority to ES12725896T priority patent/ES2728436T3/es
Priority to EP12725896.0A priority patent/EP2694091B1/en
Priority to CA2832534A priority patent/CA2832534C/en
Priority to CN201280027394.9A priority patent/CN103608027B/zh
Priority to AU2012240110A priority patent/AU2012240110B2/en
Priority to JP2014504007A priority patent/JP5996630B2/ja
Priority to SG2013074745A priority patent/SG194115A1/en
Application filed by Individual filed Critical Individual
Priority to KR1020137029369A priority patent/KR101982360B1/ko
Publication of WO2012138927A2 publication Critical patent/WO2012138927A2/en
Publication of WO2012138927A3 publication Critical patent/WO2012138927A3/en
Anticipated expiration legal-status Critical
Priority to IL228747A priority patent/IL228747B/en
Priority to AU2017248447A priority patent/AU2017248447B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/07Fusion polypeptide containing a localisation/targetting motif containing a mitochondrial localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/26Preparation of nitrogen-containing carbohydrates
    • C12P19/28N-glycosides
    • C12P19/30Nucleotides
    • C12P19/34Polynucleotides, e.g. nucleic acids, oligoribonucleotides

Definitions

  • the present invention relates to a method for the generation of compact Transcription Activator- Like Effector Nucleases (TALENs) that can efficiently target and process double-stranded DNA. More specifically, the present invention concerns a method for the creation of TALENs that consist of a single TALE DNA binding domain fused to at least one catalytic domain such that the active entity is composed of a single polypeptide chain for simple and efficient vectorization and does not require dimerization to target a specific single double-stranded DNA target sequence of interest and process DNA nearby said DNA target sequence. The present invention also relates to compact TALENs, vectors, compositions and kits used to implement the method.
  • TALENs Transcription Activator- Like Effector Nucleases
  • DSBs double-strand breaks
  • HR homologous recombination
  • SSA Single-strand annealing
  • HAT Homologous gene targeting
  • Orr- Weaver Szostak et al. 1981
  • Orr-Weaver Szostak et al. 1983
  • Rothstein 1983 was one of the first methods for rational genome engineering and remains to this day a standard for the generation of engineered cells or knock-out mice (Capecchi 2001).
  • An inherently low efficiency has nevertheless prevented it from being used as a routine protocol in most cell types and organisms.
  • an extensive assortment of rational approaches has been proposed with the intent of achieving greater than 1% targeted modifications.
  • matrix optimization methods, essentially consisting of modifying the targeting vector structure to achieve maximal efficacy, and; (ii) methods involving additional effectors to stimulate HR, generally sequence-specific endonucleases.
  • matrix optimization has covered a wide range of techniques, with varying degrees of success (Russell and Hirata 1998; Inoue, Dong et al. 2001; Hirata, Chamberlain et al. 2002; Taubes 2002; Gruenert, Bruscia et al. 2003; Sangiuolo, Scaldaferri et al. 2008; Bedayat, Abdolmohamadi et al. 2010).
  • Stimulation of HR via nucleases has repeatedly proven efficient (Paques and Duchateau 2007; Carroll 2008).
  • DSBs induced by biological reagents e.g. meganucleases, ZFNs and TALENs (see below), which cleave DNA by hydrolysis of two phosphodiester bonds
  • the DNA can be rejoined in a seamless manner by simple re-ligation of the cohesive ends.
  • deleterious insertions or deletions indels of various sizes can occur at the breaks, eventually resulting in gene inactivation (Liang, Han et al. 1998; Lloyd, Plaisier et al. 2005; Doyon, McCammon et al. 2008; Perez, Wang et al. 2008; Santiago, Chan et al. 2008; Kim, Lee et al.
  • Targeted mutagenesis based on NEHJ has been used to trigger inactivation of single or even multiple genes in immortalized cell lines (Cost, Freyvert et al. 2010; Liu, Chan et al. 2010).
  • this method opens new perspectives for organisms in which the classical HR-based gene knock-out methods have proven inefficient, or at least difficult to establish (Doyon, McCammon et al. 2008; Geurts, Cost et al. 2009; Shukla, Doyon et al. 2009; Yang, Djukanovic et al. 2009; Gao, Smith et al. 2010; Mashimo, Takizawa et al. 2010; Menoret, Iscache et al. 2010).
  • Member proteins are composed of domains that adopt a similar ⁇ fold, with the LAGLIDADG motif comprising the terminal region of the first helix and not only contributing to a bipartite catalytic center but also forming the core subunit/subunit interaction (Stoddard 2005). Two such ⁇ / ⁇ domains assemble to form the functional protein, with the ⁇ -strands in each creating a saddle- shaped DNA binding region. The spatial separation of the catalytic center with regions directly interacting with the DNA has allowed for specificity re-engineering (Seligman, Chisholm et al. 2002; Sussman, Chadsey et al. 2004; Arnould, Chames et al.
  • LAGLIDADG HEs members from two other families, GIY-YIG and HNH, are of particular interest. Biochemical and structural studies have established that in both families, member proteins can adopt a bipartite fold with distinct functional domains: (1) a catalytic domain responsible mainly for DNA cleavage, and; (2) a DNA-binding domain to provide target specificity (Stoddard 2005; Marcaida, Munoz et al. 2010).
  • the related GIY-YIG HEs I- Tevl and l-Bmol have been exploited to demonstrate the interchangeability of the DNA-binding region for these enzymes (Liu, Derbyshire et al. 2006).
  • IENR1 intron-encoded endonuclease repeat motif found in endonucleases of the GIY-YIG family.
  • the catalytic head of l-Basl has sequence similarity to those of the HNH HEs l-Hmul, l-Hmull and l-Twol, all of which function as strand-specific nickases (Landthaler, Begley et al. 2002; Landthaler and Shub 2003; Landthaler, Lau et al.
  • HNH motif has also been identified in nonspecific nucleases such the E.coli colicins (e.g. ColE9 and ColE7), EndA from S.pneumoniae, NucA from Anabaena and CAD (Midon, Schafer et al. 2011).
  • E.coli colicins e.g. ColE9 and ColE7
  • EndA from S.pneumoniae
  • NucA from Anabaena
  • CAD Mordon, Schafer et al. 2011
  • several of these nucleases contain the signature DRGH motif and share structural homology with core elements forming the ⁇ -Me-finger active site motif.
  • Zinc-finger nucleases generated by fusing Zinc-finger-based DNA-binding domains to an independent catalytic domain via a flexible linker (Kim, Cha et al. 1996; Smith, Berg et al. 1999; Smith, Bibikova et al. 2000), represent another type of engineered nuclease commonly used to stimulate gene targeting.
  • the archetypal ZFNs are based on the catalytic domain of the Type IIS restriction enzyme Fokl and have been successfully used to induce gene correction, gene insertion, and gene deletion.
  • Zinc Finger-based DNA binding domains are made of strings of 3 or 4 individual Zinc Fingers, each recognizing a DNA triplet (Pabo, Peisach et al. 2001).
  • ZFNs are easy to design, using combinatorial assembly of preexisting Zinc Fingers with known recognition patterns (Choo and Klug 1994; Choo and Klug 1994; Kim, Lee et al. 2009).
  • close examination of high resolution structures shows that there are actually crosstalks between units (Elrod-Erickson, Rould et al. 1996), and several methods have been used to assemble ZF proteins by choosing individual Zinc Fingers in a context dependant manner (Greisman and Pabo 1997; Isalan and Choo 2001; Maeder, Thibodeau-Beganny et al. 2008; Ramirez, Foley et al. 2008) to achieve better success rates and reagents of better quality.
  • TALE Transcription Activator Like Effectors
  • each base pair in the DNA target is contacted by a single repeat, with the specificity resulting from the two variant amino acids of the repeat (the so-called repeat variable dipeptide, RVD).
  • RVD repeat variable dipeptide
  • TALEN Fokl-based TALE-nuclease
  • the functional layout of a Fokl-based TALE-nuclease is essentially that of a ZFN, with the Zinc-finger DNA binding domain being replaced by the TALE domain (Christian, Cermak et al. 2010; Li, Huang et al. 2011).
  • DNA cleavage by a TALEN requires two DNA recognition regions flanking an unspecific central region. This central "spacer" DNA region is essential to promote catalysis by the dimerizing Fokl catalytic domain, and extensive effort has been placed into optimizing the distance between the DNA binding sites (Christian, Cermak et al. 2010; Miller, Tan et al. 2011).
  • TALENs novel "compact TALENs”
  • cTALENs do not require dimerization for DNA processing activity, thereby alleviating the need for "dual" target sites with intervening DNA “spacers”.
  • the invention allows for generating several distinct types of enzymes that can enhance separate DNA repair pathways (HR vs. NHEJ).
  • Figure 1 Endonuclease-induced gene targeting approaches. Upon cleavage, DNA repair mechanisms may result in one of several outcomes.
  • A When a double-strand break is targeted between two direct repeats, HR can result in the deletion of one repeat together with the intervening sequence.
  • Gene insertion (B) or correction (C) can be achieved by the introduction of a DNA repair matrix containing sequences homologous to the endogenous sequence surrounding the DNA break. Mutations can be corrected either at or distal to the break, with the frequency of correction decreasing with increasing distance.
  • D The misrepair of DNA ends by error-prone NHEJ can result in insertions or deletions of various sizes, leading to gene inactivation.
  • FIG. 2 Sequences of target DNA recognized by l-Crel and l-Tevl.
  • C1234 (SEQ. ID NO: 3) represents the partially symmetric natural DNA sequence recognized and cleaved by the wild-type l-Crel meganuclease.
  • C1221 (SEQ ID NO: 2) represents an artificial palindromic DNA sequence, derived from C1234 (SEQ ID NO: 3), also recognized and cleaved by l-Crel (SEQ ID NO: 1). Nucleotides are numbered outward (-/+) from the center of the target. DNA cleavage occurs on either side of the underlined sequence to generate 4-nucleotide 3' overhanging ends.
  • Tev SEQ ID NO: 105
  • Nucleotide numbering is relative to the intron- insertion site of the natural target sequence. Cleavage by l-Tevl occurs on either side of the underlined sequence to generate 2-nucleotide 3' overhanging ends.
  • Figure 3 Sequences of the target DNAs recognized by TALEN and compact TALEN constructs.
  • RVDs Wild-type Repeat Variable Dipeptides
  • Cipher RVDs are based on the subset of dipeptide/nucleotide pairs listed.
  • Artificial RVDs are derived by direct readout of the underlying DNA sequence using the cipher RVD code (SEQ ID NO: 245 to 249).
  • FIG. 4 Schematic of meganuclease fusion configurations. Fusion constructs are optimized to address or overcome distinct problems.
  • A The addition of two catalytic domains to an active meganuclease can not only enhance cleavage activity (e.g. three chances to effect DNA cleavage per binding event) but can also promote sequence alterations by error-prone NHEJ since small sections of DNA are excised for each pair of cleavage events.
  • B When specificity reengineering precludes maintaining cleavage activity of the meganuclease, the attached catalytic domains provide the necessary strand cleavage function.
  • (C) and (D) represent instances of (A) and (B), respectively, when only one catalytic domain is tolerated per fusion protein (e.g. either as an N- or C-terminal fusion or in the context of a single-chain molecule).
  • the catalytic domain envisioned can be either a cleavase (ability to cleave both strands of the DNA) or a nickase (cleavage of only a single DNA strand) depending on the application.
  • Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application. Components of the fusion proteins are listed in the legend.
  • FIG. 5 Schematic of cTALEN configurations.
  • Compact TALENs are designed to alleviate the need for multiple independent protein moieties when targeting a DNA cleavage event. Importantly, the requisite "spacer" region and dual target sites essential for the function of current classical TALENs are unnecessary. In addition, since the catalytic domain does not require specific DNA contacts, there are no restrictions on regions surrounding the core TALE DNA binding domain.
  • A N-terminal fusion construct to promote HR via a standard (cleavase domain) or conservative (nickase domain) repair pathway.
  • B C-terminal fusion construct with properties as in (A).
  • C The attachment of two catalytic domains to both ends of the TALE allows for dual cleavage with enhancement in NHEJ. Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application. Components of the fusion proteins are listed in the legend.
  • the enhancer domain can promote communication between the flanking domains (i.e. to assist in catalysis and/or DNA binding) or can be used to overcome the requisite T nucleotide at position -1 of all TALE-based targets.
  • D The enhancer domain is used to functionally replace the natural TALE protein N-terminal region.
  • E The enhancer domain is used to functionally replace the natural TALE protein C-terminal region. Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application. Components of the fusion proteins are listed in the legend.
  • FIG. 7 Schematic of trans cTALEN configurations.
  • Compact TALENs can be combined with auxiliary enhancer domains to promote alternate activities.
  • Auxiliary domains provide an additional function that is not essential to the cTALEN activity.
  • a standard cTALEN with an N-terminal nickase catalytic domain becomes a "cleavase" via the separate addition of the auxiliary domain.
  • B In some instances, the need to target the specificity of the auxiliary domain is necessary. Such a configuration can achieved via a TALE fusion and can be used to assist and/or anchor the auxiliary domain near the DNA to increase activity of the cTALEN.
  • C The targeted auxiliary domain is provided either before or after the cTALEN to perform an independent task. Communication between the fusion proteins is not necessary. Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application. Components of the fusion proteins are listed in the legend.
  • Imprecise NHEJ or homologous recombination can alter or remove the cleavage site, resulting in cycle exit; this can also apply to compact TALENs and enhanced compact TALENs according to the present invention (A).
  • Two other ways can also stop the process: (i) Chromosome loss can occur as the consequence of failure to repair the DSB; (ii) a loss of nuclease (degradation, dilution, cell division, etc.).
  • B-E Consequences of cleavage of additional phosphodiester bonds.
  • FIG. 10 Activity of TALE-AvrBs3::Tevl in mammalian cells.
  • PCLS8993 SEQ ID NO: 194
  • pCLS8994 SEQ ID NO: 195
  • Negative control empty vector
  • positive control l-Scel meganuclease
  • Figure 11 Activity of TALE-AvrBs3::NucA in yeast (37°C).
  • the negative control is a target lacking a recognition site (neg. Ctrl. : SEQ ID NO: 228).
  • Compact is a target having only one recognition site (SEQ ID NO: 224).
  • n.d. indicates no detectable activity, + indicates an activity over 0.3 in yeast assay at 37°C; ++, activity over 0.5 in yeast assay at 37°C and +++ activity over 0.7 in yeast assay at 37°C (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al.
  • FIG. 13 Schematic and details of a TALE::Crel prototypical compact TALEN.
  • This class of compact TALEN targets a bipartite recognition sequence comprised of the TALE DNA binding site proximal to a meganuclease target site.
  • the engineered TCRB02-A meganuclease site is shown along with details of the RVDs and DNA sequences recognized by the TALE moiety.
  • a region of the T cell receptor B gene is presented, highlighting the endogenous layout of the TALE::Crel-based compact TALEN hybrid target site.
  • FIG 14 Activity of TALE::scTB2aD01-based constructs in yeast (30°C). The layouts of the various hybrid targets are shown, starting (5') with the region recognized by the TALE DNA binding domain in uppercase, the unspecific spacer region in lowercase and the meganuclease target site in underlined uppercase characters. Activity in yeast is illustrated for select representative constructs, n.d. indicates no detectable activity, + indicates an activity over 0.3 in yeast assay at 30°C; ++, activity over 0.5 in yeast assay at 30°C and +++ activity over 0.7 in yeast assay at 30°C (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • FIG. 15 Western blot of TALE::scTB2aD01-based constructs. Constructs were expressed in HEK293 cells and total protein extracts were prepared 48 hours post-transfection. Protein was detected using a polyclonal anti-l-Crel antibody.
  • FIG. 16 Toxicity of TALE::scTB2aD01-based constructs in CHOK1 cells. Cytotoxicty is based on detectable levels of GFP expressed in living cells, on day 1 vs day 6, relative to a standard control (transfection of empty plasmid).
  • Figure 17 NHEJ activity of TALE : :scTB2aD01-based constructs in HEK293 cells. A post-transfection PCR-based analysis of genomic DNA is used to assess activity in vivo. Cleavage of mismatched DNA sequences by T7 endonuclease is indicative of NHEJ events resulting from the activity of the cTALEN or meganuclease at the targeted locus.
  • Figure 18 Activity of Tevl::TALE-AvrBs3 +/- TALE-RagT2-R::Tevl in yeast (37 e C). The negative control is a target lacking a recognition site (neg. Ctrl. : SEQ ID NO: 228). n.d.
  • FIG. 19 Activity of TALE::SnaseSTAAU in yeast (37°C).
  • the negative control is a target lacking recognition sites.
  • Compact is a target having only one recognition site (SEQ ID NO: 224).
  • n.d. indicates no detectable activity at 37°C, +/- indicated an activity above 0.3 in yeast assay at 37°C; + indicated an activity over 0.3 in yeast assay at 37°C; ++ indicated an activity over 0.5 in yeast assay at 37°C; +++ indicated an activity over 0.75 in yeast assay at 37°C (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • FIG. 20 Activity of TALE::ColE7 with various polypeptide linker in yeast (37°C).
  • Compact is a target having only one recognition site (SEQ ID NO: 224).
  • n.d. indicates no detectable activity at 37°C, + indicated an activity over 0.3 in yeast assay at 37°C; ++ indicated an activity over 0.5 in yeast assay at 37°C; +++ indicated an activity over 0.75 in yeast assay at 37°C (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • Table 6 List of AvrBs3 targets with various spacer lengths (SEQ ID NO: 157 to 192).
  • Table 7 List of AvrBs3 targets with various spacer lengths (SEQ ID NO: 157 to 192) including a target with only one recognition site (compact, SEQ ID NO: 224) and a negative control target (neg. Ctrl., SEQ ID NO: 228) consisting in a target without any recognition site.
  • Table 13 List of hybrid RagT2-R/AvrBs3 targets with various spacer lengths (SEQ ID NO: 315 to 350).
  • the present invention relates to a method to generate compact Transcription Activator-Like Effector Nucleases (cTALENs) composed of a single polypeptide chain that do not require dimerization to target a specific single double-stranded DNA target sequence of interest and process DNA nearby said single double-stranded DNA target sequence of interest.
  • cTALENs compact Transcription Activator-Like Effector Nucleases
  • At least one catalytic domain wherein said catalytic domain is capable of processing DNA a few base pairs away from said DNA target sequence of interest when fused to the C and/or N terminal of said core TALE scaffold from (i);
  • one peptidic linker to fuse said catalytic domain from (ii) to said core TALE scaffold from (i) when needed;
  • said engineered core TALE scaffold according to the present invention comprises an additional N-terminal domain resulting in an engineered core TALE scaffold sequentially comprising a N-terminal domain and different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest, onto which a selection of catalytic domains can be attached to effect DNA processing.
  • RVDs Repeat Variable Dipeptide regions
  • said engineered core TALE scaffold according to the present invention comprises an additional C-terminal domain resulting in an engineered core TALE scaffold sequentially comprising different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest and a C-terminal domain, onto which a selection of catalytic domains can be attached to effect DNA processing.
  • RVDs Repeat Variable Dipeptide regions
  • said engineered TALE-scaffold comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 134 and SEQ ID NO: 135.
  • said engineered core TALE-scaffold according to the present invention comprises the protein sequences selected from the group consisting of bTl-Avr (SEQ ID NO: 136), bT2-Avr (SEQ ID NO: 137), bTl-Pth (SEQ ID NO: 138) and bT2-Pth (SEQ ID NO: 139).
  • said engineered TALE-scaffold comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 136 to SEQ ID NO: 139.
  • said additional N- terminus and C-terminal domains of engineered core TALE scaffold are derived from natural TALE.
  • said additional N-terminus and C-terminal domains of engineered core TALE scaffold are derived from natural TALE like AvrBs3, PthXol, AvrHahl, PthA, Tallc as non- limiting examples.
  • said additional N-terminus and/or said C- terminal domains are truncated forms of respective N-terminus and/or said C-terminal domains of natural TALE like AvrBs3, PthXol, AvrHahl, PthA, Tallc as non-limiting examples from which they are derived.
  • each RVD of said core scaffold is made of 30 to 42 amino acids, more preferably 33 or 34 wherein two critical amino acids located at positions 12 and 13 mediates the recognition of one nucleotide of said nucleic acid target sequence; equivalent two critical amino acids can be located at positions other than 12 and 13 specialy in RVDs taller than 33 or 34 amino acids long.
  • RVDs associated with recognition of the different nucleotides are HD for recognizing C, NG for recognizing T, Nl for recognizing A, NN for recognizing G or A, NS for recognizing A, C, G or T, HG for recognizing T, IG for recognizing T, NK for recognizing G, HA for recognizing C, ND for recognizing C, HI for recognizing C, HN for recognizing G, NA for recognizing G, SN for recognizing G or A and YG for recognizing T, TL for recognizing A, VT for recognizing A or G and SW for recognizing A.
  • RVDs associated with recognition of the nucleotides C, T, A, G/A and G respectively are selected from the group consisting of NN or NK for recognizing G, HD for recognizing C, NG for recognizing T and Nl for recognizing A, TL for recognizing A, VT for recognizing A or G and SW for recognizing A.
  • RVDS associated with recognition of the nucleotide C are selected from the group consisting of N*
  • RVDS associated with recognition of the nucleotide T are selected from the group consisting of N* and H*, where * denotes a gap in the repeat sequence that corresponds to a lack of amino acid residue at the second position of the RVD.
  • critical amino acids 12 and 13 can be mutated towards other amino acid residues in order to modulate their specificity towards nucleotides A, T, C and G and in particular to enhance this specificity.
  • other amino acid residues is intended any of the twenty natural amino acid residues or unnatural amino acids derivatives.
  • said core scaffold of the present invention comprises between 8 and 30 RVDs. More preferably, said core scaffold of the present invention comprises between 8 and 20 RVDs; again more preferably 15 RVDs.
  • said core scaffold comprises an additional single truncated RVD made of 20 amino acids located at the C-terminus of said set of RVDs, i.e. an additional C-terminal half-RVD.
  • said core scaffold of the present invention comprises between 8.5 and 30.5 RVDs, ".5" referring to previously mentioned half-RVD (or terminal RVD, or half-repeat). More preferably, said core scaffold of the present invention comprises between 8.5 and 20.5 RVDs, again more preferably, 15.5 RVDs.
  • said half-RVD is in a core scaffold context which allows a lack of specificity of said half-RVD toward nucleotides A, C, G, T. In a more preferred embodiment, said half-RVD is absent.
  • said core scaffold of the present invention comprises RVDs of different origins.
  • said core scaffold comprises RVDs originating from different naturally occurring TAL effectors.
  • internal structure of some RVDs of the core scaffold of the present invention are constituted by structures or sequences originated from different naturally occurring TAL effectors.
  • said core scaffold of the present invention comprises RVDs-like domains. RVDs-like domains have a sequence different from naturally occurring RVDs but have the same function and / or global structure within said core scaffold of the present invention.
  • said additional N-terminal domain of said engineered core TALE scaffold is an enhancer domain.
  • said enhancer domain is selected from the group consisting of Puf RNA binding protein or Ankyrin super-family, as non-limiting examples.
  • said enhancer domain sequence is selected from the group consisting of protein domains of SEQ ID NO: 4 and SEQ ID NO: 5, as non-limiting examples listed in Table 1, a functional mutant, a variant or a derivative thereof..
  • said additional C-terminal domain of said engineered core TALE scaffold is an enhancer domain.
  • said enhancer domain is selected from the group consisting of hydrolase/transferase of Pseudomonas Aeuriginosa family, the polymerase domain from the Mycobacterium tuberculosis Ligase D family, the initiation factor elF2 from Pyrococcus family, the translation initiation factor Aif2 family, as non-limiting examples.
  • said enhancer domain sequence is selected from the group consisting of protein domains of SEQ ID NO: 6 to SEQ ID NO: 9, as non-limiting examples listed in Table 1, a functional mutant, a variant or a derivative thereof.
  • Table 1 List of enhancer domains for engineered core TALE scaffold.
  • the catalytic domain that is capable of processing DNA nearby the single double-stranded DNA target sequence of interest, when fused to said engineered core TALE scaffold according to the method of the present invention is fused to the N-terminus part of said core TALE scaffold.
  • said catalytic domain is fused to the C-terminus part of said core TALE scaffold.
  • two catalytic domains are fused to both N-terminus part of said core TALE scaffold and C-terminus part of said core TALE scaffold.
  • said catalytic domain has an enzymatic activity selected from the group consisting of nuclease activity, polymerase activity, kinase activity, phosphatase activity, methylase activity, topoisomerase activity, integrase activity, transposase activity or ligase activity.
  • the catalytic domain fused to the core TALE scaffold of the present invention can be a transcription activator or repressor (i.e. a transcription regulator), or a protein that interacts with or modifies other proteins such as histones.
  • Non-limiting examples of DNA processing activities of said compact TALEN of the present invention include, for example, creating or modifying epigenetic regulatory elements, making site-specific insertions, deletions, or repairs in DNA, controlling gene expression, and modifying chromatin structure.
  • said catalytic domain has an endonuclease activity. In another more preferred embodiment, said catalytic domain has cleavage activity on said double- stranded DNA according to the method of the present invention. In another more preferred embodiment, said catalytic domain has a nickase activity on said double-stranded DNA according to the method of the present invention.
  • said catalytic domain is selected from the group consisting of proteins Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (END1_EC0LI), Human Endo G (NUCG_HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, l-Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC_STAHY), Micrococcal nuclease (NUC_SHIFL), Endonuclease yncB, Endodeoxyribonuclease
  • said catalytic domain is l-Tevl (SEQ ID NO: 20), a functional mutant, a variant or a derivative thereof.
  • catalytic domain l-Tevl (SEQ ID NO: 20), a functional mutant, a variant or a derivative thereof is fused to the N-terminal domain of said core TALE scaffold according to the method of the present invention.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 420-432.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 435-438.
  • said catalytic domain is NucA (SEQ ID NO: 26), a functional mutant, a variant or a derivative thereof.
  • catalytic domain NucA (SEQ ID NO: 26), a functional mutant, a variant or a derivative thereof is fused to the N-terminal domain of said core TALE scaffold according to the method of the present invention.
  • catalytic domain NucA (SEQ ID NO: 26), a functional mutant, a variant or a derivative thereof is fused to the C-terminal domain of said core TALE scaffold according to the method of the present invention.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 433-434.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 439-441 and SEQ ID NO: 444-446.
  • said catalytic domain is a restriction enzyme such as Mmel, -HinPII, R.Mspl, R.Mval, Nb.BsrDI, BsrDI A, Nt.BspD6l, ss.BspD6l, R.PIel, Mlyl and Alwl as non-limiting examples listed in table 2.
  • said catalytic domain has an exonuclease activity.
  • any combinations of two catalytic domains selected from the group consisting of proteins Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (ENDl_ECOLI), Human Endo G (NUCG_HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, I- Bmol, l-Hmul, l-Tevl, l-Tevll, l-Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC STAHY), Micrococcal nuclease (NUC_SHIFL), Endonuclease yncB, Endodeoxyribonuclease
  • said unique compact TALEN monomer comprises a combination of two catalytic domains respectively fused to the C-terminus part and to the N-terminus part of said core TALE scaffold selected from the group consisting of:
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 448 and 450.
  • said compact TALEN according to the method of the present invention comprises a combination of two catalytic domains respectively fused to the C-terminus part and to the N-terminus part of said core TALE scaffold selected from the group consisting of:
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 447-450 and SEQ ID NO: 452.
  • the number of RVDs for each part of the engineered core TALE scaffold can be the same or not.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 453-455.
  • I l-Bmol 1 8 >gi
  • I-Twol 23 >g i 119881200
  • Vvn 28 >g 166352791 gb
  • P43270.1 Staphylococcal nuclease >gi 111718591 s 1 P43270.1 jNUC_STAHY RecName: Full Thermonuclease;
  • Micrococcal nuclease Full Micrococcal nuclease
  • Nb.BsrDI 36 >gi 1867574931gb
  • AKPIDSKVLFITTSPRTPEK VPEIELLD NFNGDVWNKDTQTAFMKILKEESFFDGEGKNDPAFSARD RINRAPKSLGFVILTPKLSLTDAGVELIKAKRKDDIFLRQMLKFQLPSPYHKLSDKAALFYVKPYLEIFR LVRHFGSLTFDELMIFGLQIIDFRIFNQIVOKIEDFRVGKIENKGRYKTYKKERFEEELGKIYKDELFGL TEASA TLITKKG MRDYADACVRYLRATGMVNVSYQGKSLSIVQEKKEEVDFFLKNTEREPCFINDEA S VSYLGNPNYPKLFVDDVD IKKKLRFDFKKTNKWALTLPELKEELENEILSRKENILKSQISDIKNF KLYEDIQEVFEKIENDRTLSDAPLMLEWNTWRAMTMLDGGEIKANLKFDDFGSPMSTAIGNMPDI CEYD DFQLSVEVTMASGQKQYE
  • Table 2 List of catalytic / enhancer domains for compact TALENs or enhanced compact TALENs.
  • the peptidic linker that can link said catalytic domain to the core TALE scaffold according to the method of the present invention can be selected from the group consisting of NFSl, NFS2, CFS1, RM2, BQY, QGPSG, LGPDGRKA, la8h_l, ldnpA_l, ld8cA_2, lckqA_3, lsbp_l, lev7A_l, lalo_3, lamf_l, ladjA_3, lfcdC_l, lal3_2, lg3p_l, lacc_3, lahjB_l, lacc_l, laf7_l, lheiA_l, lbia_2, ligtB_l, lnfkA_l, lau7A_l, lbpoB_l, lb0pA_2, lc05A_2, lgcb_l, lbt3
  • the peptidic linker that can link said catalytic domain to the core TALE scaffold according to the method of the present invention can be selected from the group consisting of NFSl (SEQ ID NO: 98), NFS2 (SEQ ID NO: 99) andCFSl (SEQ ID NO: 100).
  • NFSl SEQ ID NO: 98
  • NFS2 SEQ ID NO: 99
  • CFSl SEQ ID NO: 100
  • a peptidic linker is not needed to fuse a catalytical domain to the TALE scaffold in order to obtain a cTALEN according to the present invention.
  • Linker B 37 SIVAQLSRPDPAAVSAQKAKAACLGGRPALDAVKKGL 410
  • Table 3 List of peptidic linkers that can be used in compact TALENs or enhanced compact TALENs.
  • a compact TALEN according to the present invention can comprise different levels of separate enzymatic activities able to differently process DNA, resulting in a global DNA processing efficiency for said compact TALEN, each one of said different enzymatic activities having their own DNA processing efficiency.
  • the method according to the present invention further comprises the steps of:
  • said unique compact TALEN monomer further comprises:
  • said enhancer domain is fused to the N-terminus of the core TALE scaffold part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused to C-terminus of the core TALE scaffold part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused to the catalytic domain part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused between the N-terminus of the core TALE scaffold part and the catalytic part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused between the C-terminus of the core TALE scaffold part and the catalytic part of said compact TALEN entity.
  • each engineered core TALE scaffold comprising one set of RVDs.
  • the number of RVDs for each engineered core TALE scaffold can be the same or not.
  • said enhancer domain is catalytically active or not, providing functional and/or structural support to said compact TALEN entity.
  • said enhancer domain consists of a protein domain selected from the group consisting of Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (ENDl_ECOLI), Human Endo G (NUCG HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, I- Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC_STAHY), Micrococcal nucle
  • said enhancer domain consists of a catalytically active derivative of the protein domains listed above and in Table 2, providing functional and/or structural support to said compact TALEN entity.
  • said enhancer domain consists of a catalytically inactive derivative of the protein domains listed above and in Table 2, providing structural support to said compact TALEN entity.
  • said enhancer domain is selected from the group consisting of l-Tevl (SEQ ID NO: 20), ColE7 (SEQ ID NO: 11) and NucA (SEQ ID NO: 26).
  • said enhanced compact TALEN according to the method of the present invention can comprise a second enhancer domain.
  • said second enhancer domain can have the same characteristics than the first enhancer domain.
  • said second enhancer domain provides structural support to enhanced compact TALEN entity.
  • said second enhancer domain provides functional support to enhanced compact TALEN entity.
  • said second enhancer domain provides structural and functional support to the enhanced compact TALEN entity.
  • said enhanced compact TALEN entity comprises one catalytic domain and one enhancer domain.
  • said enhanced compact TALEN entity comprises one catalytic domain and two enhancer domains.
  • said enhanced compact TALEN entity comprises two catalytic domains and one enhancer domains.
  • said enhanced compact TALEN entity comprises two catalytic domains and two enhancer domains.
  • said second enhancer domain consists of a protein domain derived from a protein selected from the group consisting of Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (ENDl_ECOLI), Human Endo G (NUCG_HU AN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, l-Tevlll, I -Two I, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC STAHY), Micrococcal nuclease (NUC_SHIFL), Endonuclease yncB,
  • said second enhancer domain consists of a catalytically active derivative of the protein domains listed above and in Table 2, providing functional and/or structural support to said enhanced compact TALEN entity.
  • said second enhancer domain consists of a catalytically inactive derivative of the protein domains listed above and in Table 2, providing structural support to said enhanced compact TALEN entity.
  • any combinations of catalytic and/or enhancer domains listed above, as non-limiting examples, can be envisioned to be fused to said core TALE scaffold providing structural and/or functional support to said compact TALEN entity. More preferably, combinations of catalytic domains selected from the group of TevI (SEQ ID NO: 20), ColE7 (SEQ ID NO: 11) and NucA (SEQ ID NO: 26) can be envisioned.
  • Fokl SEQ ID NO: 368 can be used in combination with another catalytic domain according to the list of Table2.
  • Such combinations of catalytic and/or enhancer domains can be envisioned regarding the envisioned applications for using the method of the present invention.
  • an enhanced compact TALEN can present different levels of separate enzymatic activities able to differently process DNA, resulting in a global DNA processing efficiency for said enhanced compact TALEN, each one of said different enzymatic activities having their own DNA processing efficiency.
  • the DNA processing efficiency of the compact TALEN entity according to the method of the present invention can be enhanced by the engineering of at least one enhancer domain and one peptidic linker thereby obtaining a compact TALEN entity with enhanced DNA processing activity nearby a single double-stranded DNA target sequence of interest, i.e a enhanced compact TALEN according to the present invention.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention can have a dominant enzymatic activity selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention is a combination of different enzymatic activities selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention is one of its different enzymatic activities selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency is equivalent to one DNA processing activity amongst the enzymatic activities mentioned above.
  • said DNA processing activity of the compact TALEN entity which is enhanced by the enhancer is a cleavase activity or a nickase activity or a combination of both a cleavase activity and a nickase activity.
  • Enhancement of DNA processing efficiency of a compact TALEN entity according to the present invention can be a consequence of a structural support by at least one enhancer domain.
  • said structural support enhances the binding of a compact TALEN entity according to the invention for said DNA target sequence compared to the binding of a starting compact TALEN entity for the same DNA target sequence, thereby indirectly assisting the catalytic domain(s) to obtain a compact TALEN entity with enhanced DNA processing activity.
  • said structural support enhances the existing catalytical activity of a compact TALEN entity for a DNA target sequence compared to the binding of a starting compact TALEN entity for the same DNA target sequence to obtain a compact TALEN entity with enhanced DNA processing activity.
  • said enhancer according to the method of the present invention both enhances the binding of the compact TALEN entity for said DNA target sequence and the catalytic activity of the catalytic domain(s) to obtain a compact TALEN entity with enhanced DNA processing activity. All these non-limiting examples lead to a compact TALEN entity with enhanced DNA processing efficiency for a DNA target sequence at a genomic locus of interest, i.e an enhanced compact TALEN according to the present invention.
  • Enhancement of DNA processing efficiency of a compact TALEN entity according to the present invention can also be a consequence of a fuctional support by at least one enhancer domain.
  • said functional support can be the consequence of the hydrolysis of additional phosphodiester bonds.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a nuclease.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from an endonuclease.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a cleavase.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a nickase. In a more preferred embodiment, said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from an exonuclease. In genome engineering experiments, the efficiency of rare-cutting endonuclease, e.g.
  • Cleavage by peptidic rare cutting endonucleases usually generates cohesive ends, with 3' overhangs for LAGLIDADG meganucleases (Chevalier and Stoddard 2001) and 5' overhangs for Zinc Finger Nucleases (Smith, Bibikova et al. 2000). These ends, which result from hydrolysis of phosphodiester bonds, can be re-ligated in vivo by NHEJ in a seamless way (i.e a scarless re-ligation).
  • the restoration of a cleavable target sequence allows for a new cleavage event by the same endonuclease, and thus, a series of futile cycles of cleavage and re-ligation events can take place.
  • DSB resection depends on several proteins including BLM/Sgsl and DNA2, EXOI, and the M N complex (Mrell, Rad50, Nbsl/Xrs2) and is thought to result from different pathways. MRN is involved in a small scale resection process, while two redundant pathways depending on BLM and DNA2 on one hand, and on EXOI on another hand, would be involved in extensive resection (Mimitou and Symington 2008; Nimonkar, Genschel et al. 2011).
  • the efficiency of a compact TALEN e.g. it ability to produce a desired event such as targeted mutagenesis or homologous gene targeting (see definition for full definition of "efficiency of compact TALEN")
  • a desired event such as targeted mutagenesis or homologous gene targeting
  • an enhancement or modification of its global DNA processing efficiency see definition for full definition of "global DNA processing efficiency”
  • global DNA processing efficiency e.g. the global resultant or the overall result of different separate enzymatic activities that said compact TALEN.
  • enhancement of global DNA processing efficiency of a compact TALEN entity according to the present invention can be the hydrolysis of additional phosphodiester bonds at the cleavage site.
  • Said hydrolysis of additional phosphodiester bonds at the cleavage site by said at least one enhancer according to the invention can lead to different types of DSB resection affecting at said DSB cleavage site, one single DNA strand or both DNA strands, affecting either 5' overhangs ends, either 3' overhangs ends, or both ends and depending on the length of said resection.
  • adding new nickase or cleavase activities to the existing cleavase activity of a compact TALEN entity can enhance the efficiency of the resulting enhanced compact TALEN according to the invention, at a genomic locus of interest ( Figure 8B-8E).
  • enhancement of DNA processing efficiency of a compact TALEN refers to the increase in the detected level of said DNA processing efficiency, against a target DNA sequence, of a enhanced compact TALEN in comparison to the activity of a first compact TALEN against the same target DNA sequence.
  • Said first compact TALEN can be a starting compact TALEN, or a compact TALEN that has already been engineered or an enhanced compact TALEN according to the present invention.
  • Several rounds of enhancement can be envisioned from a starting compact TALEN or from a starting enhanced compact TALEN.
  • enhancement of the DNA processing efficiency of the compact TALEN entity refers to the increase in the detected level of said DNA processing efficiency against a target DNA sequence of interest or nearby said DNA sequence of interest in comparison to the efficiency of a first compact TALEN or starting compact TALEN against or nearby the same target DNA sequence.
  • the starting compact TALEN is taken as the reference scaffold to measure the DNA processing efficiency.
  • Said enhanced compact TALEN is an engineered compact TALEN comprising an enhancer domain according to this aspect of the invention.
  • Said enhanced compact TALEN can also be taken as a reference scaffold for further enhancement of said DNA processing efficiency.
  • said DNA processing efficiency can result from a cleavage-induced recombination generated by said enhanced compact TALEN.
  • said level of cleavage-induced recombination can be determined, for instance, by a cell-based recombination assay as described in the International PCT Application WO 2004/067736.
  • enhancement of efficacy in cells can be, but is not necessarily associated with an enhancement of the cleavage activity that could be detected in certain in vitro assays.
  • Said enhancement in cleavage-induced recombination of said enhanced compact TALEN is at least a 5% enhancement compared to the starting scaffold or starting compact TALEN, more preferably at least a 10% enhancement, again more preferably at least a 15% enhancement, again more preferably at least a 20% enhancement, again more preferably at least a 25% enhancement, again more preferably a 50% enhancement, again more preferably an enhancement greater than 50%, resulting in an enhancement of DNA processing efficiency of said enhanced compact TALEN of at least 5% compared to the starting scaffold or starting compact TALEN, more preferably at least a 10% enhancement, again more preferably at least a 15% enhancement, again more preferably at least a 20% enhancement, again more preferably at least a 25% enhancement, again more preferably a 50% enhancement, again more preferably a enhancement greater than 50% .
  • the peptidic linker that can link said enhancer domain to one part of said compact TALEN entity according to the method of the present invention can be selected from the group consisting of NFSl, NFS2, CFSl, M2, BQY, QGPSG, LGPDGRKA, la8h_l, ldnpA_l, ld8cA_2, lckqA_3, lsbp_l, lev7A_l, lalo_3, lamf_l, ladjA_3, lfcdC_l, lal3_2, lg3p_l, lacc_3, lahjB_l, lacc_l, laf7_l, lheiA_l, lbia_2, ligtBJL, lnfkA_l, lau7A_l, lbpoB_l, lb0pA_2, lc05A_2, lgcb_l, l
  • the peptidic linker that can said enhancer domain to one part of said compact TALEN entity according to the method of the present invention can be selected from the group consisting of NFSl (SEQ ID NO: 98), NFS2 (SEQ ID NO: 99) and CFSl (SEQ ID NO: 100).
  • NFSl SEQ ID NO: 98
  • NFS2 SEQ ID NO: 99
  • CFSl SEQ ID NO: 100
  • a compact TALEN or an enhanced compact TALEN can comprise different levels of separate enzymatic activities able to differently process DNA as mentioned above.
  • compact TALENs are designed to alleviate the need for multiple independent protein moieties when targeting a DNA processing event. Importantly, the requisite "spacer" region and dual target sites essential for the function of current TALENs are unnecessary. As each end of the core TALE scaffold is amenable to fusion, the order (N- v.s C-terminal) of addition of the catalytic and enhancement domains can vary with the application.
  • compact TALENs can be enhanced through the addition of a domain to promote existing or alternate activities as non-limiting examples depicted in figure 6 :
  • the enhancer domain is fused to the compact TALEN via the N-terminus of its catalytic domain part. Such a configuration can be used to assist and/or anchor the catalytic domain part near the DNA to increase DNA processing activity.
  • C The enhancer domain is sandwiched between the catalytic domain part and the core TALE scaffold part. The enhancer domain can promote communication between the flanking domains (i.e.
  • the enhancer domain is used to functionally replace the engineered core TALE scaffold N-terminal region.
  • the enhancer domain is used to functionally replace the engineered core TALE scaffold C-terminal region. Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application. According to the present invention, the nature of the catalytic domain(s) comprised in the compact TALEN and the enhanced compact TALEN is application dependent.
  • a nickase domain should allow for a higher HR/NHEJ ratio than a cleavase domain, thereby being more agreeable for therapeutic applications (McConnell Smith, Takeuchi et al. 2009; Metzger, McConnell- Smith et al. 2011).
  • the coupling of a cleavase domain on one side with a nickase domain on the other could result in excision of a single-strand of DNA spanning the binding region of a compact TALEN.
  • the targeted generation of extended single-strand overhangs could be applied in applications that target DNA repair mechanisms.
  • the use of two cleavase domains is then preferred.
  • the use of two nickase domains can be favored.
  • the invention relates to a method for generating several distinct types of compact TALENs that can be applied to applications ranging from targeted DNA cleavage to targeted gene regulation.
  • the present invention relates to a compact TALEN comprising:
  • TALE scaffold comprising different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest, onto which a selection of catalytic domains can be attached to effect DNA processing;
  • RVDs Repeat Variable Dipeptide regions
  • At least one catalytic domain wherein said catalytic domain is capable of processing DNA nearby said single double-stranded DNA target sequence of interest when fused to said engineered core TALE scaffold from (i);
  • the compact TALEN does not require dimerization to target a specific single double- stranded DNA target sequence of interest and process DNA nearby said single double-stranded DNA target sequence of interest.
  • the compact TALEN according to the present invention is an active entity unit able, by itself, to target only one specific single double-stranded DNA target sequence of interest through one DNA binding domain and to process DNA nearby said single double-stranded DNA target sequence of interest.
  • the present invention relates to a compact TALEN monomer comprising:
  • TALE scaffold comprising Repeat Variable Dipeptide regions (RVDs) having DNA binding specificity onto a specific double-stranded DNA target sequence of interest;
  • At least one catalytic domain wherein said catalytic domain is capable of processing DNA a few base pairs away from said double-stranded DNA target sequence of interest when fused to the C or N terminal of said core TALE scaffold from (i);
  • said compact TALEN monomer is assembled to bind said target DNA sequence and process double-stranded DNA without requiring dimerization.
  • said engineered core TALE scaffold of the compact TALEN according to the present invention comprises an additional N-terminal domain resulting in an engineered core TALE scaffold sequentially comprising a N-terminal domain and different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest, onto which a selection of catalytic domains can be attached to effect DNA processing.
  • RVDs Repeat Variable Dipeptide regions
  • said engineered core TALE scaffold of the compact TALEN according to the present invention comprises an additional C-terminal domain resulting in an engineered core TALE scaffold sequentially comprising different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest and a C-terminal domain, onto which a selection of catalytic domains can be attached to effect DNA processing.
  • RVDs Repeat Variable Dipeptide regions
  • said engineered core TALE-scaffold of the compact TALEN according to the present invention comprises additional N-terminus and a C-terminal domains resulting in an engineered core TALE scaffold sequentially comprising a N-terminal domain, different sets of Repeat Variable Dipeptide regions (RVDs) to change DNA binding specificity and target a specific single double-stranded DNA target sequence of interest and a C-terminal domain, onto which a selection of catalytic domains can be attached to effect DNA processing.
  • RVDs Repeat Variable Dipeptide regions
  • said engineered core TALE-scaffold according to the present invention comprises the protein sequences selected from the group consisting of ST1 (SEQ ID NO: 134) and ST2 (SEQ ID NO: 135).
  • said engineered core TALE scaffold comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 134 and SEQ ID NO: 135.
  • said engineered core TALE-scaffold according to the present invention comprises the protein sequences selected from the group consisting of bTl-Avr (SEQ ID NO: 136), bT2-Avr (SEQ ID NO: 137), bTl-Pth (SEQ ID NO: 138) and bT2-Pth (SEQ ID NO: 139).
  • said engineered TALE-scaffold comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 136 to SEQ ID NO: 139.
  • said additional N-terminus and/or said C- terminal domains are truncated forms of respective N-terminus and/or said C-terminal domains of natural TALE like AvrBs3, PthXol, AvrHahl, PthA, Tallc as non-limiting examples, from which they are derived.
  • RVDs associated with recognition of the nucleotides C, T, A, G/A and G respectively are selected from the group consisting of NN or NK for recognizing G, HD for recognizing C, NG for recognizing T and Nl for recognizing A, TL for recognizing A, VT for recognizing A or G and SW for recognizing A.
  • RVDS associated with recognition of the nucleotide C are selected from the group consisting of N*
  • RVDS associated with recognition of the nucleotide T are selected from the group consisting of N* and H*, where * denotes a gap in the repeat sequence that corresponds to a lack of amino acid residue at the second position of the RVD.
  • critical amino acids 12 and 13 can be mutated towards other amino acid residues in order to modulate their specificity towards nucleotides A, T, C and G and in particular to enhance this specificity.
  • other amino acid residues is intended any of the twenty natural amino acid residues or unnatural amino acids derivatives.
  • said core scaffold comprises an additional single truncated RVD made of 20 amino acids located at the C-terminus of said set of RVDs, i.e. an additional C-terminal half-RVD.
  • said core scaffold of the present invention comprises between 8.5 and 30.5 RVDs, ".5" referring to previously mentioned half-RVD (or terminal RVD, or half-repeat). More preferably, said core scaffold of the present invention comprises between 8.5 and 20.5 RVDs, again more preferably, 15.5 RVDs.
  • said half-RVD is in a core scaffold context which allows a lack of specificity of said half-RVD toward nucleotides A, C, G, T. In a more preferred embodiment, said half-RVD is absent.
  • said core scaffold of the present invention comprises RVDs of different origins.
  • said core scaffold comprises RVDs originating from different naturally occurring TAL effectors.
  • internal structure of some RVDs of the core scaffold of the present invention are constituted by structures or sequences originated from different naturally occurring TAL effectors.
  • said core scaffold of the present invention comprises RVDs-like domains. RVDs-like domains have a sequence different from naturally occurring RVDs but have the same function and / or global structure within said core scaffold of the present invention.
  • said additional N-terminal domain of said engineered core TALE scaffold of said compact TALEN according to the present invention is an enhancer domain.
  • said enhancer domain is selected from the group consisting of Puf RNA binding protein or Ankyrin super-family, as non-limiting examples.
  • said enhancer domain sequence is selected from the group consisting of protein domains of SEQ ID NO: 4 and SEQ ID NO: 5 as non-limiting examples listed in Table 1, a functional mutant, a variant or a derivative thereof.
  • said additional C-terminal domain of said engineered core TALE scaffold is an enhancer domain.
  • said enhancer domain is selected from the group consisting of hydrolase/transferase of Pseudomonas Aeuriginosa family, the polymerase domain from the Mycobacterium tuberculosis Ligase D family, the initiation factor elF2 from Pyrococcus family, the translation initiation factor Aif2 family as non-limiting examples.
  • said enhancer domain sequence is selected from the group consisting of protein domains of SEQ ID NO: 6 to SEQ ID NO: 9 as non-limiting examples listed in Table 1.
  • the catalytic domain that is capable of processing DNA nearby the single double-stranded DNA target sequence of interest, when fused to said engineered core TALE scaffold according to the present invention is fused to the N-terminus part of said core TALE scaffold.
  • said catalytic domain is fused to the C-terminus part of said core TALE scaffold.
  • two catalytic domains are fused to both N-terminus part of said core TALE scaffold and C-terminus part of said core TALE scaffold.
  • said catalytic domain has an enzymatic activity selected from the group consisting of nuclease activity, polymerase activity, kinase activity, phosphatase activity, methylase activity, topoisomerase activity, integrase activity, transposase activity or ligase activity.
  • the catalytic domain fused to the core TALE scaffold of the present invention can be a transcription activator or repressor (i.e. a transcription regulator), or a protein that interacts with or modifies other proteins such as histones.
  • Non-limiting examples of DNA processing activities of said compact TALEN of the present invention include, for example, creating or modifying epigenetic regulatory elements, making site-specific insertions, deletions, or repairs in DNA, controlling gene expression, and modifying chromatin structure.
  • said catalytic domain of the compact TALEN according to the present invention is ColE7 (SEQ ID NO: 11), a functional mutant, a variant or a derivative thereof.
  • catalytic domain ColE7 (SEQ ID NO: 11), a functional mutant, a variant or a derivative thereof is fused to the N-terminal domain of said core TALE scaffold according to the method of the present invention.
  • catalytic domain ColE7 (SEQ ID NO: 11), a functional mutant, a variant or a derivative thereof is fused to the C-terminal domain of said core TALE scaffold according to the method of the present invention.
  • said compact TALEN according to the method of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 435-438.
  • catalytic domain l-Crel (SEQ ID NO: 1), a functional mutant, a variant or a derivative thereof is fused to the C-terminal domain of said core TALE scaffold according to the present invention.
  • said compact TALEN according to the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group of SEQ ID NO: 439-441 and SEQ ID NO: 444-446.
  • said catalytic domain is a restriction enzyme such as mel, R-HinPII, R.Mspl, R.Mval, Nb.BsrDI, BsrDI A, Nt.BspD6l, ss.BspD6l, R.PIel, Mlyl and Alwl as non-limiting examples listed in table 2.
  • said catalytic domain has an exonuclease activity.
  • any combinations of two catalytic domains selected from the group consisting of proteins Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (END1_EC0LI), Human Endo G (NUCG_HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, l-Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC_STAHY), Micrococcal nuclease (NUC_SHIFL), Endonuclease yncB, Endodeoxyribonucle
  • l-Hmul catalytic domain can be fused to the N-terminus part of said core TALE scaffold and ColE7 catalytic domain can be fused to the C-terminus part of said core TALE scaffold.
  • l-Tevl catalytic domain can be fused to the N-terminus part of said core TALE scaffold and ColE7 catalytic domain can be fused to the C-terminus part of said core TALE scaffold.
  • ID NO :368 can be used in combination with another catalytic domain according to the list of Table2.
  • Table 14 Examples of combinations of catalytic domains respectively fused to N and C-terminus part of compact TALEN core scaffolds according to the present invention leading to dual-cleavage TALENs.
  • said unique compact TALEN monomer comprises a combination of two catalytic domains respectively fused to the N-terminus part and to the C-terminus part of said core TALE scaffold selected from the group consisting of:
  • said compact TALEN according to the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 448 and 450.
  • said compact TALEN according to the present invention comprises a combination of two catalytic domains respectively fused to the C-terminus part and to the N-terminus part of said core TALE scaffold selected from the group consisting of:
  • said compact TALEN according to the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 447-450 and SEQ ID NO: 452.
  • said catalytic domain and / or said enhancer domain between two parts of the engineered core TALE scaffold according to the invention, each part comprising one set of RVDs.
  • the number of RVDs for each part of the engineered core TALE scaffold can be the same or not.
  • said compact TALEN according to the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 453- 455.
  • the compact TALEN monomer of the present invention comprises a protein sequence having at least 80%, more preferably 90%, again more preferably 95% amino acid sequence identity with the protein sequences selected from the group consisting of SEQ ID NO: 420- 450 and 452-455.
  • the peptidic linker that can link said catalytic domain to the core TALE scaffold according to the method of the present invention can be selected from the group consisting of NFSl, NFS2, CFS1, RM2, BQY, QGPSG, LGPDGRKA, la8h_l, ldnpA_l, ld8cA_2, lckqA_3, lsbp_l, lev7A_l, lalo_3, lamfJL, ladjA_3, lfcdC_l, lal3_2, lg3p_l, lacc_3, lahjB_l, lacc_l, laf7_l, lheiA_l, lbia_2, ligtB_l, lnfkA_l, lau7A_l, lbpoB_l, lb0pA_2, lc05A_2, lgcb_l, lbt3
  • the peptidic linker that can link said catalytic domain to the core TALE scaffold according to the method of the present invention can be selected from the group consisting of NFSl (SEQ ID NO: 98), NFS2 (SEQ ID NO: 99) andCFSl (SEQ ID NO: 100).
  • NFSl SEQ ID NO: 98
  • NFS2 SEQ ID NO: 99
  • CFSl SEQ ID NO: 100
  • a peptidic linker is not needed to fuse a catalytical domain to the TALE scaffold in order to obtain a cTALEN according to the present invention.
  • a compact TALEN according to the present invention can comprise different levels of separate enzymatic activities able to differently process DNA, resulting in a global DNA processing efficiency for said compact TALEN, each one of said different enzymatic activities having their own DNA processing efficiency.
  • the compact TALEN according to the present invention further comprises:
  • said unique compact TALEN monomer further comprises: (i) At least one enhancer domain;
  • said enhancer domain is fused to N-terminus of the core TALE scaffold part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused to C-terminus of the core TALE scaffold part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused to the catalytic domain part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused between the N-terminus part of the core TALE scaffold and the catalytic part of said compact TALEN entity. In another more preferred embodiment, said enhancer domain is fused between the C-terminus part of the core TALE scaffold and the catalytic part of said compact TALEN entity.
  • each engineered core TALE scaffold comprising one set of RVDs.
  • the number of RVDs for each engineered core TALE scaffold can be the same or not.
  • said enhancer domain is catalytically active or not, providing functional and/or structural support to said compact TALEN entity.
  • said enhancer domain consists of a protein domain selected from the group consisting of Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (ENDl_ECOLI), Human Endo G (NUCG_HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, I- Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC_STAHY), Micrococcal nucle
  • said enhancer domain consists of a catalytically active derivative of the protein domains listed above and in Table 2, providing functional and/or structural support to said compact TALEN entity.
  • said enhancer domain consists of a catalytically inactive derivative of the protein domains listed above and in Table 2, providing structural support to said compact TALEN entity.
  • said enhancer domain is selected from the group consisting of l-Tevl (SEQ ID NO: 20), ColE7 (SEQ ID NO: 11) and NucA (SEQ ID NO: 26).
  • said enhanced compact TALEN according to the present invention can comprise a second enhancer domain.
  • said second enhancer domain can have the same characteristics than the first enhancer domain.
  • said second enhancer domain provides structural support to enhanced compact TALEN entity.
  • said second enhancer domain provides functional support to enhanced compact TALEN entity.
  • said second enhancer domain provides structural and functional supports to enhanced compact TALEN entity.
  • said enhanced compact TALEN entity comprises one catalytic domain and one enhancer domain.
  • said enhanced compact TALEN entity comprises one catalytic domain and two enhancer domains.
  • said enhanced compact TALEN entity comprises two catalytic domains and one enhancer domains.
  • said enhanced compact TALEN entity comprises two catalytic domains and two enhancer domains.
  • said second enhancer domain consists of a protein domain derived from a protein selected from the group consisting of Mmel, Colicin-E7 (CEA7_ECOLX), Colicin-E9, APFL, EndA, Endo I (END1_EC0LI), Human Endo G (NUCG_HUMAN), Bovine Endo G (NUCG_BOVIN), R.HinPll, l-Basl, l-Bmol, l-Hmul, l-Tevl, l-Tevll, l-Tevlll, l-Twol, R.Mspl, R.Mval, NucA, NucM, Vvn, Vvn_CLS, Staphylococcal nuclease (NUC_STAAU), Staphylococcal nuclease (NUC_STAHY), Micrococcal nuclease (NUC_SHIFL), Endonuclease yncB
  • said second enhancer domain consists of a catalytically active derivative of the protein domains listed above and in Table 2, providing functional and/or structural support to said enhanced compact TALEN entity.
  • said second enhancer domain consists of a catalytically inactive derivative of the protein domains listed above and in Table 2, providing structural support to said enhanced compact TALEN entity.
  • an enhanced compact TALEN can present different levels of separate enzymatic activities able to differently process DNA, resulting in a global DNA processing efficiency for said enhanced compact TALEN, each one of said different enzymatic activities having their own DNA processing efficiency.
  • the DNA processing efficiency of the compact TALEN entity according to the present invention can be enhanced by the engineering of at least one enhancer domain and one peptidic linker thereby obtaining a compact TALEN entity with enhanced DNA processing activity nearby a single double-stranded DNA target sequence of interest, i.e a enhanced compact TALEN according to the present invention.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention can have a dominant enzymatic activity selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention is a combination of different enzymatic activities selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency that is enhanced in said enhanced compact TALEN according to the present invention is one of its different enzymatic activities selected from the group consisting of a nuclease activity, a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • the global DNA processing efficiency is equivalent to one DNA processing activity amongst the enzymatic activities mentioned above.
  • said DNA processing activity of the compact TALEN entity which is enhanced by the enhancer is a cleavase activity or a nickase activity or a combination of both a cleavase activity and a nickase activity.
  • Enhancement of DNA processing efficiency of a compact TALEN entity according to the present invention can be a consequence of a structural support by said at least one enhancer domain.
  • said structural support enhances the binding of a compact TALEN entity according to the invention for said DNA target sequence compared to the binding of a starting compact TALEN entity for the same DNA target sequence, thereby indirectly assisting the catalytic domain(s) to obtain a compact TALEN entity with enhanced DNA processing activity.
  • said structural support enhances the existing catalytical activity of a compact TALEN entity for a DNA target sequence compared to the binding of a starting compact TALEN entity for the same DNA target sequence to obtain a compact TALEN entity with enhanced DNA processing activity.
  • said enhancer according to the present invention both enhances the binding of the compact TALEN entity for said DNA target sequence and the catalytic activity of the catalytic domain(s) to obtain a compact TALEN entity with enhanced DNA processing activity. All these non-limiting examples lead to a compact TALEN entity with enhanced DNA processing efficiency for a DNA target sequence at a genomic locus of interest, i.e an enhanced compact TALEN according to the present invention.
  • Enhancement of DNA processing efficiency of a compact TALEN entity according to the present invention can also be a consequence of a fuctional support by said at least one enhancer domain.
  • said functional support can be the consequence of the hydrolysis of additional phosphodiester bonds.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a nuclease.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from an endonuclease.
  • said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a cleavase. In another more preferred embodiment, said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from a nickase. In a more preferred embodiment, said functional support can be the hydrolysis of additional phosphodiester bonds by a protein domain derived from an exonuclease.
  • the efficiency of rare-cutting endonuclease e.g. their ability to induce a desired event (Homologous gene targeting, targeted mutagenesis, sequence removal or excision) at a locus, depends on several parameters, including the specific activity of the nuclease, probably the accessibility of the target, and the efficacy and outcome of the repair pathway(s) resulting in the desired event (homologous repair for gene targeting, NHEJ pathways for targeted mutagenesis).
  • Cleavage by peptidic rare cutting endonucleases usually generates cohesive ends, with 3' overhangs for LAGLIDADG meganucleases (Chevalier and Stoddard 2001) and 5' overhangs for Zinc Finger Nucleases (Smith, Bibikova et al. 2000). These ends, which result from hydrolysis of phosphodiester bonds, can be re-ligated in vivo by N HEJ in a seamless way (i.e a scarless re-ligation).
  • the restoration of a cleavable target sequence allows for a new cleavage event by the same endonuclease, and thus, a series of futile cycles of cleavage and re-ligation events can take place.
  • DSB resection is important for certain DSB pathways. Extensive DSB resection, resulting in the generation of large single stranded regions (a few hundred nucleotides at least), has been shown in yeast to initiate single strand annealing (Sugawara and Haber 1992) and strand invasion, the ATP-dependant step that initiates many homologous recombination events of DNA duplex invasion by an homologous strand that (White and Haber 1990; Sun, Treco et al. 1991) (for a review of mechanisms, see (Paques and Haber 1999)).
  • DSB resection depends on several proteins including BLM/Sgsl and DNA2, EXOI, and the MRN complex (Mrell, Rad50, Nbsl/Xrs2) and is thought to result from different pathways. M RN is involved in a small scale resection process, while two redundant pathways depending on BLM and DNA2 on one hand, and on EXOI on another hand, would be involved in extensive resection (Mimitou and Symington 2008; Nimonkar, Genschel et al. 2011).
  • the efficiency of a compact TALEN e.g. it ability to produce a desired event such as targeted mutagenesis or homologous gene targeting (see definition for full definition of "efficiency of compact TALEN")
  • a desired event such as targeted mutagenesis or homologous gene targeting
  • an enhancement or modification of its global DNA processing efficiency e.g. the global resultant or the overall result of different separate enzymatic activities that said compact TALEN.
  • enhancement of global DNA processing efficiency of a compact TALEN entity according to the present invention can be the hydrolysis of additional phosphodiester bonds at the cleavage site.
  • Said hydrolysis of additional phosphodiester bonds at the cleavage site by said at least one enhancer according to the invention can lead to different types of DSB resection affecting at said DSB cleavage site, one single DNA strand or both DNA strands, affecting either 5' overhangs ends, either 3' overhangs ends, or both ends and depending on the length of said resection.
  • adding new nickase or cleavase activities to the existing cleavase activity of a compact TALEN entity can enhance the efficiency of the resulting enhanced compact TALEN according to the invention, at a genomic locus of interest ( Figure 8B-8E).
  • the addition of a single nickase activity can result in a single strand gap, and suppress the cohesivity of the ends, which can also enhances the efficiency of the resulting enhanced compact TALEN at a genomic locus of interest, according to the invention, via stimulation of one or several alternative repair outcomes mentioned above.
  • enhancement of DNA processing efficiency of a compact TALEN refers to the increase in the detected level of said DNA processing efficiency, against a target DNA sequence, of a compact TALEN in comparison to the activity of a first compact TALEN against the same target DNA sequence.
  • Said first compact TALEN can be a starting compact TALEN, or a compact TALEN that has already been engineered or an enhanced compact TALEN according to the present invention.
  • Several rounds of enhancement can be envisioned from a starting compact TALEN or from a starting enhanced compact TALEN.
  • enhancement of the DNA processing efficiency of the compact TALEN entity refers to the increase in the detected level of said DNA processing efficiency against a target DNA sequence of interest or nearby said DNA sequence of interest in comparison to the efficiency of a first compact TALEN or starting compact TALEN against or nearby the same target DNA sequence.
  • the starting compact TALEN is taken as the reference scaffold to measure the DNA processing efficiency.
  • Said enhanced compact TALEN is an engineered compact TALEN comprising an enhancer domain according to this aspect of the invention.
  • Said enhanced compact TALEN can also be taken as a reference scaffold for further enhancement in said DNA processing efficiency.
  • said DNA processing efficiency can result from a cleavage-induced recombination generated by said enhanced compact TALEN.
  • said level of cleavage-induced recombination can be determined, for instance, by a cell-based recombination assay as described in the International PCT Application WO 2004/067736.
  • enhancement of efficacy in cells can be, but is not necessarily associated with an enhancement of the cleavage activity that could be detected in certain in vitro assays.
  • the peptidic linker that can link said enhancer domain to one part of said compact TALEN entity according to the method of the present invention can be selected from the group consisting of NFS1, NFS2, CFS1, R 2, BQY, QGPSG, LGPDGRKA, la8h_l, ldnpA_l, ld8cA_2, lckqA_3, lsbp_l, lev7A_l, lalo_3, lamf_l, ladjA_3, lfcdC_l, lal3_2, lg3p_l, lacc_3, lahjBJL, lacc_l, laf7_l, lheiA_l, lbia_2, ligtB_l, lnfkA_l, lau7A_l, lbpoB_l, lb0pA_2, lc05A_2, lgcb_l, lbt
  • a compact TALEN or an enhanced compact TALEN can comprise different levels of separate enzymatic activities able to differently process DNA as mentioned above.
  • compact TALENs are designed to alleviate the need for multiple independent protein moieties when targeting a DNA processing event.
  • the requisite "spacer" region and dual target sites essential for the function of current TALENs are unnecessary, as compact TALENs according to the invention comprises a core TALE scaffold containing only one DNA binding domain to target a specific single double-stranded DNA target sequence of interest and process DNA nearby said single double-stranded DNA target sequence of interest.
  • the order (N- v.s C-terminal) of addition of the catalytic and enhancement domains can vary with the application.
  • compact TALENs can be enhanced through the addition of a domain to promote existing or alternate activities as non-limiting examples depicted in figure 6 :
  • the enhancer domain is fused to the compact TALEN via the N-terminus of its catalytic domain part. Such a configuration can be used to assist and/or anchor the catalytic domain part near the DNA to increase DNA processing activity.
  • C The enhancer domain is sandwiched between the catalytic domain part and the core TALE scaffold part. The enhancer domain can promote communication between the flanking domains (i.e.
  • the enhancer domain is used to functionally replace the engineered core TALE scaffold N-terminal region.
  • the enhancer domain is used to functionally replace the engineered core TALE scaffold C-terminal region. Fusion junctions (N- vs. C-terminal) and linker designs can vary with the application.
  • the nature of the catalytic domain(s) comprised in the compact TALEN and the enhanced compact TALEN is application dependent.
  • a nickase domain should allow for a higher HR/NHEJ ratio than a cleavase domain, thereby being more agreeable for therapeutic applications (McConnell Smith, Takeuchi et al. 2009; Metzger, McConnell- Smith et al. 2011).
  • McConnell Smith Takeuchi et al. 2009
  • Metzger McConnell- Smith et al. 2011
  • the coupling of a cleavase domain on one side with a nickase domain on the other could result in excision of a single-strand of DNA spanning the binding region of a compact TALEN.
  • the targeted generation of extended single-strand overhangs could be applied in applications that target DNA repair mechanisms.
  • the use of two cleavase domains is then preferred.
  • the use of two nickase domains can be favored.
  • the invention relates to a method for generating several distinct types of compact TALENs that can be applied to applications ranging from targeted DNA cleavage to targeted gene regulation.
  • the present invention also relates to methods for use of said compact TALENs according to the invention for various applications ranging from targeted DNA cleavage to targeted gene regulation.
  • the present invention relates to a method for increasing targeted HR (and NHEJ) when Double-Strand break activity is promoted in a compact TALEN targeting a DNA target sequence according to the invention.
  • the addition of at least two catalytically active cleavase enhancer domains according to the invention allows to increase Double-strand break-induced mutagenesis by leading to a loss of genetic information and preventing any scarless re-ligation of targeted genomic locus of interest by NHEJ.
  • the present invention relates to a method for increasing targeted H with less NHEJ (i.e in a more conservative fashion) when Single-Strand Break activity is promoted in a compact TALEN targeting a DNA target sequence according to the invention.
  • the present invention relates to a method for increasing excision of a single-strand of DNA spanning the binding region of a compact TALEN when both one cleavase enhancer domain and one nickase enhancer domain, respectively, are fused to both N-terminus and C-terminus of a core TALE scaffold according to the invention.
  • the present invention relates to a method for inserting a transgene into a specific single double-stranded DNA target sequence of a genomic locus of a cell, tissue or non-human animal, or a plant wherein at least one compact TALEN of the present invention is transitory or not introduced into said cell, tissue, non-human animal or plant.
  • the present invention relates to a method to inhibit the activity of a compact TALEN when expressed in a cell wherein said method comprises the step of introducing in said cell an auxiliary domain inhibiting the activity of said compact TALEN.
  • the catalytic domain of said compact TALEN is NucA (SEQ ID NO: 26) and said auxiliary domain is NuiA (SEQ ID NO: 229), a functional mutant, a variant or a derivative thereof.
  • the catalytic domain of said compact TALEN is ColE7 (SEQ ID NO: 11) and said auxiliary domain is Im7 (SEQ ID NO: 230), a functional mutant, a variant or a derivative thereof.
  • non-human transgenic animal comprising a vector and /or a recombinant polynucleotide encoding for a compact TALEN or an enhanced compact TALEN according to the present invention.
  • Vectors comprising targeting DNA and/or nucleic acid encoding a compact TALEN can be introduced into a cell by a variety of methods (e.g., injection, direct uptake, projectile bombardment, liposomes, electroporation).
  • Compact TALENs can be stably or transiently expressed into cells using expression vectors. Techniques of expression in eukaryotic cells are well known to those in the art. (See Current Protocols in Human Genetics: Chapter 12 "Vectors For Gene Therapy” & Chapter 13 "Delivery Systems for Gene Therapy”).
  • the compact TALEN of the present invention is substantially non-immunogenic, i.e., engender little or no adverse immunological response.
  • the compact TALEN is substantially free of N-formyl methionine.
  • Another way to avoid unwanted immunological reactions is to conjugate compact TALEN to polyethylene glycol ("PEG”) or polypropylene glycol (“PPG”) (preferably of 500 to 20,000 daltons average molecular weight (MW)). Conjugation with PEG or PPG, as described by Davis et al. (US 4,179,337) for example, can provide non-immunogenic, physiologically active, water soluble compact TALEN conjugates with anti-viral activity. Similar methods also using a polyethylene-polypropylene glycol copolymer are described in Saifer et al. (US 5,006,333).
  • compact TALEN i.e one compact TALEN active entity
  • enhanced compact TALENs i.e one enhanced compact TALEN active entity
  • two different compact TALENs or two enhanced compact TALENs can be used.
  • said two different compact TALENs can comprise the same core TALE scaffold or not; said two different compact TALENs can comprise the same set of Repeat Variable Dipeptides or not; said two different compact TALENs can comprise the same catalytic domain or not.
  • two identical compact TALENs active entities When two identical compact TALENs active entities are used for DNA processing according to the invention, they can be considered as a homodimeric pair of compact TALENs active entities.
  • two non identical compact TALENs active entities When two non identical compact TALENs active entities are used for DNA processing according to the invention, they can be considered as a heterodimeric pair of compact TALENs active entities.
  • one of the compact TALEN can modulate the activity of the other one, leading for instance to an enhanced DNA processing event compared to the same DNA processing event achieved by only one compact TALEN; in this non-limiting example, a Trans-TALEN modulates and enhances the catalytic activity of an initial compact TALEN.
  • a combination of compact TALENs, enhanced compact TALENs and dual-cleavage compact TALENs can be used, said compact TALENs comprising the same catalytic domain or not, the same core TALE scaffold or not.
  • DNA target sequence for each compact TALENs of the combination to be used can be located on a same endogenous genomic DNA locus of interest or not. Said DNA target sequences can be located at an approximative distance of 1000 base pairs (bps).
  • said DNA target sequences can be located at an approximative distance of 500 bps or 200 bps, or 100 bps, or 50 bps, or 20 bps, 19 bps, 18 bps, 17 bps, 16 bps, 15 bps, 14 bps, 13 bps, 12 bps, 11 bps, 10 bps, 9 bps, 8 bps, 7 bps, 6 bps, 5 bps, 4 bps, 3 bps, 2 bps, 1 bp.
  • Said DNA target sequences located at distances mentioned above are "nearby" DNA sequences in reference to the target DNA sequence for DNA processing according to the present invention.
  • two compact TALENs active entities can be used as a way of achieving two different DNA processing activities nearby a DNA target sequence according to the invention.
  • two compact TALENs targeting said DNA sequence or DNA sequences nearby said targeted DNA sequence and comprising each one a nickase-derived catalytic domain can be used; in this case, this use of two compact TALENs active entities can represent an alternative way of achieving a Double Strand Break nearby a said DNA target sequence, compared to the use of one compact TALEN targeting said DNA sequence and comprising a cleavase-derived catalytic domain, or not.
  • one compact TALEN comprising a cleavase-derived domain and one compact TALEN comprising an exonuclease-derived domain can be used to make a Double Strand Break and create a gap, respectively, to achieve an imprecise NHEJ event at the genomic locus of interest comprising said DNA target sequence.
  • each compact TALEN forming this heterodimeric pair of compact TALENs is active by itself, each of these active entities is dependent of the other one to achieve the wanted resulting DNA processing activity.
  • the wanted resulting activity is a gap created by the exonuclease activity, said exonuclease activity being possible only from the Double Strand Break achieved by the cleavase domain of the other compact TALENs.
  • the wanted resulting activity is also envisioned the case where two identical compact TALEN active entities (a homodimeric pair of compact TALENs) are dependent each other to achieve a wanted resulting DNA processing activity.
  • - Amino acid substitution means the replacement of one amino acid residue with another, for instance the replacement of an Arginine residue with a Glutamine residue in a peptide sequence is an amino acid substitution.
  • Enhanced/increased/improved DNA processing activity refers to an increase in the detected level of a given compact TALEN or enhanced compact TALEN associated DNA processing activity against a target DNA sequence or DNA target sequence by a second compact TALEN or enhanced compact TALEN in comparison to the activity of a first compact TALEN or enhanced compact TALEN against the target DNA sequence.
  • the second compact TALEN or enhanced compact TALEN can be a variant of the first one and can comprise one or more substituted amino acid residues in comparison to the first compact TALEN or enhanced compact TALEN.
  • the second compact TALEN or enhanced compact TALEN can be a variant of the first one and can comprise one or more catalytic and/or enhancer domains in comparison to said first compact TALEN or enhanced compact TALEN.
  • This definition more broadly applies for other endonucleases and rare-cutting endonucleases.
  • - DNA processing activity refers to a particular / given enzymatic activity of said compact TALEN or enhanced compact TALEN or more broadly to qualify the enzymatic activity of a rare- cutting endonuclease.
  • Said DNA processing activity can refer to a cleavage activity, either a cleavase activity either a nickase activity, more broadly a nuclease activity but also a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • said given DNA processing activity of a particular enzymatic activity can also be described as DNA processing efficiency of said particular enzymatic activity.
  • Methods for enhancing compact TALEN or enhanced compact TALEN DNA processing activity according to this definition are encompassed in the present invention.
  • Global DNA processing efficiency describes, for a compact TALEN or an enhanced compact TALEN according to the present invention, the global resultant or the overall effect of different separate enzymatic activities that said compact TALEN or enhanced compact TALEN can comprise.
  • a compact TALEN or an enhanced compact TALEN presents a global capacity to process DNA nearby a target sequence in a genomic locus of interest, i.e a global DNA processing efficiency.
  • Said global DNA processing efficiency can qualify or rank a second given compact TALEN or enhanced compact TALEN in comparison to a first given compact TALEN or enhanced compact TALEN.
  • said global DNA processing efficiency can refer to only one enzymatic activity, two enzymatic activities, three enzymatic activities, four enzymatic activities or more than four enzymatic activities.
  • Said global DNA processing efficiency can refer to the sum of individual enzymatic activities.
  • Said global DNA processing efficiency can refer to the synergy or combined effect of different enzymatic activities comprised in a given compact TALEN or enhanced compact TALEN.
  • An enhancement of the DNA processing efficiency of a compact TALEN according to the present invention can reflect a synergy, an enhanced combined effect, resulting in an enhanced compact TALEN characterized by a global DNA processing efficiency that is greater than the sum of respective DNA processing efficiencies of separate starting compact TALEN or than the sum of respective DNA processing efficiencies of separate enzymatic activities comprised in a same starting compact TALEN.
  • Efficiency of a rare-cutting endonuclease is the property for said rare-cutting endonuclease of producing a desired event.
  • This desired event can be for example Homologous gene targeting, targeted mutagenesis, or sequence removal or excision.
  • the efficiency of the desired event depends on several parameters, including the specific activity of the nuclease and the repair pathway(s) resulting in the desired event (efficacy of homologous repair for gene targeting, efficacy and outcome of NHEJ pathways for targeted mutagenesis).
  • Efficiency of a rare cutting endonuclease for a locus is intended to mean its ability to produce a desired event at this locus.
  • Efficiency of a rare cutting endonuclease for a target is intended to mean its ability to produce a desired event as a consequence of cleavage of this target.
  • - by "meganuclease” is intended a rare-cutting endonuclease subtype having a double- stranded DNA target sequence greater than 12 bp.
  • Said meganuclease is either a dimeric enzyme, wherein each domain is on a monomer or a monomeric enzyme comprising the two domains on a single polypeptide.
  • Variant designation also applies for instance for an enhanced compact TALEN comprising at least one supplementary protein domain (catalytic or enhancer domain) in comparison to the starting compact TALEN entity.
  • variants and protein domains comprised in these variants which present a sequence with high percentage of identity or high percentage of homology with sequences of compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains and polypeptides according to the present invention, at nucleotidic or polypeptidic levels.
  • peptide linker by "peptide linker", “peptidic linker” or “peptide spacer” it is intended to mean a peptide sequence which allows the connection of different monomers in a fusion protein and the adoption of the correct conformation for said fusion protein activity and which does not alter the specificity of either of the monomers for their targets.
  • Peptide linkers can be of various sizes, from 3 amino acids to 50 amino acids as a non limiting indicative range. Peptide linkers can also be structured or unstructured.
  • one cell type related to the chosen cell type or organism is intended a cell type or an organism sharing characteristics with said chosen cell type or said chosen organism; this cell type or organism related to the chosen cell type or organism, can be derived from said chosen cell type or organism or not.
  • targeting DNA construct/minimal repair matrix/repair matrix it is intended to mean a DNA construct comprising a first and second portion that are homologous to regions 5' and 3' of the DNA target in situ.
  • the DNA construct also comprises a third portion positioned between the first and second portion which comprise some homology with the corresponding DNA sequence in situ or alternatively comprise no homology with the regions 5' and 3' of the DNA target in situ.
  • a homologous recombination event is stimulated between the genome containing the targeted gene comprised in the locus of interest and the repair matrix, wherein the genomic sequence containing the DNA target is replaced by the third portion of the repair matrix and a variable part of the first and second portions of the repair matrix.
  • a functional variant is intended a catalytically active variant of a protein, such variant can have additional properties compared to its parent protein.
  • a functional variant of a meganuclease can be able to cleave a DNA target sequence, preferably said target being a new target which is not cleaved by the parent meganuclease.
  • This definition also applies to compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains that constitute such TALENs according to the present invention.
  • polypeptides and protein domains comprised in these molecules which present a sequence with high percentage of identity or high percentage of homology with sequences of compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains and polypeptides according to the present invention, at nucleotidic or polypeptidic levels.
  • high percentage of identity or high percentage of homology it is intended 60%, more preferably 70%, more preferably 75%, more preferably 80%, more preferably 85%, more preferably 90%, more preferably 95, more preferably 97%, more preferably 99% or any integer comprised between 60% and 99%.
  • This expression can also apply to compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains that constitute such TALENs according to the present invention.
  • derivatives of compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains and derivatives of polypeptides according to the present invention which present a sequence with high percentage of identity or high percentage of homology with sequences of compact TALENs, enhanced compact TALENs, dual-cleavage compact TALENs or protein domains and polypeptides according to the present invention, at nucleotidic or polypeptidic levels.
  • l-Crel is intended the wild-type l-Crel having the sequence of pdb accession code lg9y, corresponding to the sequence SEQ ID NO: 1 in the sequence listing.
  • l-Cre ⁇ variants described can comprise an additional Alanine after the first Methionine of the wild type /-Crel sequence (SEQ ID NO: 1).
  • SEQ ID NO: 1 the sequence of pdb accession code lg9y, corresponding to the sequence SEQ ID NO: 1 in the sequence listing.
  • l-Cre ⁇ variants described can comprise an additional Alanine after the first Methionine of the wild type /-Crel sequence (SEQ ID NO: 1).
  • variants may also comprise two additional Alanine residues and an Aspartic Acid residue after the final Proline of the wild type /-Crel sequence as shown in SEQ ID NO: 106.
  • l-Crel sites include the wild-type non-palindromic l-Crel homing site and the derived palindromic sequences such as the sequence 5'- t.i2C. u a.ioa.9a. 8 a.7C. 6 g.st J ,c.3g.2t. ia + iC +2 g +3 a +4 c + 5g + 6t + 7t + 8t + 9t + iog + iia + i2 (SEQ ID NO: 2), also called C1221 or C1221 target.
  • SEQ ID NO: 2 also called C1221 or C1221 target.
  • LAGLIDADG homing endonuclease core domain which is the characteristic ⁇ ⁇ of the homing endonucleases of the LAGLIDADG family, corresponding to a sequence of about one hundred amino acid residues.
  • Said domain comprises four beta-strands ( ⁇ ⁇ 2 ⁇ 3 ⁇ 4) folded in an anti-parallel beta-sheet which interacts with one half of the DNA target.
  • This domain is able to associate with another LAGLIDADG homing endonuclease core domain which interacts with the other half of the DNA target to form a functional endonuclease able to cleave said DNA target.
  • the LAGLIDADG homing endonuclease core domain corresponds to the residues 6 to 94.
  • beta-hairpin is intended two consecutive beta-strands of the antiparallel beta-sheet of a LAGLIDADG homing endonuclease core domain ( ⁇ ⁇ 2 0 ⁇ ⁇ 3 ⁇ 4 ) which are connected by a loop or a turn.
  • single-chain meganuclease is intended a meganuclease comprising two LAGLIDADG homing endonuclease domains or core domains linked by a peptidic spacer.
  • the single-chain meganuclease is able to cleave a chimeric DNA target sequence comprising one different half of each parent meganuclease target sequence.
  • cleavage site is intended a double-stranded palindromic, partially palindromic (pseudo-palindromic) or non-palindromic polynucleotide sequence that is recognized and can be cleaved by a LAGLIDADG homing endonuclease such as l-Crel, or a variant, or a single-chain chimeric meganuclease derived from I- Crel.
  • Said DNA target sequence can be qualified as "cleavable" by an endonuclease, rare-cutting endonuclease, chimeric rare-cutting endonuclease or meganuclease when recognized within a genomic sequence and known to correspond to the DNA target sequence of a given endonuclease, rare-cutting endonuclease, chimeric rare-cutting endonuclease or meganuclease or a variant of such endonuclease, rare-cutting endonuclease, chimeric rare-cutting endonuclease or meganuclease.
  • telomeres a DNA location
  • a genomic location preferably a genomic location
  • genetic material that can exist independently to the main body of genetic material such as plasmids, episomes, virus, transposons or in organelles such as mitochondria or chloroplasts as non-limiting examples, at which a double stranded break (cleavage) can be induced by the endonuclease, rare- cutting endonuclease, chimeric rare-cutting endonuclease or meganuclease.
  • the DNA target is defined by the 5' to 3' sequence of one strand of the double-stranded polynucleotide, as indicate above for C1221 (SEQ ID NO: 2).
  • Cleavage of the DNA target can occur at the nucleotides at positions +2 and -2, respectively for the sense and the antisense strand.
  • the position at which cleavage of the DNA target by an l-Crel-derived variant can occur corresponds to the cleavage site on the sense strand of the DNA target.
  • compact TALENs a subclass of chimeric rare-cutting endonucleases
  • the following expressions "DNA target”, “DNA target sequence”, “target DNA sequence”, “target sequence” , “target-site”, “target” , “site”, “site of interest”, “recognition site”, “polynucleotide recognition site”, and “recognition sequence” can apply to qualify their specific DNA target sequence with the particularity that said specific DNA target sequence recognized by the compact TALEN according to the invention is the one or not that is processed and/or cut by the compact TALEN.
  • a compact TALEN, an enhanced compact TALEN or a dual cleavage compact TALEN according to the present invention can process and / or cut DNA within said specific DNA target sequence.
  • a compact TALEN, an enhanced compact TALEN or a dual cleavage compact TALEN can also process and / or cut DNA outside said specific DNA target sequence.
  • DNA nearby said specific DNA target sequence or by “DNA nearby” is intended DNA sequence or sequences located within or outside said specific DNA target sequence.
  • single double-stranded DNA target sequence is intended a compact-TALEN or enhanced compact TALEN or dual-cleavage compact TALEN binding site.
  • the recognition DNA binding site of a compact-TALEN or enhanced compact TALEN or dual-cleavage compact TALEN can be ranging from 12 to 100 base pairs (bp) in length, usually greater than 12 bps in length.
  • DNA target half-site by "DNA target half-site", "half cleavage site” or half-site” is intended the portion of the DNA target which is bound by each LAGLIDADG homing endonuclease core domain.
  • Endonuclease refers to any wild-type or variant enzyme capable of catalyzing the hydrolysis (cleavage) of bonds between nucleic acids within a DNA or RNA molecule, preferably a DNA molecule.
  • Endonucleases can be classified as rare-cutting endonucleases when having typically a polynucleotide recognition greater than 12 base pairs (bp) in length, more preferably of 14-45 bp.
  • Rare-cutting endonucleases significantly increase HR by inducing DNA double-strand breaks (DSBs) at a defined locus (Rouet, Smih et al. 1994; Rouet, Smih et al.
  • Rare-cutting endonucleases can for example be a homing endonuclease (Paques and Duchateau 2007), a chimeric Zinc-Finger nuclease (ZFN) resulting from the fusion of engineered zinc-finger domains with the catalytic domain of a restriction enzyme such as Fokl (Porteus and Carroll 2005) or a chemical endonuclease (Eisenschmidt, Lanio et al. 2005 ; Arimondo, Thomas et al. 2006; Simon, Cannata et al. 2008).
  • a chemical or peptidic cleaver is conjugated either to a polymer of nucleic acids or to another DNA recognizing a specific target sequence, thereby targeting the cleavage activity to a specific sequence.
  • Chemical endonucleases also encompass synthetic nucleases like conjugates of orthophenanthroline, a DNA cleaving molecule, and triplex-forming oligonucleotides (TFOs), known to bind specific DNA sequences (Kalish and Glazer 2005). Such chemical endonucleases are comprised in the term "endonuclease" according to the present invention.
  • Rare-cutting endonucleases can also be for example TALENs, a new class of chimeric nucleases using a Fokl catalytic domain and a DNA binding domain derived from Transcription Activator Like Effector (TALE), a family of proteins used in the infection process by plant pathogens of the Xanthomonas genus (Boch, Scholze et al. 2009; Boch, Scholze et al. 2009; Moscou and Bogdanove 2009; Moscou and Bogdanove 2009; Christian, Cermak et al. 2010; Christian, Cermak et al. 2010; Li, Huang et al. 2010; Li, Huang et al. 2011).
  • TALE Transcription Activator Like Effector
  • TALEN Fokl-based TALE-nuclease
  • TALENs novel "compact TALENs”
  • cTALENs do not require dimerization for DNA processing activity, thereby alleviating the need for "dual" target sites with intervening DNA “spacers”; these compact TALENs can be seen as one subclass of rare-cutting endonucleases or chimeric rare-cutting endonucleases according to the present invention.
  • Rare-cutting endonuclease can be a homing endonuclease, also known under the name of meganuclease. Such homing endonucleases are well-known to the art (Stoddard 2005). Homing endonucleases recognize a DNA target sequence and generate a single- or double-strand break. Homing endonucleases are highly specific, recognizing DNA target sites ranging from 12 to 45 base pairs (bp) in length, usually ranging from 14 to 40 bp in length.
  • HEs Homing Endonucleases
  • proteins families Cholier and Stoddard 2001.
  • homing the endonuclease cleaves a cognate allele from which the mobile element is absent, thereby stimulating a homologous recombination event that duplicates the mobile DNA into the recipient locus.
  • LAGLIDADG peptide is the only conserved region among members of the family, these proteins share a very similar architecture.
  • the catalytic core is flanked by two DNA- binding domains with a perfect two-fold symmetry for homodimers such as l-Crel (Chevalier, Monnat et al. 2001), l-Msol (Chevalier, Turmel et al. 2003) and l-Ceul (Spiegel, Chevalier et al. 2006) and with a pseudo symmetry for monomers such as l-Scel (Moure, Gimble et al. 2003), l-Dmol (Silva, Dalgaard et al.
  • residues 28 to 40 and 44 to 77 of l-Crel were shown to form two partially separable functional subdomains, able to bind distinct parts of a homing endonuclease target half- site (Smith, Grizot et al. 2006); International PCT Applications WO 2007/049095 and WO 2007/057781 (Cellectis)).
  • the combination of the two former steps allows a larger combinatorial approach, involving four different subdomains.
  • the different subdomains can be modified separately and combined to obtain an entirely redesigned meganuclease variant (heterodimer or single-chain molecule) with chosen specificity.
  • couples of novel meganucleases are combined in new molecules ("half-meganucleases") cleaving palindromic targets derived from the target one wants to cleave. Then, the combination of such "half-meganucleases" can result in a heterodimeric species cleaving the target of interest.
  • Examples of such endonuclease include l-Sce I, l-Chu I, l-Cre I, l-Csm I, Pl-Sce I, Pl-Tli I, Pl-Mtu I, l-Ceu I, l-Sce II, l-Sce III, HO, Pl-Civ I, Pl-Ctr I, Pl-Aae I, Pl-Bsu I, Pl-Dha I, Pl-Dra I, Pl-Mav I, Pl-Mch I, Pl-Mfu I, Pl-Mfl I, Pl-Mga I, Pl-Mgo I, Pl-Min I, Pl-Mka I, Pl-Mle I, Pl-Mma I, Pl-Msh I, Pl-Msm I, Pl-Mth I, Pl-Mtu I, Pl-Mxe I, Pl-Npu I, Pl-Pfu I, Pl-Rma I, Pl-Spb I, Pl-Ss
  • a homing endonuclease can be a LAGLIDADG endonuclease such as ⁇ -Scel, ⁇ -Crel, ⁇ -Ceul, I- Msol, and ⁇ -Dmol.
  • Said LAGLIDADG endonuclease can be l-Sce I, a member of the family that contains two LAGLIDADG motifs and functions as a monomer, its molecular mass being approximately twice the mass of other family members like l-Crel which contains only one LAGLIDADG motif and functions as homodimers.
  • the variant endonuclease according to the invention cleaves a target sequence that is different from the target sequence of the corresponding wild-type endonuclease. Methods for obtaining such variant endonucleases with novel specificities are well-known in the art.
  • Endonucleases variants may be homodimers (meganuclease comprising two identical monomers) or heterodimers (meganuclease comprising two non-identical monomers). It is understood that the scope of the present invention also encompasses endonuclease variants per se, including heterodimers (WO2006097854), obligate heterodimers (WO2008093249) and single chain meganucleases (WO03078619 and WO2009095793) as non limiting examples, able to cleave one target of interest in a polynucleotidic sequence or in a genome. The invention also encompasses hybrid variant per se composed of two monomers from different origins (WO03078619).
  • Endonucleases with novel specificities can be used in the method according to the present invention for gene targeting and thereby integrating a transgene of interest into a genome at a predetermined location.
  • delivery vector or “ delivery vectors” is intended any delivery vector which can be used in the present invention to put into cell contact ( i.e “contacting") or deliver inside cells or subcellular compartments agents/chemicals and molecules (proteins or nucleic acids) needed in the present invention. It includes, but is not limited to liposomal delivery vectors, viral delivery vectors, drug delivery vectors, chemical carriers, polymeric carriers, lipoplexes, polyplexes, dendrimers, microbubbles (ultrasound contrast agents), nanoparticles, emulsions or other appropriate transfer vectors. These delivery vectors allow delivery of molecules, chemicals, macromolecules (genes, proteins), or other vectors such as plasmids, peptides developed by Diatos. In these cases, delivery vectors are molecule carriers. By “delivery vector” or “delivery vectors” is also intended delivery methods to perform transfection.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a “vector” in the present invention includes, but is not limited to, a viral vector, a plasmid, a RNA vector or a linear or circular DNA or RNA molecule which may consists of a chromosomal, non chromosomal, semi-synthetic or synthetic nucleic acids.
  • Preferred vectors are those capable of autonomous replication (episomal vector) and/or expression of nucleic acids to which they are linked (expression vectors). Large numbers of suitable vectors are known to those of skill in the art and commercially available.
  • Viral vectors include retrovirus, adenovirus, parvovirus (e. g. adenoassociated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e. g., influenza virus), rhabdovirus (e. g., rabies and vesicular stomatitis virus), paramyxovirus (e. g. measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e. g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.
  • orthomyxovirus e. g., influenza virus
  • rhabdovirus e. g., rabies and vesicular stomatitis virus
  • paramyxovirus e. g. measles and Sendai
  • viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
  • retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields, et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • lentiviral vector HIV-Based lentiviral vectors that are very promising for gene delivery because of their relatively large packaging capacity, reduced immunogenicity and their ability to stably transduce with high efficiency a large range of different cell types.
  • Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope and transfer) or more plasmids into producer cells.
  • lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface.
  • the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex.
  • the product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration in the DNA of infected cells.
  • integrated lentiviral vectors or LV
  • integrated lentiviral vectors or LV
  • non integrative lentiviral vectors or NILV is meant efficient gene delivery vectors that do not integrate the genome of a target cell through the action of the virus integrase.
  • One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
  • Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked.
  • Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors.
  • a vector according to the present invention comprises, but is not limited to, a YAC (yeast artificial chromosome), a BAC (bacterial artificial), a baculovirus vector, a phage, a phagemid, a cosmid, a viral vector, a plasmid, a RNA vector or a linear or circular DNA or RNA molecule which may consist of chromosomal, non chromosomal, semi-synthetic or synthetic DNA.
  • expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids" which refer generally to circular double stranded DNA loops which, in their vector form are not bound to the chromosome.
  • Vectors can comprise selectable markers, for example: neomycin phosphotransferase, histidinol dehydrogenase, dihydrofolate reductase, hygromycin phosphotransferase, herpes simplex virus thymidine kinase, adenosine deaminase, glutamine synthetase, and hypoxanthine-guanine phosphoribosyl transferase for eukaryotic cell culture; TRP1 for S. cerevisiae; tetracyclin, rifampicin or ampicillin resistance in E. coli.
  • selectable markers for example: neomycin phosphotransferase, histidinol dehydrogenase, dihydrofolate reductase, hygromycin phosphotransferase, herpes simplex virus thymidine kinase, adenosine deaminase, glut
  • said vectors are expression vectors, wherein a sequence encoding a polypeptide of interest is placed under control of appropriate transcriptional and translational control elements to permit production or synthesis of said polypeptide. Therefore, said polynucleotide is comprised in an expression cassette. More particularly, the vector comprises a replication origin, a promoter operatively linked to said encoding polynucleotide, a ribosome binding site, a RNA-splicing site (when genomic DNA is used), a polyadenylation site and a transcription termination site. It also can comprise an enhancer or silencer elements. Selection of the promoter will depend upon the cell in which the polypeptide is expressed. Suitable promoters include tissue specific and/or inducible promoters.
  • inducible promoters are: eukaryotic metallothionine promoter which is induced by increased levels of heavy metals, prokaryotic lacZ promoter which is induced in response to isopropyl- -D-thiogalacto-pyranoside (IPTG) and eukaryotic heat shock promoter which is induced by increased temperature.
  • tissue specific promoters are skeletal muscle creatine kinase, prostate-specific antigen (PSA), a-antitrypsin protease, human surfactant (SP) A and B proteins, ⁇ - casein and acidic whey protein genes.
  • Inducible promoters may be induced by pathogens or stress, more preferably by stress like cold, heat, UV light, or high ionic concentrations (reviewed in Potenza C et al. 2004, In vitro Cell Dev Biol 40:1-22). Inducible promoter may be induced by chemicals (reviewed in (Moore, Samalova et al. 2006); (Padidam 2003); (Wang, Zhou et al. 2003); (Zuo and Chua 2000).
  • Delivery vectors and vectors can be associated or combined with any cellular permeabilization techniques such as sonoporation or electroporation or derivatives of these techniques.
  • cell or cells any prokaryotic or eukaryotic living cells, cell lines derived from these organisms for in vitro cultures, primary cells from animal or plant origin.
  • primary cell or “primary cells” are intended cells taken directly from living tissue (i.e. biopsy material) and established for growth in vitro, that have undergone very few population doublings and are therefore more representative of the main functional components and characteristics of tissues from which they are derived from, in comparison to continuous tumorigenic or artificially immortalized cell lines. These cells thus represent a more valuable model to the in vivo state they refer to.
  • fungus refers to a fungal, plant or animal cell or a cell line derived from the organisms listed below and established for in vitro culture. More preferably, the fungus is of the genus Aspergillus, Penicillium, Acremonium, Trichoderma, Chrysoporium, Mortierella, Kluyveromyces or Pichia; More preferably, the fungus is of the species Aspergillus niger, Aspergillus nidulans, Aspergillus oryzae, Aspergillus terreus, Penicillium chrysogenum, Penicillium citrinum, Acremonium Chrysogenum, Trichoderma reesei, Mortierella alpine, Chrysosporium lucknowense, Kluyveromyces lactis, Pichia pastoris or Pichia ciferrii.
  • the plant is of the genus Arabidospis, Nicotiana, Solanum, lactuca, Brassica, Oryza, Asparagus, Pisum, Medicago, Zea, Hordeum, Secale, Triticum, Capsicum, Cucumis, Cucurbita, Citrullis, Citrus, Sorghum; More preferably, the plant is of the species Arabidospis thaliana, Nicotiana tabaccum, Solanum lycopersicum, Solanum tuberosum, Solanum melongena, Solanum esculentum, Lactuca saliva, Brassica napus, Brassica oleracea, Brassica rapa, Oryza glaberrima, Oryza sativa, Asparagus officinalis, Pisum sativum, Medicago sativa, zea mays, Hordeum vulgare, Secale cereal, Triticum aestivum, Triticum durum, Capsicum sativus, Cu
  • the animal cell is of the genus Homo, Rattus, Mus, Sus, Bos, Danio, Canis, Felis, Equus, Salmo, Oncorhynchus, Gallus, Meleagris, Drosophila, Caenorhabditis; more preferably, the animal cell is of the species Homo sapiens, Rattus norvegicus, Mus musculus, Sus scrofa, Bos taurus, Danio rerio, Canis lupus, Felis catus, Equus caballus, Salmo salar, Oncorhynchus mykiss, Gallus gallus, Meleagris gallopavo, Drosophila melanogaster, Caenorhabditis elegans.
  • the cell can be a plant cell, a mammalian cell, a fish cell, an insect cell or cell lines derived from these organisms for in vitro cultures or primary cells taken directly from living tissue and established for in vitro culture.
  • cell can be protoplasts obtained from plant organisms listed above.
  • cell lines can be selected from the group consisting of CHO-K1 cells; HEK293 cells; Caco2 cells; U2-OS cells; NIH 3T3 cells; NSO cells; SP2 cells; CHO-S cells; DG44 cells; K-562 cells, U-937 cells; MRC5 cells; IMR90 cells; Jurkat cells; HepG2 cells; HeLa cells; HT-1080 cells; HCT-116 cells; Hu-h7 cells; Huvec cells; Molt 4 cells.
  • homologous is intended a sequence with enough identity to another one to lead to homologous recombination between sequences, more particularly having at least 95 % identity, preferably 97 % identity and more preferably 99 %.
  • identity refers to sequence identity between two nucleic acid molecules or polypeptides. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base, then the molecules are identical at that position. A degree of similarity or identity between nucleic acid or amino acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences.
  • Various alignment algorithms and/or programs may be used to calculate the identity between two sequences, including FASTA, or BLAST which are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default setting.
  • mutant is intended the substitution, deletion, insertion of one or more nucleotides/amino acids in a polynucleotide (cDNA, gene) or a polypeptide sequence.
  • Said mutation can affect the coding sequence of a gene or its regulatory sequence. It may also affect the structure of the genomic sequence or the structure/stability of the encoded mRNA.
  • double-strand break-induced mutagenesis refers to a mutagenesis event consecutive to an NHEJ event following an endonuclease-induced DSB, leading to insertion/deletion at the cleavage site of an endonuclease.
  • gene is meant the basic unit of heredity, consisting of a segment of DNA arranged in a linear manner along a chromosome, which codes for a specific protein or segment of protein.
  • a gene typically includes a promoter, a 5' untranslated region, one or more coding sequences (exons), optionally introns, a 3' untranslated region.
  • the gene may further comprise a terminator, enhancers and/or silencers.
  • transgene refers to a sequence encoding a polypeptide.
  • the polypeptide encoded by the transgene is either not expressed, or expressed but not biologically active, in the cell, tissue or individual in which the transgene is inserted.
  • the transgene encodes a therapeutic polypeptide useful for the treatment of an individual.
  • gene of interest refers to any nucleotide sequence encoding a known or putative gene product.
  • locus is the specific physical location of a DNA sequence (e.g. of a gene) on a chromosome.
  • locus usually refers to the specific physical location of an endonuclease's target sequence on a chromosome.
  • locus which comprises a target sequence that is recognized and cleaved by an endonuclease according to the invention, is referred to as “locus according to the invention”.
  • locus according to the invention is referred to as “locus according to the invention”.
  • the expression "genomic locus of interest” is used to qualify a nucleic acid sequence in a genome that can be a putative target for a double-strand break according to the invention.
  • genomic locus of interest of the present invention can not only qualify a nucleic acid sequence that exists in the main body of genetic material (i.e. in a chromosome) of a cell but also a portion of genetic material that can exist independently to said main body of genetic material such as plasmids, episomes, virus, transposons or in organelles such as mitochondria or chloroplasts as non-limiting examples.
  • loss of genetic information is understood the elimination or addition of at least one given DNA fragment (at least one nucleotide) or sequence, bordering the recognition sites of the endonucleases, chimeric rare-cutting endonucleases, compact TALEN or enhanced compact TALEN of the present invention or the intervening sequence between at least two processing sites of the endonucleases, chimeric rare-cutting endonucleases, compact TALEN or enhanced compact TALEN of the present invention and leading to a change of the original sequence around said endonuclease-cutting sites, chimeric rare-cutting endonuclease-cutting sites, compact TALEN or enhanced compact TALEN recognition DNA binding site within the genomic locus of interest.
  • This loss of genetic information can be, as a non-limiting example, the elimination of an intervening sequence between two endonuclease-cutting sitesor between two processing sites of a compact TALEN or enhanced compact TALEN.
  • this loss of genetic information can also be an excision of a single-strand of DNA spanning the binding region of a compact TALEN or an enhanced compact TALEN according to the present invention
  • scarless re-ligation or “scarless religation” is intended the perfect re-ligation event, without loss of genetic information (no insertion/deletion events) of the DNA broken ends through NHEJ process after the creation of a double-strand break event.
  • Imprecise NHEJ is intended the re-ligation of nucleic acid ends generated by a DSB, with insertions or deletions of nucleotides. Imprecise NHEJ is an outcome and not a repair pathway and can result from different NHEJ pathways (Ku dependent or Ku independent as non-limiting examples).
  • fusion protein is intended the result of a well-known process in the art consisting in the joining of two or more genes which originally encode for separate proteins or part of them, the translation of said "fusion gene” resulting in a single polypeptide with functional properties derived from each of the original proteins.
  • a "chimeric rare-cutting endonuclease" according to the present invention which comprises more than two catalytic domains can be described as “multifunctional” or as “multi-functional meganuclease”.
  • chimeric rare-cutting endonucleases according to the present invention can be a fusion protein between a rare-cutting endonuclease and one catalytic domain; chimeric rare-cutting endonucleases according to the present invention can also be a fusion protein between a rare-cutting endonuclease and two catalytic domains.
  • the rare-cutting endonuclease part of chimeric rare- cutting endonucleases according to the present invention can be a meganuclease comprising two identical monomers, two non-identical monomers, or a single chain meganuclease.
  • the rare-cutting endonuclease part of chimeric rare-cutting endonucleases according to the present invention can also be the DNA-binding domain of an inactive rare-cutting endonuclease.
  • chimeric rare-cutting endonucleases according to the present invention can be derived from a TALE-nuclease (TALEN), i. e.
  • a subclass of chimeric rare-cutting endonucleases according to the present invention can be a "compact TALE-nuclease" (cTALEN), i. e. a fusion between an engineered core TALE scaffold comprising at least a Repeat Variable Dipeptide regions domain and at least one catalytic domain, said fusion protein constituting a compact TALEN active entity that does not require dimerization for DNA processing activity.
  • cTALEN compact TALE-nuclease
  • Said catalytic domain can be an endonuclease as listed in table 2 as non- limiting examples; said catalytic domain can be a frequent-cutting endonuclease such as a restriction enzyme selected from the group consisting of Mmel, R-HinPII, R.Mspl, R.Mval, Nb.BsrDI, BsrDI A, Nt.BspD6l, ss.BspD6l, R.PIel, Mlyl and Alwl as non-limiting restriction enzymes examples listed in table 2.
  • a restriction enzyme selected from the group consisting of Mmel, R-HinPII, R.Mspl, R.Mval, Nb.BsrDI, BsrDI A, Nt.BspD6l, ss.BspD6l, R.PIel, Mlyl and Alwl as non-limiting restriction enzymes examples listed in table 2.
  • enhancer domain(s) or “enhancer(s)” are meant protein domains that provide functional and/or structural support to a protein scaffold, a compact TALEN as a non-limiting example, therefore allowing an enhancement in global DNA processing efficiency of the resulting fusion protein, i.e an enhanced compact TALEN, relative to the DNA processing efficiency of the starting compact TALEN.
  • a particular domain is an enhancer domain when it provides at least a 5% enhancement in efficiency of the starting scaffold, more preferably 10 %, again more preferably 15 %, again more preferably 20 %, again more preferably 25 %, again more preferably 50%, again more preferably greater than 50%.
  • Non-limiting examples of such enhancer domains are given in Tables 1 and 2.
  • catalytic domain is intended the protein domain or module of an enzyme containing the active site of said enzyme; by active site is intended the part of said enzyme at which catalysis of the substrate occurs.
  • Enzymes, but also their catalytic domains are classified and named according to the reaction they catalyze.
  • the Enzyme Commission number (EC number) is a numerical classification scheme for enzymes, based on the chemical reactions they catalyze (http://www.chem.qmul.ac.uk/iubmb/enzyme/).
  • any catalytic domain can be fused to an engineered core TALE scaffold to generate a compact TALEN active entity with a DNA processing efficiency provided by at least said catalytic domain activity.
  • Said catalytic domain can provide a nuclease activity (endonuclease or exonuclease activities, cleavase or nickase), a polymerase activity, a kinase activity, a phosphatase activity, a methylase activity, a topoisomerase activity, an integrase activity, a transposase activity or a ligase activity as non-limiting examples.
  • Non-limiting examples of such catalytic domains are given in Tables 1 and 2.
  • said catalytic domain can be considered as an enhancer domain.
  • said enhancer domain can provide functional and/or structural support to the compact TALEN scaffold leading to an enhanced compact TALEN when fused to it. If catalytically inactive, said enhancer domain provides structural support to compact TALEN scaffold leading to an enhanced compact TALEN when fused to it. It can be envisioned from the present invention to fuse catalytic domains according to the present invention to one part of a classical TALEN in order to give these classical TALENs new catalytical properties provided by at least said catalytic domain activity or to improve their DNA processing efficiency.
  • nuclease catalytic domain is intended the protein domain comprising the active site of an endonuclease or an exonuclease enzyme.
  • Such nuclease catalytic domain can be, for instance, a “cleavase domain” or a “nickase domain”.
  • cleavase domain is intended a protein domain whose catalytic activity generates a Double Strand Break (DSB) in a DNA target.
  • nickase domain is intended a protein domain whose catalytic activity generates a single strand break in a DNA target sequence.
  • Non-limiting examples of such catalytic domains are given in Tables 1 and 2 with a GenBank or NCBI or UniProtKB/Swiss-Prot number as a reference.
  • TALE-nuclease TALEN
  • classical TALEN a fusion protein consisting of a DNA-binding domain derived from a Transcription Activator Like Effector (TALE) and one Fokl catalytic domain, that need to dimerize to form an active entity able to cleave a DNA target sequence.
  • compact TALE-nuclease is intended a general designation according to the present invention for a fusion protein between an engineered core TALE scaffold comprising at least one Repeat Variable Dipeptides domain and at least one catalytic domain, said fusion protein constituting a compact TALEN (or cTALEN) active entity and not requiring dimerization for DNA processing activity.
  • Compact TALENs are designed to alleviate the need for multiple independent protein moieties when targeting a DNA cleavage event. Importantly, the requisite "spacer" region and dual target sites essential for the function of current TALENs are unnecessary.
  • the compact TALEN according to the present invention is an active entity unit able, by itself, to target only one specific single double-stranded DNA target sequence of interest through one DNA binding domain and to process DNA nearby said single double-stranded DNA target sequence of interest.
  • the catalytic domain does not require specific DNA contact, there are no restrictions on regions surrounding the core TALE DNA binding domain. In the scope of the present invention, it can be also envisioned some sequence preference in the catalytic domain.
  • cTALEN can be qualified as a "basic cTALEN" or "cTALEN".
  • cTALEN When a cTALEN further comprises at least one "enhancer domain”, cTALEN can be qualified as an enhanced cTALEN or an "eTALEN".
  • a cTALEN or an eTALEN that comprise at least one cleavase catalytic domain and one nickase catalytic domain or at least two cleavase catalytic domains can be specifically qualified as a dual-cleavage cTALEN or a "dcTALEN”.
  • a cTALEN or an eTALEN acting with an auxiliary domain in trans is qualified as a trans compact TALEN or a trans enhanced compact TALEN, both being "trans TALEN”.
  • the wild-type l-Crel meganuclease (SEQ ID NO: 106) was chosen as the parent scaffold on which to fuse the catalytic domain of l-Tevl (SEQ ID NO: 107). Wild-type l-Tevl functions as a monomeric cleavase of the GIY-YIG family to generate a staggered double-strand break in its target DNA . Guided by biochemical and structural data, variable length constructs were designed from the N- terminal region of l-Tevl that encompass the entire catalytic domain and deletion-intolerant region of its linker (SEQ ID NO: 109 to SEQ ID NO: 114).
  • fragments were fused to the N- terminus of l-Crel with an intervening 5-residue polypeptide linker (-QGPSG-; SEQ ID NO: 103).
  • the linker-less fusion construct naturally contained residues (-LGPDGRKA-; SEQ ID NO: 104) similar to those in the artificial linker.
  • D20N point mutants were made to inactivate the l-Crel scaffold [SEQ ID NO: 108, SEQ ID NO: 115 to SEQ ID NO: 120; Chevalier, Sussman et al. 2004)].
  • Tests in our yeast assays showed no visible activity from the inactivated l-Crel (D20N) mutant protein alone (Table 4). However, cleavage activity could be observed for fusions having the l-Tevl catalytic domain (Table 4).
  • Table 4 Activity in Yeast assay for l-Tevl/l-Crel fusions. The relative activity of wild-type and fusion proteins on the two parent protein targets (C1221 for l-Crel and Tev for l-Tevl) is shown. Maximal activity (++++) is seen with each given protein on its native DNA target.
  • l-Crel_N20 is an inactive variant of the wild-type l-Crel scaffold. In all other cases, activity is only detected on the C1221 target since DNA recognition is driven by the l-Crel scaffold.
  • the "N20" fusion variants illustrate cleavage activity due to the l-Tevl catalytic domain.
  • the polypeptide spanning residues 2 to 153 of l-Crel was used, with a K82A mutation to allow for linker placement.
  • the C-terminal fusion scaffold contains residues 2 to 155 of wild-type l-Crel.
  • the "free" end of the linker i.e. onto which a polypeptide can be linked
  • PDB id lg9z
  • Table 5 Activity in Yeast assay for ColE7/l-Crel fusions. The relative activity of wild-type and fusion proteins on theC1221 target is shown.
  • l-Crel_X represents a truncated version of l-Crel based on the crystal structure and was used as the foundation for the fusion scaffolds (l-Crel_NFSl, l-Crel_NFS2 and l-Crel_CFSl).
  • "N20" constructs are inactive variants of the respective l-Crel-based scaffolds. Activity is detected in all cases wherein the l-Crel scaffold is active or when DNA catalysis is provided by the ColE7 domain.
  • Relative activity is scaled as: -, no activity detectable; +, ⁇ 25 activity; ++, 25% to ⁇ 50% activity; +++, 50% to ⁇ 75% activity; ++++, 75% to 100% activity.
  • This ColE7 domain was fused to the N-terminus of either l-Crel_NFSl (SEQ ID NO: 122) or l-Crel_NFS2 (SEQ ID NO: 123) to create hColE7Cre_D0101 (SEQ ID NO: 128) or hColE7Cre_D0102 (SEQ ID NO: 129), respectively.
  • a C-terminal fusion construct, hCreColE7_D0101 (SEQ ID NO: 130) was generated using l-Crel_CFSl (SEQ ID NO: 124).
  • D20N point mutants were made to inactivate the l-Crel scaffold (SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133; (Chevalier, Sussman et al. 2004)).
  • Tests in our yeast assays showed no visible activity from the inactivated l-Crel (D20N) mutant proteins alone (Table 5). However, cleavage activity could be observed for fusions having the ColE7 catalytic domain (Table 5).
  • Two core TALE scaffolds are generated onto which (a) different sets of RVD domains could be inserted to change DNA binding specificity, and; (b) a selection of catalytic domains could be attached, N- or C-terminal, to effect DNA cleavage (or nicking).
  • the core scaffolds (sTl: SEQ ID NO: 134 and sT2: SEQ ID NO: 135) differ in the N- and C-terminal regions, where sT2 is a truncated variant lacking 152 amino acid residues from the N-terminus (Szurek, Rossier et al. 2002) and the last 220 residues from the C-terminus compared to sTl.
  • the C-terminal region is a truncation with respect to wild-type TALE domains, ending at a fortuitously defined restriction site (BamHI) in the DNA coding sequence.
  • Example protein sequences of the baseline scaffolds are listed in SEQ ID NO: 136 to SEQ ID NO: 139. As is, these scaffolds can be tested in vitro for DNA binding ability on targets having only a single recognition sequence.
  • the catalytic domain of the Fokl nuclease (SEQ ID NO: 368 and particularly residues P381 to F583 as non-limiting example) can be fused to either the N- or C- terminus of the baseline scaffolds. Effective cleavage using these controls requires target site DNAs that contain two TALE binding sequences.
  • RVD constructs recognizing relevant sequences were generated (Figure 3): RagT2-R, NptllT5-L, NptllT5-R, NptllT6-L, NptllT6-R.
  • Example protein sequences of the insert RVDs are listed in SEQ ID NO: 253 to SEQ ID NO: 257.
  • Artificial RVD sequences are used as noted above within the sTl or sT2 scaffold to generate the desired targeted compact TALENs.
  • cTALENs Basic compact TALENs
  • Figure 5, A or B Basic compact TALENs
  • Table 5 A non-exhaustive list of catalytic domains amenable to fusion with TALE DNA binding domains is presented in Table 2.
  • Table 3 A non- exhaustive list of linkers that can be used is presented in Table 3. It is notable that linker design can depend on the nature of the catalytic domain attached and its given application. It can also be anticipated that specially engineered linkers can be constructed to better control or regulate the activity of either or both domains. Examples 5, 6 and 7 below discuss additional and alternative methods in which linkers can be defined. All cTALEN designs are assessed using our yeast assay (see Example 1) and provide detectable activity comparable to existing engineered meganucleases.
  • Example 3a TALE::Tevl compact TALEN
  • the catalytic domain of l-Tevl (SEQ ID NO: 20), a member of the GIY-YIG endonuclease family, was fused to a TALE-derived scaffold (composed of a N-terminal domain, a central core composed of RVDs and a C-terminal domain) to create a new class of cTALEN (TALE::Tevl).
  • TALE cTALEN
  • a core TALE scaffold, sT2 (SEQ ID NO: 135), was selected onto which (a) different sets of RVD domains could be inserted to change DNA binding specificity, and; (b) a selection of l-Tevl-derived catalytic domains could be attached, N- or C-terminal, to effect DNA cleavage (or nicking).
  • the previously mentioned sT2 truncated scaffold was generated by the PCR from a full-length core TALEN scaffold template (pCLS7183, SEQ ID NO: 141) using primers CMP_G061 (SEQ ID NO: 142) and CMP_G065 (SEQ ID NO: 143) and was cloned into vector pCLS7865 (SEQ ID NO: 144) to generate pCLS7865-cTALll_CFSl (pCLS9009, SEQ ID NO: 145), where CFS1 designates the amino acid sequence -GSSG- (with underlying restriction sites BamHI and Kpn2l in the coding DNA to facilitate cloning).
  • TevCreDOl [SEQ ID NO: 109 protein in plasmid pCLS6614 (SEQ ID NO: 146)] using the primer pair C P_G069 (SEQ ID NO: 147) and CMP_G070 (SEQ ID NO: 148), TevCreD02 [SEQ ID NO: 110 protein in plasmid pCLS6615 (SEQ ID NO: 203)] using the primer pair CMP_G069 (SEQ ID NO: 147) and CMP_G071 (SEQ ID NO: 149) or TevCreD05 [SEQ ID NO: 113 protein in plasmid pCLS6618 (SEQ ID NO: 258)] using the primer pair CMP_G069 (SEQ ID NO: 147) and CMP_G115 (SEQ ID NO:
  • All fusions contain the dipeptide -GS- linking the TALE-derived DNA binding domain and l-Tevl-derived catalytic domain.
  • the DNA sequence coding for the VDs to target the AvrBs3 site was subcloned into both plasmids pCLS9010 (SEQ ID NO: 150, encoding the protein of SEQ ID NO: 420), pCLS9011 (SEQ ID NO: 151, encoding the protein of SEQ ID NO: 421) and pCLS15775 (SEQ ID NO: 260, encoding the protein of SEQ ID NO: 422) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequence to create the subsequent TALE- AvrBs3::Tevl constructs cTl 1 Avr TevDOl (pCLS9012, SEQ ID NO: 218, encoding the protein of SEQ ID NO: 423), cTHAvr_TevD02 (pCLS9013, SEQ ID NO: 153, encoding the protein of
  • TALE-AvrBs3::Tevl yeast expression plasmids pCLS8523 (SEQ ID NO: 154), pCLS8524 (SEQ ID NO: 155) and pCLS12092 (SEQ ID NO: 262), were prepared by yeast in vivo cloning using plasmids pCLS9012, pCLS9013 and pCLS15776, respectively.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • TALE-AvrBs3::Tevl constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 6).
  • TALE-AvrBs3::Tevl activity levels on their respective targets in yeast cells are shown on figure 9. Data summarized in figure 9 show that TALE-AvrBs3: :Tevl is active against several targets in Yeast.
  • DNA encoding the TALE-AvrBs3::Tevl construct from either pCLS9012 (SEQ ID NO: 218) or pCLS9013 (SEQ ID NO: 153) was subcloned into the pCLS1853 (SEQ ID NO: 193) mammalian expression plasmid using Ascl and Xhol restriction enzymes for the receiving plasmid and BssHII and Xhol restriction enzymes for the TALE-AvrBs3::Tevl insert, leading to the mammalian expression plasmids pCLS8993 and pCLS8994 (SEQ ID NO: 194 and 195), respectively.
  • All mammalian target reporter plasmids containing the TALEN DNA target sequences were constructed using the standard Gateway protocol (INVITROGEN) into a CHO reporter vector (Arnould, Chames et al. 2006, Grizot, Epinat et al. 2010).
  • the TALE-AvrBs3::Tevl constructs were tested in an extrachromosomal assay in mammalian cells (CHO Kl) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN, which requires two binding sites for activity.
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 6).
  • CHO Kl cells were transfected in a 96-well plate format with 75 ng of target vector and an increasing quantity of each variant DNA from 0.7 to 25 ng , in the presence of PolyFect reagent ( ⁇ per well). The total amount of transfected DNA was completed to 125 ng (target DNA, variant DNA, carrier DNA) using an empty vector. Seventy-two hours after transfection, culture medium was removed and 150 ⁇ of lysis/revelation buffer for ⁇ -galactosidase liquid assay was added. After incubation at 37°C, optical density was measured at 420 nm. The entire process is performed on an automated Velocityll BioCel platform (Grizot, Epinat et al. 2009).
  • TALE-AvrBs3::Tevl constructs (12.5 ng DNA transfected) on the Avrl5 target (SEQ ID NO: 167) are shown in figure 10.
  • TALE-AvrBs3: :Tevl appears to be efficient to cleave the target sequence.
  • TALE::Tevl fusions each containing one TALE- based DNA binding domain and one l-Tevl-based catalytic domain, working to generate detectable activity.
  • the assays used measure tandem repeat recombination by single-strand annealing, a process that is triggered essentially by a DSB (Sugawara and Haber 1992; Paques and Duchateau 2007).
  • TALE::Tevl fusions can have a nickase activity insufficient to alone trigger a signal in the cell- based assay.
  • each TALE::Tevl is a cTALEN able to generate a nick.
  • TALE-AvrBs3::Tevl constructs cTHAvr_TevD01 and cTHAvr_TevD02 are cloned into a T7-based expression vector using Ncol/Eagl restriction sites to yield plasmids pCLS9021 (SEQ ID NO: 201) and pCLS9022 (SEQ ID NO: 202), respectively.
  • This cloning step results in TALE- AvrBs3::Tevl proteins having an additional hexa-His tag for purification.
  • Plasmids pCLS9021 and pCLS9022 are then used to produce active proteins by one of two methods:
  • Plasmids are used in a standard in vitro transcription/translation system; lysates from the translation are used directly without further purification.
  • Plasmids are used to transform E.coli BL21(DE3) cells for expression using standard protocols, namely: growth to log phase, induction with IPTG, harvest, cell lysis and purification via affinity methods for His-tagged proteins.
  • Active proteins are assayed against DNA targets having either none, one or two AvrBs3 recognition site sequences. When more than one site is present, identical recognition sequences are juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps.
  • a linear DNA nicking and/or cleavage assay is also performed.
  • PCR products containing the target sequences described above are prepared by standard methods and column purified to yield linear substrate of >98% purity.
  • Increasing amounts of TALE-AvrBs3::Tevl proteins are then incubated with each PC substrate under conditions to promote DNA cleavage for lh at 37°C. Reaction products are separated on a denaturing acrylamide gel and the single-strand DNA visualized.
  • Variants differing by truncations of the C-terminal domain of the AvrBs3-derived TALEN are chosen as starting scaffolds.
  • a subset of these variants includes truncation after positions E886 (CO), P897 (Cll), G914 (C28), L926 (C40), D950 (C64), R1000 (C115), D1059 (C172) (the protein domains of truncated C-terminal domains Cll to C172 are respectively given in SEQ ID NO: 204 to 209) and P1117 [also referred as Cter wt or WT Cter (SEQ ID NO: 210) lacking the activation domain of the C-terminal domain of natural AvrBs3 (SEQ ID NO: 220)].
  • the plasmids coding for the variant scaffolds containing the AvrBs3-derived N-terminal domain, the AvrBs3-derived set of repeat domains and the truncated AvrBs3-derived C-terminal domain [pCLS7821, pCLS7803, pCLS7807, pCLS7809, pCLS7811, pCLS7813, pCLS7817 (SEQ ID NO: 211 to 217) which are based on the pCLS7184 (SEQ ID NO: 196)] allow cloning of any catalytic domain in fusion to the C-terminal domain, using the restriction sites BamHI and Eagl.
  • Variants of the catalytic domain of l-Tevl are designed from the N-terminal region of l-Tevl.
  • a subset of these variants includes truncations of the catalytic domain, as the deletion-intolerant region of its linker, the deletion-tolerant region of its linker and its zinc finger (SEQ ID NO: 197 to 200) named in Liu et al, 2008 (Liu, Dansereau et al. 2008).
  • the DNA corresponding to these variants of l-Tevl is amplified by the PCR to introduce, at the DNA level, a BamHI (at the 5' of the coding strand) and a Eagl (at the 3' of the coding strand) restriction site and, at the protein level, a linker (for example -SGGSGS- stretch, SEQ ID NO: 219) between the C terminal domain of the TALE and the variant of the catalytic domain of l-Tevl.
  • the final TALE::Tevl constructs are generated by insertion of the variant of l-Tevl catalytic domains into the scaffold variants using BamHI and Eagl and standard molecular biology procedures.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • TALE-AvrBs3::Tevl constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 6).
  • the sT2 (SEQ ID NO: 135) core TALE scaffold described in example 3a was selected to generate pCLS7865-cTALll_NFSl (pCLS9008, SEQ ID NO: 234), where NFS1 designates the amino acid sequence -GSSG- (with underlying restriction sites BamHI and Kpn2l in the coding DNA to facilitate cloning).
  • TevCreDOl [SEQ ID NO: 109 protein in plasmid pCLS6614 (SEQ ID NO: 146)] using the primer pairs CMP_G001 (SEQ ID NO: 239) and CMP_G067 (SEQ ID NO: 263) or CMP_G152 (SEQ ID NO: 264), TevCreD02 [SEQ ID NO: 110 protein in plasmid pCLS6615 (SEQ ID NO: 203)] using the primer pair CMP_G001 (SEQ ID NO: 239) and CMP_G068 (SEQ ID NO: 240) or TevCreD05 [SEQ ID NO: 113 protein in plasmid pCLS6618 (SEQ ID NO: 258)] using the primer pair CMP_G001 (SEQ ID NO: 239) and CMP_G114 (SEQ ID NO: 265) and subclone
  • TevW01_cTll-based fusion contains the dipeptide -SG- linking the TALE-derived DNA binding domain and l-Tevl-derived catalytic domain
  • all others constructs incorporate a longer pentapeptide -QGPSG- to link the domains.
  • the DNA sequence coding for the RVDs to target the AvrBs3 site was subcloned into plasmids pCLS15777 (SEQ ID NO: 266), pCLS15778 (SEQ ID NO: 267) and pCLS12730 (SEQ ID NO: 235) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequence to create the subsequent Tevl::TALE-AvrBs3 constructs TevW01_cTllAvr (pCLS15780, SEQ ID NO: 269, encoding the protein of SEQ ID NO: 430), TevD01_cTllAvr (pCLS15781, SEQ ID NO: 270, encoding the protein of SEQ ID NO: 431) and TevD02_cTllAvr (pCLS12731, SEQ ID NO: 236, encoding the protein of SEQ ID NO:
  • Tevl::TALE-based yeast expression plasmids pCLS11979 (SEQ ID NO: 273), pCLS8521 (SEQ ID NO: 274), pCLS8522 (SEQ ID NO: 237) and pCLS12100 (SEQ ID NO: 275), were prepared by yeast in vivo cloning using plasmid pCLS15780 (SEQ ID NO: 269), pCLS15781 (SEQ ID NO: 270), pCLS12731 (SEQ ID NO: 236) and pCLS15782 (SEQ ID NO: 272), respectively.
  • each plasmid linearized by digestion with BssHII and 1 ng of the pCLS0542 (SEQ ID NO: 156) plasmid DNA linearized by digestion with Ncol and Eagl were used to transform, respectively, the yeast S. cerevisiae strain FYC2-6A (MATa, trplA63, ⁇ eu2bl, r)/s3A200) using a high efficiency LiAc transformation protocol (Arnould et al. 2007).
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • Tevl::TALE-AvrBs3 and Tevl::TALE-RagT2-R constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 6).
  • constructs were tested on a target having only a single AvrBs3 or RagT2-R recognition site (SEQ ID NO: 238, Table 8).
  • the Tevl::TALE-AvrBs3 activity level in yeast was comparable to that of TALE-AvrBs3::Tevl (pCLS8524, SEQ ID NO: 155) on suitable targets.
  • Significant activity is illustrated in table 8 for a sample single-site target, according to the cTALEN of the present invention.
  • Table 8 Activity of Tevl::TALE-AvrBs3 and and Tevl::TALE-RagT2-R on dual- and single-site DNA targets. Relative activity is scaled as: n.d., no activity detectable; +, ⁇ 25% activity; ++, 25% to ⁇ 50% activity; +++, 50% to ⁇ 75% activity; ++++, 75% to 100% activity.
  • the DNA sequence coding for the RVDs to target the NptllT5-L and NptllT6-L sites were subcloned into plasmid pCLS12730 (SEQ ID NO: 235) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequences to create the subsequent Tevl::TALE constructs TevD02_cTllNptllT5-L (pCLS15783, SEQ ID NO: 280) and TevD02_cTllNptllT6-L (pCLS15784, SEQ ID NO: 281), respectively.
  • Plasmid pCLS14529 allows for cloning gene of interest sequences downstream of a promoter that confers high levels of constitutive expression in plant cells.
  • a YFP-based single-strand annealing (SSA) assay was employed.
  • the YFP reporter gene has a short duplication of coding sequence that is interrupted by either an NptllT5 or NptllT6 TALEN target site. Cleavage at the target site stimulates recombination between the repeats, resulting in reconstitution of a functional YFP gene.
  • the reporter is introduced along with a construct encoding a Fokl-based TALEN or compact TALEN into tobacco protoplasts by PEG-mediated transformation (as known or derived from the state of the art). Uniform transformation efficiencies were obtained by using the same amount of plasmid in each transformation - i.e.
  • Table 9 Activity of Tevl::TALE-NptllT5-L and Tevl::TALE-NptllT6-L on appropriate DNA targets. Relative activity is scaled to the control constructs as: n.a., not applicable; +, 100% activity of control (2% YFP positive cells).
  • NucA (SEQ ID NO: 26), a nonspecific endonuclease from Anabaena sp., was fused to a TALE-derived scaffold (composed of a N-terminal domain, a central core composed of RVDs and a C-terminal domain) to create a new class of cTALEN (TALE::NucA). To distinguish the orientation (N-terminal vs.
  • the wild-type NucA endonuclease can be inhibited by complex formation with the NuiA protein (SEQ ID NO: 229).
  • the NuiA protein can function as an auxiliary domain to modulate the nuclease activity of TALE::NucA constructs.
  • a core TALE scaffold, sT2 (SEQ ID NO: 135), was selected onto which (a) different sets of RVD domains could be inserted to change DNA binding specificity, and; (b) a selection of NucA-derived catalytic domains could be attached, N- or C-terminal, to effect DNA cleavage (or nicking).
  • the sT2 truncated scaffold was generated by the PCR from a full-length core TALEN scaffold template (pCLS7183, SEQ ID NO: 141) using primers CMP_G061 (SEQ ID NO: 142) and CMP_G065 (SEQ ID NO: 143) and was cloned into vector pCLS7865 (SEQ ID NO: 144) to generate pCLS7865-cTALll_CFSl (pCLS9009, SEQ ID NO: 145), where CFS1 designates the amino acid sequence -GSSG- (with underlying restriction sites BamHI and Kpn2l in the coding DNA to facilitate cloning).
  • the NucA (SEQ ID NO: 26) catalytic domain corresponding to amino acid residues 25 to 274, was subcloned into the pCLS9009 backbone (SEQ ID NO: 145) by restriction and ligation using BamHI and Eagl restriction sites, yielding pCLS7865-cTll_NucA (pCLS9937, SEQ ID NO: 221, encoding the protein of SEQ ID NO: 433).
  • the fusion contains the dipeptide -GS- linking the TALE-derived DNA binding domain and NucA-derived catalytic domain.
  • the cloning step also brings at the amino acid level an AAD sequence at the Cter of the NucA catalytic domain.
  • the DNA sequence coding for the RVDs to target the AvrBs3 site was subcloned into plasmid pCLS9937 (SEQ ID NO: 221) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequence to create the subsequent TALE- AvrBs3::NucA construct cTHAvr_NucA (pCLS9938, SEQ ID NO: 222, encoding the protein of SEQ ID NO: 434).
  • the TALE-AvrBs3::NucA construct was sequenced and the insert transferred to additional vectors as needed (see below).
  • the final TALE-AvrBs3::NucA yeast expression plasmid, pCLS9924 (SEQ ID NO: 223) was prepared by yeast in vivo cloning using plasmid pCLS9938 (SEQ ID NO: 222).
  • plasmid pCLS9938 approximately 40 ng of plasmid (pCLS9938) linearized by digestion with BssHII and 1 ng of the pCLS0542 (SEQ ID NO: 156) plasmid DNA linearized by digestion with Ncol and Eagl were used to transform the yeast S. cerevisiae strain FYC2- 6A (MATa, trpl&63, /eu2Al, /7/si?A200) using a high efficiency LiAc transformation protocol (Arnould et al. 2007).
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE-AvrBs3::NucA construct was tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • Variants differing by truncations of the C-terminal domain of the AvrBs3-derived TALEN are chosen as starting scaffolds.
  • a subset of these variants includes truncation after positions E886 (CO), P897 (Cll), G914 (C28), L926 (C40), D950 (C64), R1000 (C115), D1059 (C172) (the protein domains of truncated C-terminal domains Cll to C172 are respectively given in SEQ ID NO: 204 to 209) and P1117 [also referred as Cter wt or WT Cter (SEQ ID NO: 210) lacking the activation domain of the C-terminal domain of natural AvrBs3 (SEQ ID NO: 220)].
  • the plasmids coding for the variant scaffolds containing the AvrBs3-derived N-terminal domain, the AvrBs3-derived set of repeat domains and the truncated AvrBs3-derived C-terminal domain [pCLS7821, pCLS7803, pCLS7807, pCLS7809, pCLS7811, pCLS7813, pCLS7817 (SEQ ID NO: 211 to 217) which are based on the pCLS7184 (SEQ ID NO: 196)] allow cloning of any catalytic domain in fusion to the C-terminal domain, using the restriction sites BamHI and Eagl.
  • the DNA corresponding to amino acid residues 25 to 274 of NucA is amplified by the PCR to introduce, at the DNA level, a BamHI (at the 5' of the coding strand) and a Eagl (at the 3' of the coding strand) restriction site and, at the protein level, a linker (for example -SGGSGS- stretch, SEQ ID NO: 219) between the C terminal domain of the TALE and the NucA catalytic domain.
  • the final TALE::NucA constructs are generated by insertion of the NucA catalytic domain into the scaffold variants using BamHI and Eagl and standard molecular biology procedures.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • TALE-AvrBs3::NucA constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 7).
  • TALE-AvrBs3::NucA constructs were tested on a target having only a single AvrBs3 recognition site (SEQ ID NO: 224).
  • Data summarized in figure 11 show that TALE-AvrBs3::NucA constructs are active on all targets having at least one AvrBs3 recognition site, according to the cTALEN of the present invention.
  • Example 3d TALE::ColE7 compact TALEN
  • the catalytic domain of ColE7 (SEQ ID NO: 140), a nonspecific endonuclease from E.coli, was fused to a TALE-derived scaffold (composed of a N-terminal domain, a central core composed of RVDs and a C-terminal domain) to create a new class of cTALEN (TALE::ColE7).
  • TALE cTALEN
  • construct names are written as either CD::TALE-RVD (catalytic domain is fused N-terminal to the TALE domain) or TALE-RVD::CD (catalytic domain is fused C-terminal to the TALE domain), where "-RVD” optionally designates the sequence recognized by the TALE domain and "CD” is the catalytic domain type.
  • TALE- AvrBs3::ColE7 novel TALE::ColE7 constructions that target for example the AvrBs3 sequence, and are thus named TALE- AvrBs3::ColE7.
  • a core TALE scaffold, sT2 (SEQ ID NO: 135), was selected onto which (a) different sets of RVD domains could be inserted to change DNA binding specificity, and; (b) a selection of ColE7-derived catalytic domains could be attached, N- or C-terminal, to effect DNA cleavage (or nicking).
  • the sT2 truncated scaffold was generated by the PCR from a full-length core TALEN scaffold template (pCLS7183, SEQ ID NO: 141) using primers CMP_G061 (SEQ ID NO: 142) and CMP_G065 (SEQ ID NO: 143) and was cloned into vector pCLS7865 (SEQ ID NO: 144) to generate pCLS7865-cTALll_CFSl (pCLS9009, SEQ ID NO: 145), where CFS1 designates the amino acid sequence -GSSG- (with underlying restriction sites BamHI and Kpn2l in the coding DNA to facilitate cloning).
  • the ColE7 (SEQ ID NO: 140) catalytic domain was subcloned into the pCLS9009 backbone by restriction and ligation using Kpn2l and Eagl restriction sites, yielding pCLS7865-cTll_ColE7 (pCLS9939, SEQ ID NO: 231, encoding the protein of SEQ ID NO: 435).
  • the fusion contains the dipeptide -GSSG- linking the TALE-derived DNA binding domain and ColE7-derived catalytic domain.
  • the final TALE-AvrBs3::ColE7 yeast expression plasmid, pCLS8589 was prepared by yeast in vivo cloning using plasmid pCLS9940 (SEQ ID NO: 232).
  • plasmid pCLS9940 approximately 40 ng of plasmid (pCLS9940) linearized by digestion with BssHII and 1 ng of the pCLS0542 (SEQ ID NO: 156) plasmid DNA linearized by digestion with Ncol and Eagl were used to transform the yeast S. cerevisiae strain FYC2- 6A (MAT , trplA63, Ieu2hl, his3 20Q) using a high efficiency LiAc transformation protocol (Arnould et al. 2007).
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE-AvrBs3: :ColE7 construct was tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 7).
  • constructs were tested on a target having only a single AvrBs3 recognition site (SEQ ID NO: 224, Table 7).
  • TALE-AvrBs3::ColE7 activity levels on the respective targets in yeast cells are shown in figure 12.
  • the DNA sequence coding for the RVDs to target the NptllT5-L and NptllT6-L sites were subcloned into plasmid pCLS15785 (SEQ ID NO: 285, a C-terminally modified ColE7 K497A mutant of plasmid pCLS9939, SEQ ID NO: 231) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequences to create the subsequent TALE::ColE7_A497 constructs cTllNptllT5-L_ColE7_A497 (pCLS15786, SEQ ID NO: 286) and cTllNptllT6-L_ColE7_A497 (pCLS15787, SEQ ID NO: 287), respectively.
  • Plasmid pCLS14529 allows for cloning gene of interest sequences downstream of a promoter that confers high levels of constitutive expression in plant cells.
  • a YFP-based single-strand annealing (SSA) assay was employed.
  • the YFP reporter gene has a short duplication of coding sequence that is interrupted by either an NptllT5 or NptllT6 TALEN target site. Cleavage at the target site stimulates recombination between the repeats, resulting in reconstitution of a functional YFP gene.
  • the reporter is introduced along with a construct encoding a Fokl-based TALEN or compact TALEN into tobacco protoplasts by PEG-mediated transformation. Uniform transformation efficiencies were obtained by using the same amount of plasmid in each transformation - i.e.
  • Table 10 Activity of TALE-NptllT5-L::ColE7_A497 and TALE-NptllT6-L::ColE7_A497 on appropriate DNA targets. Relative activity is scaled to the control constructs as: n.a., not applicable; +, 100% activity of control (8% YFP positive cells).
  • Variants differing by truncations of the C-terminal domain of the AvrBs3-derived TALEN are chosen as starting scaffolds.
  • a subset of these variants includes truncation after positions E886 (CO), P897 (Cll), G914 (C28), L926 (C40), D950 (C64), R1000 (C115), D1059 (C172) (the protein domains of truncated C-terminal domains Cll to C172 are respectively given in SEQ ID NO: 204 to 209) and P1117 [also referred as Cter wt or WT Cter (SEQ ID NO: 210) lacking the activation domain of the C-terminal domain of natural AvrBs3 (SEQ ID NO: 220)].
  • the plasmids coding for the variant scaffolds containing the AvrBs3-derived N-terminal domain, the AvrBs3-derived set of repeat domains and the truncated AvrBs3-derived C-terminal domain [pCLS7821, pCLS7803, pCLS7807, pCLS7809, pCLS7811, pCLS7813, pCLS7817 (SEQ ID NO: 211 to 217) which are based on the pCLS7184 (SEQ ID NO: 196)] allow cloning of any catalytic domain in fusion to the C-terminal domain, using the restriction sites BamHI and Eagl.
  • the DNA corresponding to the catalytic domain of ColE7 is amplified by the PCR to introduce, at the DNA level, a BamHI (at the 5' of the coding strand) and a Eagl (at the 3' of the coding strand) restriction site and, at the protein level, a linker (for example -SGGSGS- stretch, SEQ ID NO: 219) between the C terminal domain of the TALE and the ColE7 catalytic domain.
  • a linker for example -SGGSGS- stretch, SEQ ID NO: 219
  • variants of the ColE7 endonuclease domain that modulate catalytic activity can be generated having changes (individually or combined) at the following positions: K446, R447, D493, R496, K497, H545, N560 and H573 [positions refer to the amino acid sequence of the entire ColE7 protein (SEQ ID NO: 11)].
  • the final TALE::ColE7 constructs are generated by insertion of the ColE7 catalytic domain into the scaffold variants using BamHI and Eagl and standard molecular biology procedures.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE-AvrBs3::ColE7 constructs are tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 7).
  • constructs were tested on a target having only a single AvrBs3 recognition site (SEQ ID NO: 224, Table 7).
  • the wild-type l-Crel meganuclease (SEQ ID NO: 106) was chosen as a protein template to derive a sequence-specific catalytic domain that when fused to a TALE-derived scaffold (composed of a N- terminal domain, a central core composed of RVDs and a C-terminal domain) would generate a new class of cTALEN (TALE::Crel). To distinguish the orientation (N-terminal vs.
  • construct names are written as either CD::TALE-RVD (catalytic domain is fused N-terminal to the TALE domain) or TALE-RVD::CD (catalytic domain is fused C-terminal to the TALE domain), where "-RVD” optionally designates the sequence recognized by the TALE domain and "CD” is the catalytic domain type.
  • TALE::Crel-based constructions that target for example the T cell receptor B gene (TCRB gene, SEQ ID NO: 290, Figure 13) sequence, both via the TALE DNA binding domain and the re-engineered l-Crel domain.
  • TALE::Crel compact TALEN specificity of the TALE::Crel compact TALEN is driven by both the TALE DNA binding domain as well as the l-Crel-derived catalytic domain.
  • such proteins can provide, within a reasonably-sized monomeric protein, the requisite high specificity demanded by therapeutic applications.
  • TALE::Crel in yeast A core TALE scaffold, sT2 (SEQ ID NO: 135), was selected onto which (a) different sets of RVD domains could be inserted to change DNA binding specificity, and; (b) a selection of l-Crel-derived catalytic domains could be attached, N- or C-terminal, to effect DNA cleavage (or nicking).
  • the sT2 truncated scaffold was generated by the PCR from a full-length core TALEN scaffold template (pCLS7183, SEQ ID NO: 141) using primers CMP_G061 (SEQ ID NO: 142) and CMP_G065 (SEQ ID NO: 143) and was cloned into vector pCLS7865 (SEQ ID NO: 144) to generate pCLS7865-cTALll_CFSl (pCLS9009, SEQ ID NO: 145), where CFS1 designates the amino acid sequence -GSSG- (with underlying restriction sites BamHI and Kpn2l in the coding DNA to facilitate cloning).
  • l-Crel_NFSl SEQ ID NO: 122
  • NFS1 SEQ ID NO: 98
  • pCLS7865-cTALll_CFSl scaffold using BamHI and Eagl restriction sites
  • the l-Crel meganuclease was subsequently replaced by the engineered TCRB02-A meganuclease (pCLS6857, SEQ ID NO: 291) construct using Kpn2l and Xhol restriction sites, yielding pCLS7865-cTll_scTB2aD01 (pCLS15788, SEQ ID NO: 292, encoding the protein of SEQ ID NO: 439).
  • TCRB02-A_148C pCLS12083, SEQ ID NO: 293, encoding the protein of SEQ ID NO: 442
  • TCRB02-A_333C pCLS12195, SEQ ID NO: 294, encoding the protein of SEQ ID NO: 443
  • pCLS7865-cTll_scTB2aD01_148C pCLS15789, SEQ ID NO: 295, encoding the protein of SEQ ID NO: 440
  • pCLS7865-cTll_scTB2aD01_333C pCLS15790, SEQ ID NO: 296, encoding the protein of SEQ ID NO: 441).
  • DNA sequences for each RVD were independently subcloned into plasmid pCLS15788 (SEQ ID NO: 292) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequence to create the subsequent TALE::scTB2aD01 constructs cTHTB2Al_scTB2aD01 (pCLS15791, SEQ ID NO: 300), cTHTB2A2_scTB2aD01 (pCLS15792, SEQ ID NO: 301) and cTHTB2A3_scTB2aD01 (pCLS15793, SEQ ID NO: 302).
  • TCRB02A2 (SEQ ID NO: 298) RVDs were similarly cloned into PCLS15789 (SEQ ID NO: 295) to create cTHTB2A2_scTB2aD01_148C (pCLS15794, SEQ ID NO: 303). All constructs were sequenced and the various inserts transferred to additional vectors as needed (see below).
  • the final TALE::scTB2aD01 yeast expression plasmids were prepared by yeast in vivo cloning using plasmids pCLS15791 (SEQ ID NO: 300), pCLS15792 (SEQ ID NO: 301), pCLS15793 (SEQ ID NO: 302) and pCLS15794 (SEQ ID NO: 303), respectively.
  • each plasmid linearized by digestion with BssHII and 1 ng of the pCLS0542 (SEQ ID NO: 156) plasmid DNA linearized by digestion with Ncol and Eagl were used to transform, respectively, the yeast S. cerevisiae strain FYC2-6A (MAT , trpl S , / ⁇ 2 ⁇ 1, his3bl00) using a high efficiency LiAc transformation protocol (Arnould et al. 2007).
  • yeast target reporter plasmids containing the TALEN or meganuclease DNA target sequences were constructed as previously described (International PCT Applications WO
  • TALE::scTB2aD01-based constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003;
  • TCRB02Tsp7 SEQID NO: AC4
  • TCRB02Tspl2 SEQID NO: AC5
  • TCRB02Tspl6 SEQID NO: AC6
  • the TCRB02.1-only target was included to compare activity with the engineered TCRB02-A meganuclease (pCLS6857, SEQ ID NO: 291), which does not require the TALE DNA binding sites for activity.
  • Activity levels on the respective targets in yeast cells for the indicated TALE::scTB2aD01-based constructs are shown in figure 14.
  • All mammalian target reporter plasmids containing the TALEN DNA target sequences were constructed using the standard Gateway protocol (INVITROGEN) into a CHO reporter vector (Arnould, Chames et al. 2006, Grizot, Epinat et al. 2010).
  • TALE::scTB2aD01-based constructs were transfected in mammalian cells (HEK293) alongside the engineered TCRB02-A meganuclease (pCLS6857, SEQ ID NO: 291). Briefly, cells were transfected, respectively, with 300 ng of each protein encoding plasmid in the presence of lipofectamine. Fourty-eight hours post-transfection, 20 ⁇ g of total protein extract for each sample was analyzed by Western-Blot using a polyclonal anti-l-Crel antibody. A typical western-blot is shown in Figure 15.
  • Relative toxicity of the TALE::scTB2aD01-based constructs was assessed using a cell survival assay. CHOK1 cells were used to seed plates at a density of 2.5*10 3 cells per well. The following day, varying amounts of plasmid encoding either the TALE::scTB2aD01-based constructs (pCLS14894 and pCLS14895; SEQ ID NO: 308 and 309) or the engineered TCRB02-A meganuclease (pCLS6857, SEQ ID NO: 291) and a constant amount of GFP-encoding plasmid (10 ng) were used to transfect the cells with a total quantity of 200 ng using Polyfect reagent.
  • GFP levels were monitored by flow cytometry (Guava Easycyte, Guava technologies) on days 1 and 6 post-transfection.
  • Cell survival is expressed as a percentage, calculated as a ratio (TALEN and meganuclease-transfected cells expressing GFP on Day 6 / control-transfected cells expressing GFP on Day 6) corrected for the transfection efficiency determined on Day 1.
  • Typical cell survival assay data are shown in Figure 16.
  • Genomic DNA was extracted 2 and 7 days post-transfection with the DNeasy Blood and Tissue kit (Qiagen) and the region encompassing the TCRB02 site ( Figure 13) was amplified using the PCR with oligos TRBC2F3 (Seq ID NO: 311) and TRBC2R3B (SEQ ID NO: 312) at day 2 post-transfection and with oligos TRBC2F4 (SEQID NO: 315) and TRBC2R4B (SEQID NO: 314) at day 7 post-transfection.
  • Respective PCR products 100 ng
  • were heat denatured allowed to re-anneal by slow-cooling then treated with T7 endonuclease 1 (NEB) for 15 minutes at 37°C.
  • FIG. 17 illustrates the detectable NHEJ activity of the TALE::scTB2aD01- based constructs (pCLS14894 and pCLS14895; SEQ ID NO: 308 and 309) compared to the engineered TC B02-A meganuclease (pCLS6857, SEQ ID NO: 291). Whereas at day 2 NHEJ results are comparable for all constructs, NHEJ activity at day 7 can only be detected for the TALE::scTB2aD01-based constructs., suggesting that these compact TALENs do not induce cytotoxicity.
  • TALE::Crel compact TALEN A significant novel property of the TALE::Crel compact TALEN resides in the ability to independently engineer the "hybrid" specificity of the final molecule. As such, the inherent activity/specificity ratio can be modulated within the TALE::Crel-derived constructs, allowing for unprecedented specific targeting with retention of high DNA cleavage activity. In its simplest form, successful re-targeting of the TALE DNA binding domain is achieved via the RVD cipher ( Figure 3), with a pseudo one-to-one correspondence to the underlying DNA base. Engineering of the l-Crel moiety, however, presents more challenges insomuch as there exists a potential codependence of protein-DNA contacts needed for suitable DNA binding and cleavage activity.
  • the breakdown of the l-Crel DNA interaction surface into discrete 10NNN, 7NN, 5NNN and 2NN regions allows for novel engineering wherein high specificity is maintained in the central 5NNN-2NN region at the expense of "loose” or broad specificity in the outer 10NNN-7NN regions.
  • such an approach could reduce the complexity of re- engineering the l-Crel-derived scaffold for a compact TALEN context as only "selectivity" in cleavage is required for the catalytic domain, with subsequent specificity provided by the TALE DNA binding part of the protein fusion.
  • TALE::Crel-derived compact TALENs ideal tools for therapeutic applications.
  • l-Crel moiety could in principle be replaced with a host of naturally existing or re-engineered homing endonuclease-derived catalytic domains.
  • TALE::SnaseSTAUU Activity of TALE::SnaseSTAUU in yeast Variants differing by truncations of the C-terminal domain of the AvrBs3-derived TALEN (SEQ ID NO: 196) are chosen as starting scaffolds.
  • a subset of these variants includes truncation after positions G914 (C28) and L926 (C40) (the protein domains of truncated C-terminal domains C28 and C40 are respectively given in SEQ ID NO: 205 and 206).
  • the plasmids coding for the variant scaffolds containing the AvrBs3-derived N-terminal domain, the AvrBs3-derived set of repeat domains and the truncated AvrBs3-derived C-terminal domain [pCLS7807 and pCLS7809, (SEQ ID NO: 213 and 214) which are based on the pCLS7184 (SEQ ID NO: 196)] allow cloning of any catalytic domain in fusion to the C-terminal domain, using the restriction sites BamH! and Eagl.
  • the DNA corresponding to amino acid residues 83 to 231 of SnaseSTAAU (SEQ ID NO: 30) is amplified by the PCR to introduce, at the DNA level, a BamHI (at the 5' of the coding strand) and a Eagl (at the 3' of the coding strand) restriction site and, at the protein level, a linker (for example -SGGSGS- stretch, SEQ ID NO: 219) between the C terminal domain of the TALE and the SnaseSTAAU catalytic domain.
  • a linker for example -SGGSGS- stretch, SEQ ID NO: 219
  • the final TALE::SnaseSTAAU constructs are generated by insertion of the SnaseSTAAU catalytic domain into the scaffold variants using BamHI and Eagl and standard molecular biology procedures. Scaffold variants truncated after positions G914 (C28) and L926 (C40), respectively encoded by pCLS7807 and pCLS7809, (SEQ ID NO: 213 and 214), were fused to the SnaseSTAAU catalytic domain (SEQ ID NO: 30), leading to pCLS9082 and pCLS9081 (SEQ ID NO: 370 and 371). The cloning step also brings at the amino acid level an AAD sequence at the Cter of the SnaseSTAAU catalytic domain.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE-AvrBs3:: SnaseSTAAU constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN, which requires two binding sites for activity.
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 7).
  • TALE-AvrBs3::SnaseSTAAU constructs were tested on a target having only a single AvrBs3 recognition site (SEQ ID NO: 224).
  • Data summarized in figure 19 show that TALE- AvrBs3::SnaseSTAAU constructs are active on targets having two AvrBs3 recognition site, according to the chimeric protein of the present invention, but also on targets containing only one AvrBs3 recognition site.
  • Basic cTALENs are composed of a single DNA binding domain fused to a single catalytic domain and are designed to stimulate HR via a single double-strand DNA cleavage or single-strand nicking event. For certain applications (e.g. gene inactivation), it is favorable to enhance the level of NHEJ.
  • This example illustrates the creation of a dual-cleavage cTALEN (dcTALEN) that is capable of effecting cleavage of double-strand DNA at two distinct sites flanking the TALE DNA binding domain (Figure 5C). The simultaneous cleavage of the DNA at the two sites is expected to eliminate the intervening sequence and therefore abolish "scarless" re-ligation by NHEJ ( Figurel).
  • the baseline scaffolds (SEQ ID NO: 136 to SEQ ID NO: 139) described in Example 3 are used as starting points for fusion designs.
  • a non-exhaustive list of catalytic domains amenable to fusion with TALE DNA binding domains is presented in Table 2.
  • a non-exhaustive list of linkers that can be used is presented in Table 3. See examples 3, 5, 6 and 7 for additional details concerning the choice of linker or enhancement domain.
  • For the dcTALEN designs at least one cleavase domain is fused (N- or C-terminal) to the TALE DNA binding domain.
  • the additional catalytic domain can be either a nickase of cleavase (endonuclease or exonuclease) domain, and depends on the nature of the application. For example, the coupling of a cleavase domain on one side with a nickase domain on the other could result in excision of a single-strand of DNA spanning the TALE DNA binding region. The targeted generation of extended single-strand overhangs could be applied in applications that target DNA repair mechanisms. For targeted gene inactivation, the use of two cleavase domains in the dcTALEN is preferred.
  • dcTALEN designs are assessed using our yeast assay (see Example 1) and provide detectable activity comparable to existing engineered meganucleases. Furthermore, potential enhancements in NHEJ are monitored using the mammalian cell based assay as described in Example 3.
  • Example 4a Activity of Tevl::TALE::Fokl and Tevl::TALE::Tevl dual cleavage TALENs
  • Dual cleavage TALENs possessing an N-terminal l-Tevl-derived catalytic domain and a C-terminal catalytic domain derived from either Fokl (SEQ ID NO :368) or l-Tevl (SEQ ID NO: 20), were generated on the baseline bT2-Avr (SEQ ID NO: 137) scaffold.
  • the catalytic domain fragment of l-Tevl was excised from plasmid pCLS12731 (SEQ ID NO: 236) and subcloned into vectors pCLS15795 (SEQ ID NO: 351) and pCLS9013 (SEQ ID NO: 153) by restriction and ligation using Ncol and Nsil restriction sites, yielding TevD02_cTllAvr_Fokl-L (pCLS15796, SEQ ID NO: 352, encoding the protein of SEQ ID NO: 447) and TevD02_cTllAvr_TevD02 (pCLS15797, SEQ ID NO: 353, encoding the protein of SEQ ID NO: 448), respectively. All constructs were sequenced and the insert transferred to additional vectors as needed (see below).
  • Tevl::TALE-AvrBs3::Fokl and Tevl::TALE-AvrBs3::Tevl yeast expression plasmids pCLS13299 (SEQ ID NO: 354, encoding the protein of SEQ ID NO: 449) and pCLS13301 (SEQ ID NO: 355, encoding the protein of SEQ ID NO: 450), were prepared by yeast in vivo cloning using plasmids pCLS15796 (SEQ ID NO: 352) and pCLS15797 (SEQ ID NO: 353), respectively.
  • each plasmid linearized by digestion with BssHII and 1 ng of the pCLS0542 (SEQ ID NO: 156) plasmid DNA linearized by digestion with Ncol and Eagl were used to transform, respectively, the yeast S.
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • Tevl::TALE-AvrBs3::Fokl and Tevl::TALE-AvrBs3::Tevl constructs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • pCLS8590 SEQ ID NO: 244
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 6).
  • constructs were tested on a target having only a single AvrBs3 or RagT2- recognition site (SEQ ID NO: 238, Table 11).
  • Tevl::TALE-AvrBs3::Fokl and Tevl::TALE-AvrBs3::Tevl activity levels in yeast were comparable to those of their parent molecules lacking the N-terminal l-Tevl-derived catalytic domain.
  • Significant activity is illustrated in table 11 for a sample single-site target, according to the dcTALEN of the present invention.
  • TALE-AvrBs3 :Fokl ++++ n.d.
  • Table 11 Activity of various cTALENs and dcTALENs on dual- and single-site DNA targets. Relative activity is scaled as: n.d., no activity detectable; +, ⁇ 25% activity; ++, 25% to ⁇ 50% activity; +++, 50% to ⁇ 75% activity; ++++, 75% to 100% activity.
  • Example 4b scTrex2::TALE::Fokl dual cleavage TALEN
  • a dual cleavage TALEN (CD::TALE: :CD), possessing an N-terminal scTrex2-derived catalytic domain and a C-terminal catalytic domain derived from Fokl, was generated on the baseline bT2-Avr (SEQ ID NO: 137) scaffold.
  • the catalytic domain fragment of scTrex2 was excised from plasmid pCLS15798 (SEQ ID NO: 356, encoding the protein of SEQ ID NO: 451) and subcloned into vector pCLS15795 (SEQ ID NO: 351) by restriction and ligation using Ncol and Nsil restriction sites, yielding
  • scTrex2_cTHAvr_Fokl-L (pCLS15799, SEQ ID NO: 357, encoding the protein of SEQ ID NO: 452).
  • the construct was sequenced and the insert transferred to additional vectors as needed (see below).
  • CHO Kl cells were transfected in a 96-well plate format with 75 ng of target vector and an increasing quantity of each variant DNA from 0.7 to 25 ng , in the presence of PolyFect reagent ( ⁇ per well). The total amount of transfected DNA was completed to 125 ng (target DNA, variant DNA, carrier DNA) using an empty vector. Seventy-two hours after transfection, culture medium was removed and 150 ⁇ of lysis/revelation buffer for ⁇ -galactosidase liquid assay was added. After incubation at 37°C ; optical density was measured at 420 nm. The entire process is performed on an automated Velocityll BioCel platform (Grizot, Epinat et al. 2009).
  • Enhanced TALENs are created using functional cTALENS from Example 3.
  • the addition of the enhancer domain is evaluated in our yeast assay (see Example 1).
  • a particular enhancer domain is judged useful if it provides a minimal 5% enhancement in efficiency of the starting cTALEN, more preferably a minimal 10% enhancement, more preferably 20%, more preferably 30%, more preferably 40%, more preferably 50%, again more preferably an enhancement greater than 50%.
  • Example 5a TALE ::Col E7 : :TALE enhanced TALENs
  • Enhanced TALENs possessing N- and C-terminal TALE DNA binding domains bordering a central DNA cleavage domain, were generated using the sT2 (SEQ ID NO: 135) core scaffold.
  • the layout of this class of compact TALEN is illustrated in figure 6B, wherein the N-terminal "enhancer domain” is itself a TALE DNA binding domain.
  • a point-mutant derivative of the ColE7 catalytic domain (pCLS15785, SEQ ID NO: 285) was chosen for the catalytic core of the eTALEN.
  • TALE-AvrBs3::ColE7_A497::TALE-RagT2-R (pCLS15800, SEQ ID NO: 360, encoding the protein of SEQ ID NO: 453) and TALE-RagT2-R::ColE7_A497: :TALE-AvrBs3 (pCLS15801, SEQ ID NO: 361, encoding the protein of SEQ ID NO: 454), were obtained using standard molecular cloning techniques with DNA sequences from sT2 (SEQ ID NO: 135), pCLS15785 (SEQ ID NO: 285), AvrBs3 (SEQ ID NO: 152) and RagT2-R (SEQ ID NO: 271) as templates. All TALE::CD::TALE constructs were sequenced and the inserts transferred to additional vectors as needed (see below).
  • the yeast S. cerevisiae strain FYC2-6A (MAT , ⁇ 1 ⁇ 63, / ⁇ 2 ⁇ 1, his3&200) was transformed using a high efficiency LiAc transformation protocol (Arnould et al. 2007).
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE::CD::TALE constructs are tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on asymmetric AvrBs3/RagT2-R hybrid targets in order to compare activity with a parent compact TALEN (e.g. pCLS8589, SEQ ID NO: 233), which has activity on targets with a single binding site.
  • constructs are tested on a target having only a single AvrBs3 or RagT2-R recognition site.
  • an enhancer domain is used to replace the N-terminal region of the TALE protein.
  • Sequence and structure-based homology modeling of the N-terminal TALE region of bT2-derivatives have yielded three potential candidate proteins (Table 1): (i) Fem-3 binding factor, SEQ ID NO: 4,(FBF1, Puf family of RNA binding proteins) from C.elegans; (ii) artificial alpha-helicoidal repeat proteins (aRep), SEQ ID NO: 5 and; (iii) proteins of the Ankyrin super- family. The content and arrangement of secondary structure elements allows for using these models as starting points for enhancer domains that replace the N-terminal region of the TALE protein.
  • Chimeric proteins are constructed using the analogous regions from one of the 3 candidates mentioned to replace the N-terminal TALE protein region up to the first canonical repeat domain.
  • the new interface is redesigned in silico, using the homology models as guides. This approach can be used to pinpoint the determinants of specificity for the requisite T at position -1 of the target sequence.
  • the replacement enhancer domain should at minimum provide structural integrity to the cTALEN protein. Constructs are evaluated in our yeast assay (see Example 1).
  • a particular enhancer domain is judged useful if it provides a minimal 5% retention in activity of the starting cTALEN in the absence of a T at target position -1, more preferably a minimal 10% retention, more preferably 20%, more preferably 30%, more preferably 40%, more preferably 50%, again more preferably a retention in activity greater than 50%.
  • homology models are used to pinpoint regions for generating possible C-terminal truncations; potential truncation positions include 28, 40, 64, 118, 136, 169, 190 residues remaining beyond the last half-repeat domain. Additionally, homologous regions from the aforementioned proteins can be used to replace the C-terminal domain entirely. Contact prediction programs can be used to identify, starting from the primary sequence of a protein, the pairs of residues that are likely proximal in the 3D space. Such chimeric proteins should provide more stable scaffolds on which to build cTALENs.
  • Constructs are evaluated in our yeast assay (see Example 1).
  • a particular enhancer domain is judged useful if it provides a minimal 5% retention in activity of the starting cTALEN, more preferably a minimal 10% retention, more preferably 20%, more preferably 30%, more preferably 40%, more preferably 50%, again more preferably a retention in activity greater than 50%.
  • trans cTALENS are generated by (a) using a catalytic domain with separable activities (Figure 7A, B), or; (b) providing an auxiliary activity as a TALE-fusion ( Figure 7C). Sequence and structure-based modeling of class III (Chan, Stoddard et al. 2011). TypellS restriction endonucleases ( Eases) were used to create trans TALENs (see Table 2 for a non-exhaustive list). The initial trans TALEN is generated via fusion of an independently active catalytic domain (e.g. the Nt.BspD6l nickase) as described in Examples 3 and 4. In principle this trans TALEN can be used as is depending on the application.
  • an independently active catalytic domain e.g. the Nt.BspD6l nickase
  • the auxiliary domain in this case, ss.BspD6l
  • trans Figure 8A
  • Such optionally trans and/or heterodimeric proteins can allow for cTALEN scaffolds with activity that can be modulated to a given application.
  • auxiliary domain used exhibits activity independent of the initial cTALEN (i.e in a non-trans TALEN context), it can as well be fused to a TALE domain for specific targeting ( Figure 7B).
  • auxiliary domains can also be provided in trans as targeted entities to provide functions unrelated to the cTALEN ( Figure 7C).
  • Example 8a Specific inhibition of TALEN catalytic activity
  • both NucA SEQ ID NO: 26
  • ColE7 SEQ ID NO: 140
  • NuiA SEQ ID NO: 229)
  • Im7 SEQ ID NO: 230
  • Colicin-E9 SEQ ID NO: 366
  • Im9 SEQ ID NO: 369
  • the inhibitors serve as auxiliary domains ( Figure 7A) that modulate the activity by preventing DNA cleavage.
  • the Im7 (SEQ ID NO: 230) and NuiA (SEQ ID NO: 229) inhibitor proteins were subcloned into the pCLS7763 backbone (SEQ ID NO: 241) by restriction and ligation using Ncol and Eagl restriction sites, yielding pCLS9922 (SEQ ID NO: 242) and pCLS9923 (SEQ ID NO: 243), respectively.
  • These plasmids were then used in co-transformation experiments in the standard yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • TALE-AvrBs3::NucA (pCLS9924, SEQ ID NO: 223) and TALE-AvrBs3::ColE7 (pCLS8589, SEQ ID NO: 233) constructs were tested in a yeast SSA assay on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN (pCLS8590, SEQ ID NO: 244), which requires two binding sites for activity.
  • AvrBS3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: 157 to 192, Table 7).
  • constructs were tested on a target having only a single AvrBs3 recognition site (SEQ ID NO: 224, Table 7). Activity modulation of the TALENs was assessed in the presence or absence of specific or unspecific inhibitor protein, using the TALE-AvrBs3::Fokl TALEN as control.
  • TALE-AvrBs3::NucA and TALE-AvrBs3::ColE7 constructs are specifically inactivated by the presence of their respective inhibitor proteins NuiA and Im7, according to the present invention.
  • Table 12 Activity of TALEN constructs in the presence of inhibitor protein. Relative activity is scaled as: n.d., no activity detectable; +, ⁇ 25% activity; ++, 25% to ⁇ 50% activity; +++, 50% to ⁇ 75% activity; ++++, 75% to 100% activity.
  • Example 8b Enhancing TALEN catalytic activity via a trans TALEN
  • Example 3b illustrates that the Tevl::TALE functions unassisted as a compact TALEN (pCLS8522, SEQ ID NO: 237).
  • a trans TALEN was designed using a TALE::Tevl construct in a layout depicted in figure 7C.
  • the DNA sequence coding for the RVDs to target the RagT2-R site was subcloned into plasmid pCLS7865-cTll_TevD02 (pCLS9011, SEQ ID NO: 151) using Type IIS restriction enzymes BsmBI for the receiving plasmid and Bbvl and SfaNI for the inserted RVD sequence to create the subsequent TALE-RagT2-R::Tevl construct cTHRagT2-R_TevD02 (pCLS15802, SEQ ID NO: 364).
  • Plasmid pairs pCLS8522 (SEQ ID NO: 237) and pCLS7763 (SEQ ID NO: 241) or pCLS8522 (SEQ ID NO: 237) and pCLS8990 (SEQ ID NO: 365) were then used in co- transformation experiments in the standard yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • yeast target reporter plasmids containing the TALEN DNA target sequences were constructed as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006).
  • the TALE-RagT2-R::Tevl/Tevl::TALE-AvrBs3 construct pairs were tested in a yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al.
  • RagT2-R/AvrBs3 hybrid targets in order to compare activity with a parent compact TALEN (e.g. pCLS8522, SEQ ID NO: 237), which has activity on targets with a single binding site.
  • RagT2-R/AvrBs3 hybrid targets contain two different recognition sequences juxtaposed with the 3' end of the first (RagT2-R) proximal to the 5' end of the second (AvrBs3) and separated by "spacer" DNA ranging from 5 to 40 bps (SEQ ID NO: G064 to G099, Table 13).
  • Figure 18 illustrates the modulation in Tevl::TALE-AvrBs3 activity provided by the TALE-RagT2-R::Tevl construct, according to the trans cTALEN of the present invention.
  • Example 9 Replacement of the C-terminal domain by a polypeptide linker, activity with colE7 catalytic domain.
  • linker library is then subcloned in pCLS7183 (SEQ ID NO: 141) via the Xmal and BamHI restriction sites to replace the C- terminal domain of the AvrBs3-derived TALEN (pCLS7184, SEQ ID NO: 196).
  • the AvrBs3-derived set of repeat domains (RVDs) or any other RVD sequences having or lacking the terminal half RVD is cloned in this backbone library.
  • DNA from the library is obtained, after scrapping of the colonies from the Petri dishes, using standard miniprep techniques.
  • the Fokl catalytic head is removed using BamHI and Eagl restriction enzymes, the remaining backbone being purified using standard gel extraction techniques.
  • DNA coding for ColE7 catalytic domain (SEQ ID NO: 11) was amplified by the PCR to introduce, at the DNA level, a BamHI (at the 5' of the coding strand) and a Eagl (at the 3' of the coding strand) restriction site and, at the protein level, a linker (for example -SGGSGS - stretch, SEQ ID NO: 219) between the C terminal domain library and the catalytic head.
  • a linker for example -SGGSGS - stretch, SEQ ID NO: 219
  • DNA from the final library is obtained, after scrapping of the colonies from Petri dishes, using standard miniprep techniques and the resulting libraries are screened in our yeast SSA assay as previously described (International PCT Applications WO 2004/067736 and in Epinat, Arnould et al. 2003; Chames, Epinat et al. 2005; Arnould, Chames et al. 2006; Smith, Grizot et al. 2006) on pseudo palindromic targets in order to compare activity with a standard TALE-AvrBs3::Fokl TALEN, which requires two binding sites for activity.
  • AvrBs3 targets contain two identical recognition sequences juxtaposed with the 3' ends proximal and separated by "spacer" DNA containing 15, 18, 21 and 24 bps (SEQ ID NO: 167, 170, 173 and 176, Table 7).
  • constructs SEQ ID NO: 416-419
  • SEQ ID NO: 224 was tested on a target having only a single AvrBs3 recognition site.
  • Data summarized in figure 20 show sequences of the linker of a fraction of ColE7 constructs being active on targets having two AvrBs3 recognition sites or only one AvrBs3 recognition site.
  • TAL nucleases hybrid proteins composed of TAL effectors and Fokl DNA-cleavage domain. Nucleic Acids Res 39(1): 359-72.
  • TAL nucleases hybrid proteins composed of TAL effectors and Fokl DNA-cleavage domain

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Plant Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2012/032426 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof Ceased WO2012138927A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
JP2014504007A JP5996630B2 (ja) 2011-04-05 2012-04-05 コンパクトtale−ヌクレアーゼを作製する方法及びその使用
EP12725896.0A EP2694091B1 (en) 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof
CA2832534A CA2832534C (en) 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof
CN201280027394.9A CN103608027B (zh) 2011-04-05 2012-04-05 用于生成致密tale-核酸酶的方法及其用途
AU2012240110A AU2012240110B2 (en) 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof
SG2013074745A SG194115A1 (en) 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof
KR1020137029369A KR101982360B1 (ko) 2011-04-05 2012-04-05 콤팩트 tale-뉴클레아제의 발생 방법 및 이의 용도
DK12725896.0T DK2694091T3 (da) 2011-04-05 2012-04-05 Fremgangsmåde til fremstilling af kompakte tale-nukleaser og anvendelse heraf
ES12725896T ES2728436T3 (es) 2011-04-05 2012-04-05 Método para la generación de TALE-nucleasas compactas y usos de la mismas
IL228747A IL228747B (en) 2011-04-05 2013-10-06 Method for the generation of compact tale-nucleases and uses thereof
AU2017248447A AU2017248447B2 (en) 2011-04-05 2017-10-17 Method for the generation of compact tale-nucleases and uses thereof

Applications Claiming Priority (14)

Application Number Priority Date Filing Date Title
US201161472065P 2011-04-05 2011-04-05
US61/472,065 2011-04-05
US201161496454P 2011-06-13 2011-06-13
US61/496,454 2011-06-13
US201161499047P 2011-06-20 2011-06-20
US201161499043P 2011-06-20 2011-06-20
US61/499,047 2011-06-20
US61/499,043 2011-06-20
US201161533123P 2011-09-09 2011-09-09
US201161533098P 2011-09-09 2011-09-09
US61/533,098 2011-09-09
US61/533,123 2011-09-09
US201161579544P 2011-12-22 2011-12-22
US61/579,544 2011-12-22

Publications (2)

Publication Number Publication Date
WO2012138927A2 true WO2012138927A2 (en) 2012-10-11
WO2012138927A3 WO2012138927A3 (en) 2013-04-25

Family

ID=45976522

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2012/032426 Ceased WO2012138927A2 (en) 2011-04-05 2012-04-05 Method for the generation of compact tale-nucleases and uses thereof
PCT/US2012/032439 Ceased WO2012138939A1 (en) 2011-04-05 2012-04-05 New tale-protein scaffolds and uses thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/US2012/032439 Ceased WO2012138939A1 (en) 2011-04-05 2012-04-05 New tale-protein scaffolds and uses thereof

Country Status (13)

Country Link
US (5) US20140115726A1 (https=)
EP (3) EP2694089B1 (https=)
JP (3) JP5996630B2 (https=)
KR (1) KR101982360B1 (https=)
CN (1) CN103608027B (https=)
AU (2) AU2012240110B2 (https=)
CA (2) CA2832534C (https=)
DK (1) DK2694091T3 (https=)
ES (1) ES2728436T3 (https=)
HK (1) HK1253952A1 (https=)
IL (1) IL228747B (https=)
SG (2) SG10201602651YA (https=)
WO (2) WO2012138927A2 (https=)

Cited By (155)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013160230A1 (en) 2012-04-23 2013-10-31 Bayer Cropscience Nv Targeted genome engineering in plants
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2013182910A3 (en) * 2012-06-05 2014-02-13 Cellectis Transcription activator-like effector (tale) fusion protein
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
CN103668470A (zh) * 2012-09-12 2014-03-26 上海斯丹赛生物技术有限公司 一种dna文库及构建转录激活子样效应因子核酸酶质粒的方法
WO2014071006A1 (en) 2012-10-31 2014-05-08 Cellectis Coupling herbicide resistance with targeted insertion of transgenes in plants
WO2014076571A2 (en) 2012-11-16 2014-05-22 Cellectis Method for targeted modification of algae genomes
WO2014102688A1 (en) 2012-12-27 2014-07-03 Cellectis New design matrix for improvement of homology-directed gene targeting
WO2014118719A1 (en) 2013-02-01 2014-08-07 Cellectis Tevl chimeric endonuclease and their preferential cleavage sites
WO2014128659A1 (en) 2013-02-21 2014-08-28 Cellectis Method to counter-select cells or organisms by linking loci to nuclease components
EP2776560A2 (en) 2011-11-07 2014-09-17 The University of Western Ontario Endonuclease for genome editing
US20140301990A1 (en) * 2013-03-21 2014-10-09 Ospedale San Raffaele Srl Targeted disruption of t cell receptor genes using engineered zinc finger protein nucleases
WO2014161821A1 (en) 2013-04-02 2014-10-09 Bayer Cropscience Nv Targeted genome engineering in eukaryotes
WO2014184744A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering highly active t cell for immunotherapy
WO2014184741A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering allogeneic and highly active t cell for immunotheraphy
WO2015027134A1 (en) * 2013-08-22 2015-02-26 President And Fellows Of Harvard College Engineered transcription activator-like effector (tale) domains and uses thereof
WO2015059265A1 (en) 2013-10-25 2015-04-30 Cellectis Design of rare-cutting endonucleases for efficient and specific targeting dna sequences comprising highly repetitive motives
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
EP2758537A4 (en) * 2011-09-23 2015-08-12 Univ Iowa State Res Found MONOERARY TECHNIQUE OF TAL NUCLEASE OR ZINC FINGERUCLEASE FOR DNA MODIFICATION
WO2015121454A1 (en) 2014-02-14 2015-08-20 Cellectis Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
CN105008536A (zh) * 2013-04-16 2015-10-28 深圳华大基因科技服务有限公司 分离的寡核苷酸及其用途
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
WO2016034666A1 (en) 2014-09-04 2016-03-10 Cellectis Trophoblast glycoprotein (5t4, tpbg) specific chimeric antigen receptors for cancer immunotherapy
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
JP2016520320A (ja) * 2013-05-31 2016-07-14 セレクティスCellectis T細胞受容体α遺伝子を開裂するLAGLIDADGホーミングエンドヌクレアーゼおよびその用途
JP2016520319A (ja) * 2013-05-31 2016-07-14 セレクティスCellectis C−cケモカイン受容体5型(ccr5)遺伝子を開裂するlaglidadgホーミングエンドヌクレアーゼおよびその用途
WO2016120217A1 (en) 2015-01-26 2016-08-04 Cellectis Anti-hsp70 specific chimeric antigen receptors (cars) for cancer immunotherapy
JP2016523093A (ja) * 2013-06-25 2016-08-08 セレクティスCellectis バイオ燃料生産のための改変された珪藻
WO2016142532A1 (en) 2015-03-11 2016-09-15 Cellectis Methods for engineering allogeneic t cell to increase their persistence and/or engraftment into patients
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
WO2017024602A1 (zh) * 2015-08-07 2017-02-16 苏州大学张家港工业技术研究院 一种测定非同源末端连接修复活性的方法
WO2017025323A1 (en) 2015-08-11 2017-02-16 Cellectis Cells for immunotherapy engineered for targeting cd38 antigen and for cd38 gene inactivation
US9688997B2 (en) 2011-12-29 2017-06-27 Iowa State University Research Foundation, Inc. Genetically modified plants with resistance to Xanthomonas and other bacterial plant pathogens
WO2017178586A1 (en) 2016-04-15 2017-10-19 Cellectis A method of engineering prodrug-specific hypersensitive t-cells for immunotherapy by gene expression
WO2017178585A1 (en) 2016-04-15 2017-10-19 Cellectis A method of engineering drug-specific hypersensitive t-cells for immunotherapy by gene inactivation
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
WO2018115189A1 (en) 2016-12-21 2018-06-28 Cellectis Stably enginereed proteasome inhibitor resistant immune cells for immunotherapy
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
WO2018178377A1 (en) 2017-03-31 2018-10-04 Cellectis Sa Universal anti-cd22 chimeric antigen receptor engineered immune cells
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2019002633A1 (en) 2017-06-30 2019-01-03 Cellectis CELLULAR IMMUNOTHERAPY FOR REPETITIVE ADMINISTRATION
EP3453406A1 (en) 2014-07-29 2019-03-13 Cellectis Ror1 (ntrkr1) specific chimeric antigen receptors for cancer immunotherapy
WO2019072824A1 (en) 2017-10-09 2019-04-18 Cellectis IMPROVED ANTI-CD123 CAR IN UNIVERSAL MODIFIED IMMUNE T LYMPHOCYTES
EP3501268A1 (en) 2017-12-22 2019-06-26 Kws Saat Se Regeneration of plants in the presence of histone deacetylase inhibitors
EP3508581A1 (en) 2018-01-03 2019-07-10 Kws Saat Se Regeneration of genetically modified plants
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
WO2019149743A1 (en) 2018-01-30 2019-08-08 Cellectis Combination comprising allogeneic immune cells deficient for an antigen present on both t-cells and pathological cells and therapeutic antibody against said antigen
EP3546572A1 (en) 2013-05-13 2019-10-02 Cellectis Cd19 specific chimeric antigen receptor and uses thereof
EP3545756A1 (en) 2018-03-28 2019-10-02 KWS SAAT SE & Co. KGaA Regeneration of plants in the presence of inhibitors of the histone methyltransferase ezh2
WO2019195491A1 (en) 2018-04-05 2019-10-10 Juno Therapeutics, Inc. T cells expressing a recombinant receptor, related polynucleotides and methods
WO2019195492A1 (en) 2018-04-05 2019-10-10 Juno Therapeutics, Inc. Methods of producing cells expressing a recombinant receptor and related compositions
EP3567111A1 (en) 2018-05-09 2019-11-13 KWS SAAT SE & Co. KGaA Gene for resistance to a pathogen of the genus heterodera
EP3569619A1 (en) 2014-03-19 2019-11-20 Cellectis Cd123 specific chimeric antigen receptors for cancer immunotherapy
WO2019238832A1 (en) 2018-06-15 2019-12-19 Nunhems B.V. Seedless watermelon plants comprising modifications in an abc transporter gene
WO2019238909A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant
WO2019238908A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for enhancing genome engineering efficiency
WO2019238911A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant ii
EP3116902B1 (en) 2014-03-11 2020-01-01 Cellectis Method for generating t-cells compatible for allogenic transplantation
WO2020007593A1 (en) 2018-07-02 2020-01-09 Cellectis Chimeric antigen receptors (car)-expressing cells and combination treatment for immunotherapy of patients with relapse refractory adverse genetic risk aml
US10544201B2 (en) 2014-07-31 2020-01-28 Cellectis ROR1 specific multi-chain chimeric antigen receptor
JP2020018303A (ja) * 2013-06-14 2020-02-06 セレクティスCellectis 植物における非トランスジェニックのゲノム編集のための方法
EP3623379A1 (en) 2018-09-11 2020-03-18 KWS SAAT SE & Co. KGaA Beet necrotic yellow vein virus (bnyvv)-resistance modifying gene
US10612011B2 (en) 2015-07-30 2020-04-07 President And Fellows Of Harvard College Evolution of TALENs
WO2020157573A1 (en) 2019-01-29 2020-08-06 The University Of Warwick Methods for enhancing genome engineering efficiency
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US10752670B2 (en) 2015-05-20 2020-08-25 Cellectis Anti-GD3 specific chimeric antigen receptors for cancer immunotherapy
US10765728B2 (en) 2014-04-11 2020-09-08 Cellectis Method for generating immune cells resistant to arginine and/or tryptophan depleted microenvironment
EP3708651A1 (en) 2019-03-12 2020-09-16 KWS SAAT SE & Co. KGaA Improving plant regeneration
WO2020223571A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods
WO2020223535A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods
WO2020229241A1 (en) 2019-05-10 2020-11-19 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US10844361B2 (en) 2012-11-16 2020-11-24 Poseida Therapeutics, Inc. Site-specific enzymes and methods of use
EP3757219A1 (en) 2019-06-28 2020-12-30 KWS SAAT SE & Co. KGaA Enhanced plant regeneration and transformation by using grf1 booster gene
WO2021022223A1 (en) 2019-08-01 2021-02-04 Sana Biotechnology, Inc. Dux4 expressing cells and uses thereof
US10920208B2 (en) 2014-10-22 2021-02-16 President And Fellows Of Harvard College Evolution of proteases
WO2021041316A1 (en) 2019-08-23 2021-03-04 Sana Biotechnology, Inc. Cd24 expressing cells and uses thereof
WO2021048316A1 (en) 2019-09-12 2021-03-18 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021069387A1 (en) 2019-10-07 2021-04-15 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021093943A1 (en) 2019-11-12 2021-05-20 KWS SAAT SE & Co. KGaA Gene for resistance to a pathogen of the genus heterodera
WO2021110582A1 (en) 2019-12-03 2021-06-10 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021146627A1 (en) 2020-01-17 2021-07-22 Sana Biotechnology, Inc. Safety switches for regulation of gene expression
WO2021146222A1 (en) 2020-01-13 2021-07-22 Sana Biotechnology, Inc. Modification of blood type antigens
US11104967B2 (en) 2015-07-22 2021-08-31 President And Fellows Of Harvard College Evolution of site-specific recombinases
WO2021195426A1 (en) 2020-03-25 2021-09-30 Sana Biotechnology, Inc. Hypoimmunogenic neural cells for the treatment of neurological disorders and conditions
US11174493B2 (en) 2016-05-26 2021-11-16 Nunhems B.V. Seedless fruit producing plants
WO2021231661A2 (en) 2020-05-13 2021-11-18 Juno Therapeutics, Inc. Process for producing donor-batched cells expressing a recombinant receptor
WO2021260186A1 (en) 2020-06-26 2021-12-30 Juno Therapeutics Gmbh Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods
US11214792B2 (en) 2010-12-22 2022-01-04 President And Fellows Of Harvard College Continuous directed evolution
WO2021231549A3 (en) * 2020-05-12 2022-01-06 Factor Bioscience Inc. Engineered gene-editing proteins
CN113993997A (zh) * 2019-03-26 2022-01-28 Encodia 公司 修饰的切割酶,及其使用和相关试剂盒
WO2022036150A1 (en) 2020-08-13 2022-02-17 Sana Biotechnology, Inc. Methods of treating sensitized patients with hypoimmunogenic cells, and associated methods and compositions
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11299729B2 (en) 2015-04-17 2022-04-12 President And Fellows Of Harvard College Vector-based mutagenesis system
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
WO2022098787A1 (en) 2020-11-04 2022-05-12 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods
EP4019639A1 (en) 2020-12-22 2022-06-29 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in beta vulgaris
EP4019638A1 (en) 2020-12-22 2022-06-29 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in beta vulgaris
WO2022146891A2 (en) 2020-12-31 2022-07-07 Sana Biotechnology, Inc. Methods and compositions for modulating car-t activity
US11384360B2 (en) 2012-06-19 2022-07-12 Regents Of The University Of Minnesota Gene targeting in plants using DNA viruses
EP4043556A1 (en) 2015-06-30 2022-08-17 Cellectis Methods for improving functionality in nk cell by gene inactivation using specific endonuclease
US11447809B2 (en) 2017-07-06 2022-09-20 President And Fellows Of Harvard College Evolution of tRNA synthetases
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11473082B2 (en) 2015-06-17 2022-10-18 Poseida Therapeutics, Inc. Compositions and methods for directing proteins to specific loci in the genome
WO2022251367A1 (en) 2021-05-27 2022-12-01 Sana Biotechnology, Inc. Hypoimmunogenic cells comprising engineered hla-e or hla-g
US11524983B2 (en) 2015-07-23 2022-12-13 President And Fellows Of Harvard College Evolution of Bt toxins
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
WO2023287827A2 (en) 2021-07-14 2023-01-19 Sana Biotechnology, Inc. Altered expression of y chromosome-linked antigens in hypoimmunogenic cells
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
WO2023019227A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy to reduce complement-mediated inflammatory reactions
WO2023019229A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified primary cells for allogeneic cell therapy
WO2023019225A2 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy to reduce instant blood mediated inflammatory reactions
WO2023019226A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy
US11624130B2 (en) 2017-09-18 2023-04-11 President And Fellows Of Harvard College Continuous evolution for stabilized proteins
WO2023081900A1 (en) 2021-11-08 2023-05-11 Juno Therapeutics, Inc. Engineered t cells expressing a recombinant t cell receptor (tcr) and related systems and methods
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
EP4219731A2 (en) 2016-05-18 2023-08-02 Amyris, Inc. Compositions and methods for genomic integration of nucleic acids into exogenous landing pads
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
WO2023158836A1 (en) 2022-02-17 2023-08-24 Sana Biotechnology, Inc. Engineered cd47 proteins and uses thereof
WO2023173123A1 (en) 2022-03-11 2023-09-14 Sana Biotechnology, Inc. Genetically modified cells and compositions and uses thereof
WO2023183313A1 (en) 2022-03-22 2023-09-28 Sana Biotechnology, Inc. Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods
US11788080B2 (en) 2019-03-26 2023-10-17 Encodia, Inc. Modified cleavases, uses thereof and related kits
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
CN117344048A (zh) * 2023-09-28 2024-01-05 江苏省农业科学院 检测无毒基因Avr-Pik的RPA-LFD引物探针组、试剂盒及其应用
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11913044B2 (en) 2018-06-14 2024-02-27 President And Fellows Of Harvard College Evolution of cytidine deaminases
WO2024083579A1 (en) 2022-10-20 2024-04-25 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2024097314A2 (en) 2022-11-02 2024-05-10 Sana Biotechnology, Inc. Methods and systems for determining donor cell features and formulating cell therapy products based on cell features
WO2024100604A1 (en) 2022-11-09 2024-05-16 Juno Therapeutics Gmbh Methods for manufacturing engineered immune cells
WO2024151541A1 (en) 2023-01-09 2024-07-18 Sana Biotechnology, Inc. Type-1 diabetes autoimmune mouse
WO2024161021A1 (en) 2023-02-03 2024-08-08 Juno Therapeutics Gmbh Methods for non-viral manufacturing of engineered immune cells
US12060553B2 (en) 2017-08-25 2024-08-13 President And Fellows Of Harvard College Evolution of BoNT peptidases
WO2024229302A1 (en) 2023-05-03 2024-11-07 Sana Biotechnology, Inc. Methods of dosing and administration of engineered islet cells
WO2024243236A2 (en) 2023-05-22 2024-11-28 Sana Biotechnology, Inc. Methods of delivery of islet cells and related methods
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
WO2025043172A1 (en) 2023-08-23 2025-02-27 Sana Biotechnology, Inc. Modified cd47 proteins and their uses
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2025137646A1 (en) 2023-12-22 2025-06-26 Recode Therapeutics, Inc. Gene editing methods and compositions for treating cystic fibrosis
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12398390B2 (en) 2014-01-20 2025-08-26 President And Fellows Of Harvard College Negative selection and stringency modulation in continuous evolution systems
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
WO2025181336A1 (en) 2024-03-01 2025-09-04 Cellectis Sa Compositions and methods for hbb-editing in hspc
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
WO2025212519A1 (en) 2024-04-01 2025-10-09 Moonlight Bio, Inc. Dll3 binding proteins and uses thereof
WO2025235851A1 (en) 2024-05-10 2025-11-13 Juno Therapeutics, Inc. Genetically engineered t cells expressing a cd19 chimeric antigen receptor (car) and uses thereof for allogeneic cell therapy
US12473563B2 (en) 2020-02-28 2025-11-18 KWS SAAT SE & Co. KGaA Immature inflorescence meristem editing
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12492382B2 (en) 2019-05-10 2025-12-09 The Regents Of The University Of California Blood type O Rh—hypo-immunogenic cells
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof

Families Citing this family (121)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2342336B1 (en) 2008-09-05 2016-12-14 President and Fellows of Harvard College Continuous directed evolution of proteins and nucleic acids
AU2011265733B2 (en) * 2010-06-14 2014-04-17 Iowa State University Research Foundation, Inc. Nuclease activity of TAL effector and Foki fusion protein
CA2841710C (en) * 2011-07-15 2021-03-16 The General Hospital Corporation Methods of transcription activator like effector assembly
AU2012340213B2 (en) 2011-11-16 2017-12-07 Sangamo Therapeutics, Inc. Modified DNA-binding proteins and uses thereof
US10704021B2 (en) 2012-03-15 2020-07-07 Flodesign Sonics, Inc. Acoustic perfusion devices
DK3141259T3 (da) * 2012-03-15 2019-09-30 Cellectis Repeat-variable direster til targeting af nukleotider
WO2013158309A2 (en) * 2012-04-18 2013-10-24 The Board Of Trustees Of The Leland Stanford Junior University Non-disruptive gene targeting
US9890364B2 (en) 2012-05-29 2018-02-13 The General Hospital Corporation TAL-Tet1 fusion proteins and methods of use thereof
US9091827B2 (en) 2012-07-09 2015-07-28 Luxtera, Inc. Method and system for grating couplers incorporating perturbed waveguides
EP3789405A1 (en) 2012-10-12 2021-03-10 The General Hospital Corporation Transcription activator-like effector (tale) - lysine-specific demethylase 1 (lsd1) fusion proteins
EP4357457B1 (en) 2012-10-23 2024-10-16 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
WO2014071219A1 (en) * 2012-11-01 2014-05-08 Factor Bioscience Inc. Methods and products for expressing proteins in cells
CA2895155C (en) 2012-12-17 2021-07-06 President And Fellows Of Harvard College Rna-guided human genome engineering
AU2014214719B2 (en) 2013-02-07 2020-02-13 The General Hospital Corporation Tale transcriptional activators
MX374090B (es) * 2013-03-14 2025-03-05 Caribou Biosciences Inc Composiciones y métodos de ácidos nucleicos dirigidos al ácido nucleico.
FR3008106A1 (fr) * 2013-07-05 2015-01-09 Agronomique Inst Nat Rech Methode d'induction d'une recombinaison meiotique ciblee
US10782479B2 (en) 2013-07-08 2020-09-22 Luxtera Llc Method and system for mode converters for grating couplers
US10006011B2 (en) 2013-08-09 2018-06-26 Hiroshima University Polypeptide containing DNA-binding domain
CN105579068A (zh) * 2013-09-23 2016-05-11 伦斯勒理工学院 在各种细胞群中纳米颗粒介导的基因传递、基因组编辑和靶向配体的修饰
US9476884B2 (en) 2013-10-04 2016-10-25 University Of Massachusetts Hybridization- independent labeling of repetitive DNA sequence in human chromosomes
WO2015105955A1 (en) 2014-01-08 2015-07-16 Flodesign Sonics, Inc. Acoustophoresis device with dual acoustophoretic chamber
BR112016019940A2 (pt) 2014-03-21 2017-10-24 Univ Leland Stanford Junior edição de genoma sem nucleases
EP3157328B1 (en) * 2014-06-17 2021-08-04 Poseida Therapeutics, Inc. A method for directing proteins to specific loci in the genome and uses thereof
JP7199809B2 (ja) 2015-02-13 2023-01-06 ファクター バイオサイエンス インコーポレイテッド 核酸製品及びその投与方法
US20160244784A1 (en) * 2015-02-15 2016-08-25 Massachusetts Institute Of Technology Population-Hastened Assembly Genetic Engineering
US11377651B2 (en) 2016-10-19 2022-07-05 Flodesign Sonics, Inc. Cell therapy processes utilizing acoustophoresis
US11708572B2 (en) 2015-04-29 2023-07-25 Flodesign Sonics, Inc. Acoustic cell separation techniques and processes
US20180344817A1 (en) * 2015-05-01 2018-12-06 Precision Biosciences, Inc. Precise deletion of chromosomal sequences in vivo and treatment of nucleotide repeat expansion disorders using engineered nucleases
WO2017079428A1 (en) 2015-11-04 2017-05-11 President And Fellows Of Harvard College Site specific germline modification
US11214789B2 (en) 2016-05-03 2022-01-04 Flodesign Sonics, Inc. Concentration and washing of particles with acoustics
CN117604022A (zh) 2016-08-17 2024-02-27 孟山都技术公司 通过操纵赤霉素代谢增加可收获产量的用于矮株型植物的方法和组合物
US10576167B2 (en) 2016-08-17 2020-03-03 Factor Bioscience Inc. Nucleic acid products and methods of administration thereof
ES2925644T3 (es) 2016-10-04 2022-10-19 Prec Biosciences Inc Dominios coestimuladores para su uso en células modificadas genéticamente
CN110168102A (zh) * 2016-11-15 2019-08-23 基因组影像公司 利用分子梳理监测经修饰的核酸酶诱导的基因编辑事件的方法
CN110582301A (zh) 2016-12-14 2019-12-17 利甘达尔股份有限公司 用于核酸和蛋白质有效负载递送的方法和组合物
WO2018162702A1 (en) 2017-03-10 2018-09-13 Institut National De La Sante Et De La Recherche Medicale (Inserm) Nuclease fusions for enhancing genome editing by homology-directed transgene integration
JP6901293B2 (ja) * 2017-03-15 2021-07-14 株式会社三共 遊技用装置
EP4029943A1 (en) 2017-05-08 2022-07-20 Precision Biosciences, Inc. Nucleic acid molecules encoding an engineered antigen receptor and an inhibitory nucleic acid molecule and methods of use thereof
IL313037A (en) 2017-05-25 2024-07-01 2Seventy Bio Inc Cblb endonuclease variants, compositions, and methods of use
US20200224194A1 (en) * 2017-09-20 2020-07-16 Helix Nanotechnologies, Inc. Expression systems that facilitate nucleic acid delivery and methods of use
US20200239544A1 (en) 2017-10-03 2020-07-30 Precision Biosciences, Inc. Modified epidermal growth factor receptor peptides for use in genetically-modified cells
EP4501408A3 (en) 2017-11-17 2025-04-09 Iovance Biotherapeutics, Inc. Til expansion from fine needle aspirates and small biopsies
EP3714041A1 (en) 2017-11-22 2020-09-30 Iovance Biotherapeutics, Inc. Expansion of peripheral blood lymphocytes (pbls) from peripheral blood
WO2019118921A1 (en) 2017-12-14 2019-06-20 Flodesign Sonics, Inc. Acoustic transducer drive and controller
MX2020008560A (es) 2018-02-15 2020-10-12 Monsanto Technology Llc Composiciones y metodos para mejorar los rendimientos de cultivos mediante el apilamiento de rasgos.
CN111954463A (zh) 2018-02-15 2020-11-17 孟山都技术公司 用于杂交玉米种子生产的改进方法
US20210130779A1 (en) 2018-04-27 2021-05-06 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
CN112352053A (zh) 2018-05-02 2021-02-09 塞勒克提斯公司 增加膳食纤维的工程化小麦
JP2021527409A (ja) 2018-06-14 2021-10-14 ブルーバード バイオ, インコーポレイテッド Cd79aキメラ抗原受容体
WO2020072059A1 (en) 2018-10-04 2020-04-09 Bluebird Bio, Inc. Cblb endonuclease variants, compositions, and methods of use
CA3118493A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Expansion of tils utilizing akt pathway inhibitors
TW202039830A (zh) 2018-11-05 2020-11-01 美商艾歐凡斯生物治療公司 用於製造腫瘤浸潤性淋巴細胞之方法及其在免疫療法中之用途
US20230039976A1 (en) 2018-11-05 2023-02-09 Iovance Biotherapeutics, Inc. Selection of improved tumor reactive t-cells
TW202039831A (zh) 2018-11-05 2020-11-01 美商艾歐凡斯生物治療公司 對抗pd-1抗體呈現難治性之非小細胞肺癌(nsclc)病患之治療
US12274205B2 (en) 2018-12-12 2025-04-15 Monsanto Technology Llc Delayed harvest of short stature corn plants
JP7710372B2 (ja) 2018-12-19 2025-07-18 アイオバンス バイオセラピューティクス,インコーポレイテッド 操作されたサイトカイン受容体対を使用して腫瘍浸潤リンパ球を拡大培養する方法及びその使用
US20220090047A1 (en) 2018-12-21 2022-03-24 Precision Biosciences, Inc. Genetic modification of the hydroxyacid oxidase 1 gene for treatment of primary hyperoxaluria
US20220133795A1 (en) 2019-03-01 2022-05-05 Iovance Biotherapeutics, Inc. Expansion of Tumor Infiltrating Lymphocytes From Liquid Tumors and Therapeutic Uses Thereof
JP7286796B2 (ja) 2019-04-03 2023-06-05 プレシジョン バイオサイエンシズ,インク. マイクロrna適合shrna(shrnamir)を含む遺伝子改変免疫細胞
WO2020206231A1 (en) 2019-04-05 2020-10-08 Precision Biosciences, Inc. Methods of preparing populations of genetically-modified immune cells
US20220249559A1 (en) 2019-05-13 2022-08-11 Iovance Biotherapeutics, Inc. Methods and compositions for selecting tumor infiltrating lymphocytes and uses of the same in immunotherapy
JP7699552B2 (ja) 2019-07-03 2025-06-27 ファクター バイオサイエンス インコーポレイテッド カチオン性脂質及びその使用
EP4004216A1 (en) 2019-07-25 2022-06-01 Precision BioSciences, Inc. Compositions and methods for sequential stacking of nucleic acid sequences into a genomic locus
US10501404B1 (en) 2019-07-30 2019-12-10 Factor Bioscience Inc. Cationic lipids and transfection methods
AU2020333851A1 (en) 2019-08-20 2022-03-31 Precision Biosciences, Inc. Lymphodepletion dosing regimens for cellular immunotherapies
WO2021035170A1 (en) 2019-08-21 2021-02-25 Precision Biosciences, Inc. Compositions and methods for tcr reprogramming using fusion proteins
CA3146672A1 (en) * 2019-10-11 2021-04-15 Thaquoris PITT Increase in corn transformation efficacy by the n-terminus of a tale
JP2022553389A (ja) 2019-10-25 2022-12-22 アイオバンス バイオセラピューティクス,インコーポレイテッド 腫瘍浸潤リンパ球の遺伝子編集及び免疫療法におけるその使用
WO2021087305A1 (en) 2019-10-30 2021-05-06 Precision Biosciences, Inc. Cd20 chimeric antigen receptors and methods of use for immunotherapy
EP4069285A1 (en) 2019-12-06 2022-10-12 Precision BioSciences, Inc. Methods for cancer immunotherapy, using lymphodepletion regimens and cd19, cd20 or bcma allogeneic car t cells
US12516291B2 (en) 2019-12-11 2026-01-06 Iovance Biotherapeutics, Inc. Processes for the production of tumor infiltrating lymphocytes (TILs) and methods of using the same
WO2021158915A1 (en) 2020-02-06 2021-08-12 Precision Biosciences, Inc. Recombinant adeno-associated virus compositions and methods for producing and using the same
WO2021202513A1 (en) 2020-03-31 2021-10-07 Elo Life Systems Modulation of endogenous mogroside pathway genes in watermelon and other cucurbits
EP4146794A1 (en) 2020-05-04 2023-03-15 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
US20230183664A1 (en) 2020-05-11 2023-06-15 Precision Biosciences, Inc. Self-limiting viral vectors encoding nucleases
WO2022035793A1 (en) 2020-08-10 2022-02-17 Precision Biosciences, Inc. Antibodies and fragments specific for b-cell maturation antigen and uses thereof
WO2022076606A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
US20230372397A1 (en) 2020-10-06 2023-11-23 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2022076547A1 (en) 2020-10-07 2022-04-14 Precision Biosciences, Inc. Lipid nanoparticle compositions
US20240060079A1 (en) 2020-10-23 2024-02-22 Elo Life Systems Methods for producing vanilla plants with improved flavor and agronomic production
US12527250B2 (en) 2020-11-23 2026-01-20 Monsanto Technology Llc Methods for improved hybrid corn seed production
CA3202483A1 (en) 2020-12-17 2022-06-23 Maria Fardis Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors
US20240123067A1 (en) 2020-12-17 2024-04-18 Iovance Biotherapeutics, Inc. Treatment of cancers with tumor infiltrating lymphocyte therapies
WO2022165111A1 (en) 2021-01-28 2022-08-04 Precision Biosciences, Inc. Modulation of tgf beta signaling in genetically-modified eukaryotic cells
TW202241508A (zh) 2021-01-29 2022-11-01 美商艾歐凡斯生物治療公司 細胞介素相關之腫瘤浸潤性淋巴球組合物及方法
WO2022198141A1 (en) 2021-03-19 2022-09-22 Iovance Biotherapeutics, Inc. Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd69 selection and gene knockout in tils
AR125199A1 (es) 2021-03-23 2023-06-21 Iovance Biotherapeutics Inc Edición génica cish de linfocitos infiltrantes de tumores y usos de los mismos en inmunoterapia
AU2022246174A1 (en) 2021-03-25 2023-09-14 Iovance Biotherapeutics, Inc. Methods and compositions for t-cell coculture potency assays and use with cell therapy products
EP4326287A2 (en) 2021-04-19 2024-02-28 Iovance Biotherapeutics, Inc. Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies
WO2022226316A1 (en) 2021-04-22 2022-10-27 Precision Biosciences, Inc. Compositions and methods for generating male sterile plants
WO2022245754A1 (en) 2021-05-17 2022-11-24 Iovance Biotherapeutics, Inc. Pd-1 gene-edited tumor infiltrating lymphocytes and uses of same in immunotherapy
US20240365776A1 (en) 2021-07-22 2024-11-07 Iovance Biotherapeutics, Inc Method for cryopreservation of solid tumor fragments
US20240342285A1 (en) 2021-07-28 2024-10-17 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors
IL311333A (en) 2021-09-09 2024-05-01 Iovance Biotherapeutics Inc Processes for generating til products using pd-1 talen knockdown
WO2023064872A1 (en) 2021-10-14 2023-04-20 Precision Biosciences, Inc. Combinations of anti-bcma car t cells and gamma secretase inhibitors
EP4419111A1 (en) 2021-10-19 2024-08-28 Precision Biosciences, Inc. Gene editing methods for treating alpha-1 antitrypsin (aat) deficiency
CN113980141B (zh) * 2021-10-27 2022-11-29 湖北大学 基于大肠杆菌素e家族dna酶的蛋白质复合物及其在人工蛋白支架中的应用
WO2023077015A2 (en) 2021-10-27 2023-05-04 Iovance Biotherapeutics, Inc. Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy
US12577624B2 (en) 2021-11-02 2026-03-17 Monsanto Technology Llc Transgenic corn event ZM_BCS216090 and methods for detection and uses thereof
WO2023081767A1 (en) 2021-11-05 2023-05-11 Precision Biosciences, Inc. Methods for immunotherapy
EP4430206A1 (en) 2021-11-10 2024-09-18 Encodia, Inc. Methods for barcoding macromolecules in individual cells
US20250009800A1 (en) 2021-11-16 2025-01-09 Precision Biosciences, Inc. Methods for cancer immunotherapy
WO2023094435A1 (en) 2021-11-23 2023-06-01 Cellectis Sa New tale protein scaffolds with improved on-target/off-target activity ratios
EP4460334A1 (en) 2022-01-07 2024-11-13 Precision BioSciences, Inc. Optimized polynucleotides for protein expression
WO2023147488A1 (en) 2022-01-28 2023-08-03 Iovance Biotherapeutics, Inc. Cytokine associated tumor infiltrating lymphocytes compositions and methods
EP4504220A1 (en) 2022-04-06 2025-02-12 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
CA3248034A1 (en) 2022-04-15 2023-10-19 Iovance Biotherapeutics, Inc. METHODS FOR EXPANSION OF TIL CELLS BY MEANS OF SPECIFIC CYTOKINE COMBINATIONS AND/OR AKT INHIBITOR TREATMENT
EP4522202A1 (en) 2022-05-10 2025-03-19 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with an il-15r agonist
EP4583889A1 (en) 2022-09-09 2025-07-16 Iovance Biotherapeutics, Inc. Processes for generating til products using pd-1/tigit talen double knockdown
EP4583890A1 (en) 2022-09-09 2025-07-16 Iovance Biotherapeutics, Inc. Processes for generating til products using pd-1/tigit talen double knockdown
WO2024098027A1 (en) 2022-11-04 2024-05-10 Iovance Biotherapeutics, Inc. Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection
WO2024098024A1 (en) 2022-11-04 2024-05-10 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes from liquid tumors and therapeutic uses thereof
WO2024112711A2 (en) 2022-11-21 2024-05-30 Iovance Biotherapeutics, Inc. Methods for assessing proliferation potency of gene-edited t cells
EP4623072A2 (en) 2022-11-21 2025-10-01 Iovance Biotherapeutics, Inc. Two-dimensional processes for the expansion of tumor infiltrating lymphocytes and therapies therefrom
WO2024118836A1 (en) 2022-11-30 2024-06-06 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes with shortened rep step
KR20260010765A (ko) 2023-04-14 2026-01-21 프리시젼 바이오사이언시스 인코포레이티드 근육-특이적 발현 카세트
WO2024216116A1 (en) 2023-04-14 2024-10-17 Precision Biosciences, Inc. Muscle-specific expression cassettes
WO2025054540A1 (en) 2023-09-08 2025-03-13 Iovance Biotherapeutics, Inc. Methods of gene-editing using programmable nucleases
WO2025101484A1 (en) 2023-11-06 2025-05-15 Iovance Biotherapeutics, Inc. Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies
CN117821413B (zh) * 2023-12-15 2024-12-27 湖北大学 一种高进行性Pfu DNA聚合酶及其制备方法和应用
WO2026046724A1 (en) 2024-08-30 2026-03-05 Cellectis Sa Tale protein scaffolds involving fusions of monopartite and bipartite nls

Citations (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US5006333A (en) 1987-08-03 1991-04-09 Ddi Pharmaceuticals, Inc. Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols
WO2003078619A1 (en) 2002-03-15 2003-09-25 Cellectis Hybrid and single chain meganucleases and use thereof
WO2004031346A2 (en) 2002-09-06 2004-04-15 Fred Hutchinson Cancer Research Center Methods and compositions concerning designed highly-specific nucleic acid binding proteins
WO2004067736A2 (en) 2003-01-28 2004-08-12 Cellectis Custom-made meganuclease and use thereof
WO2006097784A1 (en) 2005-03-15 2006-09-21 Cellectis I-crei meganuclease variants with modified specificity, method of preparation and uses thereof
WO2006097853A1 (en) 2005-03-15 2006-09-21 Cellectis I-crei meganuclease variants with modified specificity, method of preparation and uses thereof
WO2007034262A1 (en) 2005-09-19 2007-03-29 Cellectis Heterodimeric meganucleases and use thereof
WO2007049156A2 (en) 2005-10-25 2007-05-03 Cellectis I-CreI HOMING ENDONUCLEASE VARIANTS HAVING NOVEL CLEAVAGE SPECIFICITY AND USE THEREOF
WO2007049095A1 (en) 2005-10-25 2007-05-03 Cellectis Laglidadg homing endonuclease variants having mutations in two functional subdomains and use thereof
WO2007093918A2 (en) 2006-02-13 2007-08-23 Cellectis Meganuclease variants cleaving a dna target sequence from a xeroderma pigmentosum gene and uses thereof
WO2008010093A2 (en) 2006-07-18 2008-01-24 Cellectis Meganuclease variants cleaving a dna target sequence from a rag gene and uses thereof
WO2008059382A2 (en) 2006-11-14 2008-05-22 Cellectis Meganuclease variants cleaving a dna target sequence from the hprt gene and uses thereof
WO2008093249A2 (en) 2007-02-01 2008-08-07 Cellectis Obligate heterodimer meganucleases and uses thereof
WO2008102274A2 (en) 2007-02-20 2008-08-28 Cellectis Meganuclease variants cleaving a dna target sequence from the beta-2-microglobulin gene and uses thereof
WO2008152523A1 (en) 2007-06-06 2008-12-18 Cellectis Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof
WO2009013622A2 (en) 2007-07-23 2009-01-29 Cellectis Meganuclease variants cleaving a dna target sequence from the human hemoglobin beta gene and uses thereof
WO2009019614A2 (en) 2007-08-03 2009-02-12 Cellectis Meganuclease variants cleaving a dna target sequence from the human interleukin-2 receptor gamma chain gene and uses thereof
WO2009095793A1 (en) 2008-01-31 2009-08-06 Cellectis New i-crei derived single-chain meganuclease and uses thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2206723A1 (en) * 2009-01-12 2010-07-14 Bonas, Ulla Modular DNA-binding domains
US8956828B2 (en) * 2009-11-10 2015-02-17 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
WO2011064751A1 (en) * 2009-11-27 2011-06-03 Basf Plant Science Company Gmbh Chimeric endonucleases and uses thereof
HUE041436T2 (hu) * 2009-12-10 2019-05-28 Univ Minnesota Tal-effektor-közvetített DNS-módosítás
AU2011219716A1 (en) * 2010-02-26 2012-09-27 Cellectis Use of endonucleases for inserting transgenes into safe harbor loci
JP6208580B2 (ja) * 2010-05-17 2017-10-04 サンガモ セラピューティクス, インコーポレイテッド 新規のdna結合タンパク質及びその使用
EP2633040B1 (en) * 2010-10-27 2019-07-10 Cellectis Method for increasing the efficiency of double-strand break-induced mutagenesis
US9499592B2 (en) * 2011-01-26 2016-11-22 President And Fellows Of Harvard College Transcription activator-like effectors
WO2012118717A2 (en) * 2011-02-28 2012-09-07 Seattle Children's Research Institute Coupling endonucleases with end-processing enzymes drive high efficiency gene disruption
US10000746B2 (en) * 2013-05-31 2018-06-19 Cellectis LAGLIDADG homing endonuclease cleaving the T cell receptor alpha gene and uses thereof

Patent Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US5006333A (en) 1987-08-03 1991-04-09 Ddi Pharmaceuticals, Inc. Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols
WO2003078619A1 (en) 2002-03-15 2003-09-25 Cellectis Hybrid and single chain meganucleases and use thereof
WO2004031346A2 (en) 2002-09-06 2004-04-15 Fred Hutchinson Cancer Research Center Methods and compositions concerning designed highly-specific nucleic acid binding proteins
WO2004067736A2 (en) 2003-01-28 2004-08-12 Cellectis Custom-made meganuclease and use thereof
WO2006097784A1 (en) 2005-03-15 2006-09-21 Cellectis I-crei meganuclease variants with modified specificity, method of preparation and uses thereof
WO2006097853A1 (en) 2005-03-15 2006-09-21 Cellectis I-crei meganuclease variants with modified specificity, method of preparation and uses thereof
WO2006097854A1 (en) 2005-03-15 2006-09-21 Cellectis Heterodimeric meganucleases and use thereof
WO2007034262A1 (en) 2005-09-19 2007-03-29 Cellectis Heterodimeric meganucleases and use thereof
WO2007049156A2 (en) 2005-10-25 2007-05-03 Cellectis I-CreI HOMING ENDONUCLEASE VARIANTS HAVING NOVEL CLEAVAGE SPECIFICITY AND USE THEREOF
WO2007049095A1 (en) 2005-10-25 2007-05-03 Cellectis Laglidadg homing endonuclease variants having mutations in two functional subdomains and use thereof
WO2007057781A2 (en) 2005-10-25 2007-05-24 Cellectis Laglidadg homing endonuclease variants having mutations in two functional subdomains and use thereof.
WO2007060495A1 (en) 2005-10-25 2007-05-31 Cellectis I-crei homing endonuclease variants having novel cleavage specificity and use thereof
WO2007093918A2 (en) 2006-02-13 2007-08-23 Cellectis Meganuclease variants cleaving a dna target sequence from a xeroderma pigmentosum gene and uses thereof
WO2008010093A2 (en) 2006-07-18 2008-01-24 Cellectis Meganuclease variants cleaving a dna target sequence from a rag gene and uses thereof
WO2008059382A2 (en) 2006-11-14 2008-05-22 Cellectis Meganuclease variants cleaving a dna target sequence from the hprt gene and uses thereof
WO2008093249A2 (en) 2007-02-01 2008-08-07 Cellectis Obligate heterodimer meganucleases and uses thereof
WO2008102274A2 (en) 2007-02-20 2008-08-28 Cellectis Meganuclease variants cleaving a dna target sequence from the beta-2-microglobulin gene and uses thereof
WO2008152523A1 (en) 2007-06-06 2008-12-18 Cellectis Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof
WO2009013622A2 (en) 2007-07-23 2009-01-29 Cellectis Meganuclease variants cleaving a dna target sequence from the human hemoglobin beta gene and uses thereof
WO2009019614A2 (en) 2007-08-03 2009-02-12 Cellectis Meganuclease variants cleaving a dna target sequence from the human interleukin-2 receptor gamma chain gene and uses thereof
WO2009095793A1 (en) 2008-01-31 2009-08-06 Cellectis New i-crei derived single-chain meganuclease and uses thereof

Non-Patent Citations (157)

* Cited by examiner, † Cited by third party
Title
"Immobilized Cells And Enzymes", 1986, IRL PRESS
"Manipulating the Mouse Embryo", 1986, COLD SPRING HARBOR LABORATORY PRESS
"Methods In ENZYMOLOGY", vol. 154, 155, ACADEMIC PRESS, INC.
ARIMONDO, P. B.; C. J. THOMAS ET AL.: "Exploring the cellular activity of camptothecin-triple- helix-forming oligonucleotide conjugates", MOL CELL BIOL, vol. 26, no. 1, 2006, pages 324 - 33, XP055108516, DOI: doi:10.1128/MCB.26.1.324-333.2006
ARNOULD, S.; C. PEREZ ET AL.: "Engineered I-Crel derivatives cleaving sequences from the human XPC gene can induce highly efficient gene correction in mammalian cells", JOURNAL OF MOLECULAR BIOLOGY, vol. 371, no. 1, 2007, pages 49 - 65, XP022145891, DOI: doi:10.1016/j.jmb.2007.04.079
ARNOULD, S.; P. CHAMES ET AL.: "Engineering of large numbers of highly specific homing endonucleases that induce recombination on novel DNA targets", J MOL BIOL, vol. 355, no. 3, 2006, pages 443 - 58, XP024950505, DOI: doi:10.1016/j.jmb.2005.10.065
ARNOULD, S.; P. CHAMES ET AL.: "Engineering of large numbers of highly specific homing endonucleases that induce recombination on novel DNA targets", JOURNAL OF MOLECULAR BIOLOGY, vol. 355, 2006, pages 443 - 58, XP024950505, DOI: doi:10.1016/j.jmb.2005.10.065
ASHWORTH, J.; J. J. HAVRANEK ET AL.: "Computational redesign of endonuclease DNA binding and cleavage specificity", NATURE, vol. 441, no. 7093, 2006, pages 656 - 9, XP002500320, DOI: doi:10.1038/nature04818
B. D. HARRIES & S. J. HIGGINS: "Nucleic Acid Hybridization", 1984
B. D. HARRIES & S. J. HIGGINS: "Transcription And Translation", 1984
B. PERBAL: "A Practical Guide To Molecular Cloning", 1984
BENNARDO, N.; A. CHENG ET AL.: "Alternative-NHEJ is a mechanistically distinct pathway of mammalian chromosome break repair", PLOS GENET, vol. 4, no. 6, 2008, pages E1000110, XP002680904, DOI: doi:10.1371/JOURNAL.PGEN.1000110
BENNARDO, N.; A. GUNN ET AL.: "Limiting the persistence of a chromosome break diminishes its mutagenic potential", PLOS GENET, vol. 5, no. 10, 2009, pages E1000683, XP002683881, DOI: doi:10.1371/JOURNAL.PGEN.1000683
BIOTECHNOLOGY AND BIOENGINEERING, vol. 105, no. 2, pages 330 - 40
BIOTECHNOLOGY AND BIOENGINEERING, vol. 106, no. 1, pages 97 - 105
BOCH, J.; H. SCHOLZE ET AL.: "Breaking the code of DNA binding specificity of TAL-type III effectors", SCIENCE, vol. 326, no. S9S9, 2009, pages 1509 - 12, XP055250971, DOI: doi:10.1126/science.1178811
BOLDUC, J. M.; P. C. SPIEGEL ET AL.: "Structural and biochemical analyses of DNA and RNA binding by a bifunctional homing endonuclease and group I intron splicing factor", GENES DEV, vol. 17, no. 23, 2003, pages 2875 - 88
BUIS, J.; Y. WU ET AL.: "Mrell nuclease activity has essential roles in DNA repair and genomic stability distinct from ATM activation", CELL, vol. 135, no. 1, 2008, pages 85 - 96
CAPECCHI, M. R.: "Generating mice with targeted mutations 10.1038/nm1001-1086 nm1001-1086 [pii", NATURE MEDICINE, vol. 7, no. 10, 2001, pages 1086 - 90
CARROLL, D.: "Progress and prospects: zinc-finger nucleases as gene therapy agents gt2008145 [pii] 10.1038/gt.2008.145", GENE THERAPY, vol. 15, no. 22, 2008, pages 1463 - 8
CELL CYCLE, vol. 7, no. 1, pages 33 - 8
CELL, vol. 95, no. 7, pages 891 - 902
CELLULAR AND MOLECULAR LIFE SCIENCES: CMLS, vol. 67, no. 5, pages 727 - 48
CHAMES, P.; J. C. EPINAT ET AL.: "In vivo selection of engineered homing endonucleases using double-strand break induced homologous recombination", NUCLEIC ACIDS RES, vol. 33, no. 20, 2005, pages E178, XP002378874
CHAMES, P.; J. C. EPINAT ET AL.: "In vivo selection of engineered homing endonucleases using double-strand break induced homologous recombination", NUCLEIC ACIDS RESEARCH, vol. 33, no. 20, 2005, pages E178, XP002378874
CHEVALIER, B. S.; B. L. STODDARD: "Homing endonucleases: structural and functional insight into the catalysts of intron/intein mobility", NUCLEIC ACIDS RES, vol. 29, no. 18, 2001, pages 3757 - 74, XP002383228, DOI: doi:10.1093/nar/29.18.3757
CHEVALIER, B. S.; R. J. MONNAT, JR. ET AL.: "The homing endonuclease I-Crel uses three metals, one of which is shared between the two active sites", NAT STRUCT BIOI, vol. 8, no. 4, 2001, pages 312 - 6, XP008015664, DOI: doi:10.1038/86181
CHEVALIER, B. S.; T. KORTEMME ET AL.: "Design, activity, and structure of a highly specific artificial endonuclease", MOL CELL, vol. 10, no. 4, 2002, pages 895 - 905, XP002248750, DOI: doi:10.1016/S1097-2765(02)00690-1
CHEVALIER, B.; M. TURMEL ET AL.: "Flexible DNA target site recognition by divergent homing endonuclease isoschizomers I-Crel and I-Msol", J MOL BIOL, vol. 329, no. 2, 2003, pages 253 - 69
CHOO, Y.; A. KLUG: "Selection of DNA binding sites for zinc fingers using rationally randomized DNA reveals coded interactions", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 91, no. 23, 1994, pages 11168 - 72, XP002075339, DOI: doi:10.1073/pnas.91.23.11168
CHOO, Y.; A. KLUG: "Toward a code for the interactions of zinc fingers with DNA: selection of randomized fingers displayed on phage", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 91, no. 23, 1994, pages 11163 - 7, XP002075340, DOI: doi:10.1073/pnas.91.23.11163
CHOULIKA, A.; A. PERRIN ET AL.: "Induction of homologous recombination in mammalian chromosomes by using the I-Scel system of Saccharomyces cerevisiae", MOL CELL BIOL, vol. 15, no. 4, 1995, pages 1968 - 73, XP000572150
CHRISTIAN, M.; T. CERMAK ET AL.: "Targeting DNA double-strand breaks with TAL effector nucleases", GENETICS, vol. 186, no. 2, 2010, pages 757 - 61, XP002632806, DOI: doi:10.1534/GENETICS.110.120717
COFFIN, J. M. ET AL.: "Fundamental Virology, Third Edition,", 1996, LIPPINCOTT-RAVEN PUBLISHERS, article "Retroviridae: The viruses and their replication"
D. GOEDDEL,: "Gene Expression Technology", vol. 185
D. M. WEIR AND C. C. BLACKWELL,: "Handbook Of Experimental Immunology", vol. I-IV, 1986
DOYON, J. B.; V. PATTANAYAK ET AL.: "Directed evolution and substrate specificity profile of homing endonuclease I-Scel", J AM CHEM SOC, vol. 128, no. 7, 2006, pages 2477 - 84, XP002611223, DOI: doi:10.1021/JA0575191
EASTBERG, J. H.; J. EKLUND ET AL.: "Mutability of an HNH nuclease imidazole general base and exchange of a deprotonation mechanism", BIOCHEMISTRY, vol. 46, no. 24, 2007, pages 7215 - 25
EISENSCHMIDT, K.; T. LANIO ET AL.: "Developing a programmed restriction endonuclease for highly specific DNA cleavage", NUCLEIC ACIDS RES, vol. 33, no. 22, 2005, pages 7039 - 47, XP002383230, DOI: doi:10.1093/nar/gki1009
ELROD-ERICKSON, M.; M. A. ROULD ET AL.: "Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions", STRUCTURE, vol. 4, no. 10, 1996, pages 1171 - 80
EPINAT, J. C.; S. ARNOULD ET AL.: "A novel engineered meganuclease induces homologous recombination in yeast and mammalian cells", NUCLEIC ACIDS RES, vol. 31, no. 11, 2003, pages 2952 - 62
EPINAT, J. C.; S. ARNOULD ET AL.: "A novel engineered meganuclease induces homologous recombination in yeast and mammalian cells", NUCLEIC ACIDS RESEARCH, vol. 31, no. 11, 2003, pages 2952 - 62
EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 40, no. 10, pages 2932 - 41
EXPERT OPINION ON BIOLOGICAL THERAPY, vol. 9, no. 10, pages 1289 - 303
FREDERICK M. AUSUBEL: "Current Protocols in Molecular Biology", 2000, WILEY AND SON INC
FRONTIERS IN BIOSCIENCE : A JOURNAL AND VIRTUAL LIBRARY, vol. 13, pages 2989 - 99
GENETICS, vol. 186, no. 2, pages 757 - 61
GENOME RESEARCH, vol. 19, no. 7, pages 1279 - 88
GIMBLE, F. S.; C. M. MOURE ET AL.: "Assessing the plasticity of DNA target site recognition of the PI-Scel homing endonuclease using a bacterial two-hybrid selection system", J MOL BIOL, vol. 334, no. 5, 2003, pages 993 - 1008
GREISMAN, H. A.; C. O. PABO: "A general strategy for selecting high-affinity zinc finger proteins for diverse DNA target sites", SCIENCE, vol. 275, no. 5300, 1997, pages 657 - 61, XP002167950, DOI: doi:10.1126/science.275.5300.657
GUIROUILH-BARBAT, J.; E. RASS ET AL.: "Defects in XRCC4 and KU80 differentially affect the joining of distal nonhomologous ends", PROC NATL ACAD SCI U S A, vol. 104, no. 52, 2007, pages 20902 - 7
GUIROUILH-BARBAT, J.; S. HUCK ET AL.: "Impact of the KU80 pathway on NHEJ-induced genome rearrangements in mammalian cells", MOL CELL, vol. 14, no. 5, 2004, pages 611 - 23
HABER, J.: "Partners and pathwaysrepairing a double-strand break", TRENDS GENET., vol. 16, no. 6, 2000, pages 259 - 264, XP004200111, DOI: doi:10.1016/S0168-9525(00)02022-9
HARTSUIKER, E.; K. MIZUNO ET AL.: "Ctp1CtIP and Rad32Mrell nuclease activity are required for Recl2Spoll removal, but Recl2Spoll removal is dispensable for other MRN-dependent meiotic functions", MOL CELL BIOL, vol. 29, no. 7, 2009, pages 1671 - 81
HINNEN, A.; J. B. HICKS ET AL.: "Transformation of yeast", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 75, no. 4, 1978, pages 1929 - 33, XP002336016, DOI: doi:10.1073/pnas.75.4.1929
ICHIYANAGI, K.; Y. ISHINO ET AL.: "Crystal structure of an archaeal intein-encoded homing endonuclease PI-Pful", J MOL BIOL, vol. 300, no. 4, 2000, pages 889 - 901
J. H. MILLER AND M. P. CALOS: "Gene Transfer Vectors For Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY
JOURNAL OF MOLECULAR BIOLOGY, vol. 368, no. 3, pages 812 - 21
JOURNAL OF MOLECULAR BIOLOGY, vol. 382, no. 1, pages 188 - 202
JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 128, no. 7, pages 2477 - 84
JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 131, no. 47, pages 17345 - 53
KIM, Y. G.; J. CHA ET AL.: "Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 93, no. 3, 1996, pages 1156 - 60, XP002116423, DOI: doi:10.1073/pnas.93.3.1156
KU, W. Y.; Y. W. LIU ET AL.: "The zinc ion in the HNH motif of the endonuclease domain of colicin E7 is not required for DNA binding but is essential for DNA hydrolysis", NUCLEIC ACIDS RESEARCH, vol. 30, no. 7, 2002, pages 1670 - 8
LANDTHALER, M.; B. W. SHEN ET AL.: "I-Basi and I-Hmul: two phage intron-encoded endonucleases with homologous DNA recognition sequences but distinct DNA specificities", JOURNAL OF MOLECULAR BIOLOGY, vol. 358, no. 4, 2006, pages 1137 - 51
LANDTHALER, M.; D. A. SHUB: "The nicking homing endonuclease I-Basl is encoded by a group I intron in the DNA polymerase gene of the Bacillus thuringiensis phage Bastille", NUCLEIC ACIDS RESEARCH, vol. 31, no. 12, 2003, pages 3071 - 7
LANDTHALER, M.; N. C. LAU ET AL.: "Group I intron homing in Bacillus phages SP01 and SP82: a gene conversion event initiated by a nicking homing endonuclease", JOURNAL OF BACTERIOLOGY, vol. 186, no. 13, 2004, pages 4307 - 14
LANDTHALER, M.; U. BEGLEY ET AL.: "Two self-splicing group I introns in the ribonucleotide reductase large subunit gene of Staphylococcus aureus phage Twort", NUCLEIC ACIDS RESEARCH, vol. 30, no. 9, 2002, pages 1935 - 43
LEE, S. E.; F. PAQUES ET AL.: "Role of yeast SIR genes and mating type in directing DNA double-strand breaks to homologous and non-homologous repair paths", CURR BIOL, vol. 9, no. 14, 1999, pages 767 - 70
LI, T.; S. HUANG ET AL.: "TAL nucleases (TALNs): hybrid proteins composed of TAL effectors and Fokl DNA-cleavage domain", NUCLEIC ACIDS RES, vol. 39, no. 1, 2010, pages 359 - 72
LIANG, F.; M. HAN ET AL.: "Homology-directed repair is a major double-strand break repair pathway in mammalian cells", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 95, no. 9, 1998, pages 5172 - 7, XP055024260, DOI: doi:10.1073/pnas.95.9.5172
LIU, Q.; J. T. DANSEREAU ET AL.: "Role of the interdomain linker in distance determination for remote cleavage by homing endonuclease I-Tevl.", J MOL BIOL, vol. 379, no. 5, 2008, pages 1094 - 106, XP022697734, DOI: doi:10.1016/j.jmb.2008.04.047
LIU, Q.; V. DERBYSHIRE ET AL.: "Distance determination by GIY-YIG intron endonucleases: discrimination between repression and cleavage functions", NUCLEIC ACIDS RESEARCH, vol. 34, no. 6, 2006, pages 1755 - 64, XP002691037, DOI: doi:10.1093/nar/gkl079
LLOYD, A.; C. L. PLAISIER ET AL.: "Targeted mutagenesis using zinc-finger nucleases in Arabidopsis 0409339102 [pii] 10.1073/pnas.0409339102", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 102, no. 6, 2005, pages 2232 - 7
M. J. GAIT: "Oligonucleotide Synthesis", 1984
MAYER AND WALKER,: "Immunochemical Methods In Cell And Molecular Biology", 1987, ACADEMIC PRESS
METHODS IN ENZYMOLOGY, vol. 340, pages 593 - 609
MILLER, J. C.; S. TAN: "A TALE nuclease architecture for efficient genome editing nbt.1755 [pii] 10.1038/nbt.1755", NATURE BIOTECHNOLOGY, vol. 29, no. 2, 2011, pages 143 - 8
MIMITOU, E. P.; L. S. SYMINGTON: "Sae2, Exol and Sgsl collaborate in DNA double-strand break processing", NATURE, vol. 455, no. 7214, 2008, pages 770 - 4
MOLECULAR CELL, vol. 14, no. 5, pages 611 - 23
MOLECULAR CELL, vol. 31, no. 2, pages 294 - 301
MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 3, no. 4, pages 526 - 30
MOORE, I.; M. SAMALOVA ET AL.: "Transactivated and chemically inducible gene expression in plants", PLANT, vol. 145, no. 4, 2006, pages 651 - 83, XP002716440, DOI: doi:10.1111/J.1365-313X.2006.02660.X
MOORE, J. K.; J. E. HABER: "Cell cycle and genetic requirements of two pathways of nonhomologous end-joining repair of double-strand breaks in Saccharomyces cerevisiae", MOL CELL BIOL, vol. 16, no. 5, 1996, pages 2164 - 73, XP055092963, DOI: doi:10.1128/MCB.16.5.2164
MOSCOU, M. J.; A. J. BOGDANOVE: "A simple cipher governs DNA recognition by TAL effectors", SCIENCE, vol. 326, no. 5959, 2009, pages 1501, XP002599998
MOURE, C. M.; F. S. GIMBLE ET AL.: "Crystal structure of the intein homing endonuclease PI-Scel bound to its recognition sequence", NAT STRUCT BIOL, vol. 9, no. 10, 2002, pages 764 - 70
MOURE, C. M.; F. S. GIMBLE ET AL.: "The crystal structure of the gene targeting homing endonuclease I-Scel reveals the origins of its target site specificity", J MOL BIOL, vol. 334, no. 4, 2003, pages 685 - 95, XP004473365, DOI: doi:10.1016/j.jmb.2003.09.068
NATURE BIOTECHNOLOGY, vol. 20, no. 7, pages 735 - 8
NATURE BIOTECHNOLOGY, vol. 26, no. 6, pages 702 - 8
NATURE BIOTECHNOLOGY, vol. 26, no. 7, pages 808 - 16
NATURE METHODS, vol. 5, no. 5, pages 374 - 5
NATURE, vol. 396, no. 6707, pages 173 - 7
NATURE, vol. 459, no. 7245, pages 437 - 41
NIMONKAR, A. V.; J. GENSCHEL ET AL.: "BLM-DNA2-RPA-MRN and EX01-BLM-RPA-MRN constitute two DNA end resection machineries for human DNA break repair", GENES DEV, vol. 25, no. 4, 2011, pages 350 - 62
NUCLEIC ACIDS RESEARCH, vol. 27, no. 2, pages 674 - 81
NUCLEIC ACIDS RESEARCH, vol. 39, no. 1, pages 359 - 72
NUCLEIC ACIDS RESEARCH, vol. 39, no. 2, pages 623 - 34
NUCLEIC ACIDS RESEARCH, vol. 39, no. 3, pages 926 - 35
NUCLEIC ACIDS RESEARCH, vol. 39, pages 1 - 18
OLIGONUCLEOTIDES, vol. 20, no. 1, pages 7 - 16
ORR-WEAVER, T. L.; J. W. SZOSTAK ET AL.: "Genetic applications of yeast transformation with linear and gapped plasmids", METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 228 - 45
ORR-WEAVER, T. L.; J. W. SZOSTAK ET AL.: "Yeast transformation: a model system for the study of recombination", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 78, no. 10, 1981, pages 6354 - 8
PABO, C. 0.; E. PEISACH ET AL.: "Design and selection of novel Cys2His2 zinc finger proteins 70/1/313 [pii] 10.1146/annurev.biochem.70.1.313", ANNUAL REVIEW OF BIOCHEMISTRY, vol. 70, 2001, pages 313 - 40
PADIDAM, M.: "Chemically regulated gene expression in plants", CURR OPIN PLANT BIOL, vol. 6, no. 2, 2003, pages 169 - 77, XP002559217, DOI: doi:10.1016/S1369-5266(03)00005-0
PAQUES, F.; J. E. HABER: "Multiple pathways of recombination induced by double-strand breaks in Saccharomyces cerevisiae", MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS : MMBR, vol. 63, no. 2, 1999, pages 349 - 404, XP055460644
PAQUES, F.; P. DUCHATEAU: "Meganucleases and DNA double-strand break-induced recombination: perspectives for gene therapy", CURR GENE THER, vol. 7, no. 1, 2007, pages 49 - 66, XP002493370, DOI: doi:10.2174/156652307779940216
PAQUES, F.; P. DUCHATEAU: "Meganucleases and DNA double-strand break-induced recombination: perspectives for gene therapy", CURRENT GENE THERAPY, vol. 7, no. 1, 2007, pages 49 - 66, XP002493370, DOI: doi:10.2174/156652307779940216
PI OS ONE, vol. 5, no. 1, pages E8870
PIERCE, A. J.; P. HU ET AL.: "Ku DNA end-binding protein modulates homologous repair of double-strand breaks in mammalian cells", GENES DEV, vol. 15, no. 24, 2001, pages 3237 - 42
PINGOUD, A.; G. H. SILVA: "Precision genome surgery", NAT BIOTECHNOL, vol. 25, no. 7, 2007, pages 743 - 4, XP002657044, DOI: doi:10.1038/nbt0707-743
PLANT MOLECULAR BIOLOGY, vol. 70, no. 6, pages 669 - 79
PORTEUS, M. H.; D. CARROLL: "Gene targeting using zinc finger nucleases", NAT BIOTECHNOL, vol. 23, no. 8, 2005, pages 967 - 73, XP002467422, DOI: doi:10.1038/nbt1125
POTENZA C ET AL., IN VITRO CELL DEV BIOL, vol. 40, 2004, pages 1 - 22
PROCEED INGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 105, no. 15, pages 5809 - 14
PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 104, no. 52, pages 20902 - 7
PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 105, no. 2, pages 405 - 6
PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 106, no. 13, pages 5099 - 104
PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 108, no. 6, pages 2623 - 8
PROTEIN ENGINEERING, DESIGN & SELECTION : PEDS, vol. 24, no. 1-2, pages 27 - 31
PROTEIN SCIENCE : A PUBLICATION OF THE PROTEIN SOCIETY, vol. 15, no. 2, pages 269 - 80
R. I. FRESHNEY: "Culture Of Animal Cells", 1987, ALAN R. LISS, INC.
ROSEN, L. E.; H. A. MORRISON ET AL.: "Homing endonuclease I-Crel derivatives with novel DNA target specificities", NUCLEIC ACIDS RES., 2006
ROSEN, L. E.; H. A. MORRISON ET AL.: "Homing endonuclease I-Crel derivatives with novel DNA target specificities", NUCLEIC ACIDS RESEARCH, vol. 34, no. 17, 2006, pages 4791 - 800
ROTHSTEIN, R. J.: "One-step gene disruption in yeast", METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 202 - 11, XP009084053, DOI: doi:10.1016/0076-6879(83)01015-0
ROUET, P.; F. SMIH ET AL.: "Expression of a site-specific endonuclease stimulates homologous recombination in mammalian cells", PROC NATL ACAD SCI U S A, vol. 91, no. 13, 1994, pages 6064 - 8, XP002005205, DOI: doi:10.1073/pnas.91.13.6064
ROUET, P.; F. SMIH ET AL.: "Introduction of double-strand breaks into the genome of mouse cells by expression of a rare-cutting endonuclease", MOL CELL BIOL, vol. 14, no. 12, 1994, pages 8096 - 106
RUSSELL, D. W.; R. K. HIRATA: "Human gene targeting by viral vectors 10.1038/ng0498-325", NATURE GENETICS, vol. 18, no. 4, pages 325 - 30, XP001105541, DOI: doi:10.1038/ng0498-325
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, Third Edition,", 2001, COLD SPRING HARBOR LABORATORY PRESS
SARTORI, A. A.; C. LUKAS ET AL.: "Human CtIP promotes DNA end resection", NATURE, vol. 450, no. 7169, 2007, pages 509 - 14
SCIENCE, vol. 325, no. 5939, pages 433
SCIENCE, vol. 326, no. 5959, pages 1501
SCIENCE, vol. 326, no. S9S9, pages 1509 - 12
SELIGMAN, L. M.; K. M. CHISHOLM ET AL.: "Mutations altering the cleavage specificity of a homing endonuclease", NUCLEIC ACIDS RESEARCH, vol. 30, no. 17, 2002, pages 3870 - 9, XP002282592, DOI: doi:10.1093/nar/gkf495
SELIGMAN, L. M.; K. M. STEPHENS ET AL.: "Genetic analysis of the Chlamydomonas reinhardtii I-Crel mobile intron homing system in Escherichia coli", GENETICS, vol. 147, no. 4, 1997, pages 1653 - 64, XP055039708
SHEN, B. W.; M. LANDTHALER ET AL.: "DNA binding and cleavage by the HNH homing endonuclease I-Hmul.", JOURNAL OF MOLECULAR BIOLOGY, vol. 342, no. 1, 2004, pages 43 - 56, XP004844890, DOI: doi:10.1016/j.jmb.2004.07.032
SILVA, G. H.; J. Z. DALGAARD ET AL.: "Crystal structure of the thermostable archaeal intron-encoded endonuclease I-Dmol", J MOL BIOL, vol. 286, no. 4, 1999, pages 1123 - 36, XP004462690, DOI: doi:10.1006/jmbi.1998.2519
SIMON, P.; F. CANNATA ET AL.: "Sequence-specific DNA cleavage mediated by bipyridine polyamide conjugates", NUCLEIC ACIDS RES, vol. 36, no. 11, 2008, pages 3531 - 8
SMITH, J.; M. BIBIKOVA ET AL.: "Requirements for double-strand cleavage by chimeric restriction enzymes with zinc finger DNA-recognition domains", NUCLEIC ACIDS RESEARCH, vol. 28, no. 17, 2000, pages 3361 - 9, XP002974228, DOI: doi:10.1093/nar/28.17.3361
SMITH, J.; S. GRIZOT ET AL.: "A combinatorial approach to create artificial homing endonucleases cleaving chosen sequences", NUCLEIC ACIDS RES, vol. 34, no. 22, 2006, pages E149, XP002559417, DOI: doi:10.1093/nar/gkl720
SMITH, J.; S. GRIZOT ET AL.: "A combinatorial approach to create artificial homing endonucleases cleaving chosen sequences", NUCLEIC ACIDS RESEARCH, vol. 34, no. 22, 2006, pages E149, XP002559417, DOI: doi:10.1093/nar/gkl720
SONODA, E.; H. HOCHEGGER ET AL.: "Differential usage of non-homologous end-joining and homologous recombination in double strand break repair", DNA REPAIR (AMST), vol. 5, no. 9-10, 2006, pages 1021 - 9, XP024977137, DOI: doi:10.1016/j.dnarep.2006.05.022
SPIEGEL, P. C.; B. CHEVALIER ET AL.: "The structure of I-Ceul homing endonuclease: Evolving asymmetric DNA recognition from a symmetric protein scaffold", STRUCTURE, vol. 14, no. 5, 2006, pages 869 - 80
STODDARD, B. L.: "Homing endonuclease structure and function", Q REV BIOPHYS, vol. 38, no. 1, 2005, pages 49 - 95, XP008065807, DOI: doi:10.1017/S0033583505004063
STODDARD, B. L.: "Homing endonuclease structure and function", QUARTERLY REVIEWS OF BIOPHYSICS, vol. 38, no. 1, 2005, pages 49 - 95, XP008065807, DOI: doi:10.1017/S0033583505004063
STODDARD, B. L.; A. M. SCHARENBERG ET AL.: "Progress in Gene Therapy: Autologous and Cancer Stem Cell Gene Therapy", vol. 3, 2007, WORLD SCIENTIFIC PUBLISHING CO. PTE. LTD., article "Advances in Engineering Homing Endonucleases for Gene Targeting: Ten Years After Structures", pages: 135 - 68
SUGAWARA, N.; J. E. HABER: "Characterization of double-strand break-induced recombination: homology requirements and single-stranded DNA formation", MOL CELL BIOL, vol. 12, no. 2, 1992, pages 563 - 75
SUN, H.; D. TRECO ET AL.: "Extensive 3'-overhanging, single-stranded DNA associated with the meiosis-specific double-strand breaks at the ARG4 recombination initiation site", CELL, vol. 64, no. 6, 1991, pages 1155 - 61, XP024245310, DOI: doi:10.1016/0092-8674(91)90270-9
SUSSMAN, D.; M. CHADSEY ET AL.: "Isolation and characterization of new homing endonuclease specificities at individual target site positions", J MOL BIOL, vol. 342, no. 1, 2004, pages 31 - 41, XP004844889, DOI: doi:10.1016/j.jmb.2004.07.031
SUSSMAN, D.; M. CHADSEY ET AL.: "Isolation and characterization of new homing endonuclease specificities at individual target site positions", JOURNAL OF MOLECULAR BIOLOGY, vol. 342, no. 1, 2004, pages 31 - 41, XP004844889, DOI: doi:10.1016/j.jmb.2004.07.031
TAUBES, G: "Gene therapy. The strange case of chimeraplasty 10.1126/science.298.5601.2116 298/5601/2116 [pii", SCIENCE, vol. 298, no. 5601, 2002, pages 2116 - 20
THE JOURNAL OF CLINICAL INVESTIGATION, vol. 112, no. 5, pages 637 - 41
THE PLANT IOURNAL : FOR CELL AND MOLECULAR BIOLOGY, vol. 42, no. 2, pages 175 - 87
THE PLANT IOURNAL : FOR CELL AND MOLECULAR BIOLOGY, vol. 61, no. 1, pages 176 - 87
TRENDS IN GENETICS: TIG, vol. 24, no. 11, pages 529 - 38
WANG, R.; X. ZHOU ET AL.: "Chemically regulated expression systems and their applications in transgenic plants", TRANSGENIC RES, vol. 12, no. 5, 2003, pages 529 - 40, XP002395660, DOI: doi:10.1023/A:1025852307127
WHITE, C. I.; J. E. HABER: "Intermediates of recombination during mating type switching in Saccharomyces cerevisiae", EMBO J, vol. 9, no. 3, 1990, pages 663 - 73
ZHAO, L.; R. P. BONOCORA ET AL.: "The restriction fold turns to the dark side: a bacterial homing endonuclease with a PD-(D/E)-XK motif", THE EMBO JOURNAL, vol. 26, no. 9, 2007, pages 2432 - 42
ZUO, J.; N. H. CHUA: "Chemical-inducible systems for regulated expression of plant genes", CURR OPIN BIOTECHNOL, vol. 11, no. 2, 2000, pages 146 - 51, XP001039646, DOI: doi:10.1016/S0958-1669(00)00073-2

Cited By (265)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12366009B2 (en) 2010-12-22 2025-07-22 President And Fellows Of Harvard College Continuous directed evolution
US11214792B2 (en) 2010-12-22 2022-01-04 President And Fellows Of Harvard College Continuous directed evolution
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10323236B2 (en) 2011-07-22 2019-06-18 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
EP2758537A4 (en) * 2011-09-23 2015-08-12 Univ Iowa State Res Found MONOERARY TECHNIQUE OF TAL NUCLEASE OR ZINC FINGERUCLEASE FOR DNA MODIFICATION
EP2776560A2 (en) 2011-11-07 2014-09-17 The University of Western Ontario Endonuclease for genome editing
US9688997B2 (en) 2011-12-29 2017-06-27 Iowa State University Research Foundation, Inc. Genetically modified plants with resistance to Xanthomonas and other bacterial plant pathogens
WO2013160230A1 (en) 2012-04-23 2013-10-31 Bayer Cropscience Nv Targeted genome engineering in plants
EP4541818A2 (en) 2012-05-25 2025-04-23 Cellectis Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
EP3964567A1 (en) 2012-05-25 2022-03-09 Cellectis Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
EP3279315A2 (en) 2012-05-25 2018-02-07 Cellectis Use of pre t alpha or functional variant thereof for expanding tcr alpha deficient t cells
EP3473707A1 (en) 2012-05-25 2019-04-24 Cellectis Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
EP3276000A2 (en) 2012-05-25 2018-01-31 Cellectis Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2013182910A3 (en) * 2012-06-05 2014-02-13 Cellectis Transcription activator-like effector (tale) fusion protein
US10815500B2 (en) 2012-06-05 2020-10-27 Cellectis Transcription activator-like effector (TALE) fusion protein
US11384360B2 (en) 2012-06-19 2022-07-12 Regents Of The University Of Minnesota Gene targeting in plants using DNA viruses
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
CN103668470A (zh) * 2012-09-12 2014-03-26 上海斯丹赛生物技术有限公司 一种dna文库及构建转录激活子样效应因子核酸酶质粒的方法
WO2014071006A1 (en) 2012-10-31 2014-05-08 Cellectis Coupling herbicide resistance with targeted insertion of transgenes in plants
WO2014076571A2 (en) 2012-11-16 2014-05-22 Cellectis Method for targeted modification of algae genomes
US10844361B2 (en) 2012-11-16 2020-11-24 Poseida Therapeutics, Inc. Site-specific enzymes and methods of use
WO2014102688A1 (en) 2012-12-27 2014-07-03 Cellectis New design matrix for improvement of homology-directed gene targeting
WO2014118719A1 (en) 2013-02-01 2014-08-07 Cellectis Tevl chimeric endonuclease and their preferential cleavage sites
US10738289B2 (en) 2013-02-01 2020-08-11 Cellectis Tevi chimeric endonuclease and their preferential cleavage sites
WO2014128659A1 (en) 2013-02-21 2014-08-28 Cellectis Method to counter-select cells or organisms by linking loci to nuclease components
CN105208866A (zh) * 2013-03-21 2015-12-30 桑格摩生物科学股份有限公司 使用工程化锌指蛋白核酸酶靶向断裂t细胞受体基因
US10918668B2 (en) 2013-03-21 2021-02-16 Sangamo Therapeutics, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
US9937207B2 (en) * 2013-03-21 2018-04-10 Sangamo Therapeutics, Inc. Targeted disruption of T cell receptor genes using talens
US20140301990A1 (en) * 2013-03-21 2014-10-09 Ospedale San Raffaele Srl Targeted disruption of t cell receptor genes using engineered zinc finger protein nucleases
WO2014161821A1 (en) 2013-04-02 2014-10-09 Bayer Cropscience Nv Targeted genome engineering in eukaryotes
CN105008536A (zh) * 2013-04-16 2015-10-28 深圳华大基因科技服务有限公司 分离的寡核苷酸及其用途
EP3936612A1 (en) 2013-05-13 2022-01-12 Cellectis Methods for engineering allogeneic and highly active t cell for immunotheraphy
EP3546572A1 (en) 2013-05-13 2019-10-02 Cellectis Cd19 specific chimeric antigen receptor and uses thereof
WO2014184744A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering highly active t cell for immunotherapy
EP4364809A2 (en) 2013-05-13 2024-05-08 Cellectis Cd19 specific chimeric antigen receptor and uses thereof
WO2014184741A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering allogeneic and highly active t cell for immunotheraphy
JP2016520319A (ja) * 2013-05-31 2016-07-14 セレクティスCellectis C−cケモカイン受容体5型(ccr5)遺伝子を開裂するlaglidadgホーミングエンドヌクレアーゼおよびその用途
JP2016520320A (ja) * 2013-05-31 2016-07-14 セレクティスCellectis T細胞受容体α遺伝子を開裂するLAGLIDADGホーミングエンドヌクレアーゼおよびその用途
JP2022130538A (ja) * 2013-06-14 2022-09-06 セレクティス 植物における非トランスジェニックのゲノム編集のための方法
JP2020018303A (ja) * 2013-06-14 2020-02-06 セレクティスCellectis 植物における非トランスジェニックのゲノム編集のための方法
JP2016523093A (ja) * 2013-06-25 2016-08-08 セレクティスCellectis バイオ燃料生産のための改変された珪藻
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US9163284B2 (en) 2013-08-09 2015-10-20 President And Fellows Of Harvard College Methods for identifying a target site of a Cas9 nuclease
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
JP2020011959A (ja) * 2013-08-22 2020-01-23 プレジデント アンド フェローズ オブ ハーバード カレッジ 操作された転写活性化因子様エフェクター(tale)ドメインおよびその使用
EP3699293A1 (en) * 2013-08-22 2020-08-26 President And Fellows Of Harvard College Engineered transcription activator-like effector (tale) domains and uses thereof
AU2014308713B2 (en) * 2013-08-22 2020-10-08 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
JP2016534116A (ja) * 2013-08-22 2016-11-04 プレジデント アンド フェローズ オブ ハーバード カレッジ 操作された転写活性化因子様エフェクター(tale)ドメインおよびその使用
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
JP7149599B2 (ja) 2013-08-22 2022-10-07 プレジデント アンド フェローズ オブ ハーバード カレッジ 操作された転写活性化因子様エフェクター(tale)ドメインおよびその使用
JP2022191242A (ja) * 2013-08-22 2022-12-27 プレジデント アンド フェローズ オブ ハーバード カレッジ 操作された転写活性化因子様エフェクター(tale)ドメインおよびその使用
WO2015027134A1 (en) * 2013-08-22 2015-02-26 President And Fellows Of Harvard College Engineered transcription activator-like effector (tale) domains and uses thereof
US10227581B2 (en) 2013-08-22 2019-03-12 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US9737604B2 (en) 2013-09-06 2017-08-22 President And Fellows Of Harvard College Use of cationic lipids to deliver CAS9
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9999671B2 (en) 2013-09-06 2018-06-19 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US12584118B2 (en) 2013-09-06 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9340799B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College MRNA-sensing switchable gRNAs
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US12559737B2 (en) 2013-09-06 2026-02-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US9340800B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College Extended DNA-sensing GRNAS
WO2015059265A1 (en) 2013-10-25 2015-04-30 Cellectis Design of rare-cutting endonucleases for efficient and specific targeting dna sequences comprising highly repetitive motives
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10640788B2 (en) 2013-11-07 2020-05-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAs
US11390887B2 (en) 2013-11-07 2022-07-19 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10190137B2 (en) 2013-11-07 2019-01-29 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US9840699B2 (en) 2013-12-12 2017-12-12 President And Fellows Of Harvard College Methods for nucleic acid editing
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
US12398390B2 (en) 2014-01-20 2025-08-26 President And Fellows Of Harvard College Negative selection and stringency modulation in continuous evolution systems
EP3505623A1 (en) 2014-02-14 2019-07-03 Cellectis Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells
WO2015121454A1 (en) 2014-02-14 2015-08-20 Cellectis Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells
US11820996B2 (en) 2014-03-11 2023-11-21 Cellectis Method for generating T-cells compatible for allogenic transplantation
EP4368705A2 (en) 2014-03-11 2024-05-15 Cellectis Method for generating t-cells compatible for allogenic transplantation
EP3693384A1 (en) 2014-03-11 2020-08-12 Cellectis Method for generating t-cells compatible for allogenic transplantation
EP3116902B1 (en) 2014-03-11 2020-01-01 Cellectis Method for generating t-cells compatible for allogenic transplantation
US12252699B2 (en) 2014-03-11 2025-03-18 Cellectis Method for generating t-cells compatible for allogenic transplantation
EP3569619A1 (en) 2014-03-19 2019-11-20 Cellectis Cd123 specific chimeric antigen receptors for cancer immunotherapy
US12171820B2 (en) 2014-04-11 2024-12-24 Cellectis Method for generating immune cells resistant to arginine and/or tryptophan depleted microenvironment
US10765728B2 (en) 2014-04-11 2020-09-08 Cellectis Method for generating immune cells resistant to arginine and/or tryptophan depleted microenvironment
EP3453406A1 (en) 2014-07-29 2019-03-13 Cellectis Ror1 (ntrkr1) specific chimeric antigen receptors for cancer immunotherapy
US10752684B2 (en) 2014-07-29 2020-08-25 Cellectis ROR1 (NTRKR1) specific chimeric antigen receptors for cancer immunotherapy
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10544201B2 (en) 2014-07-31 2020-01-28 Cellectis ROR1 specific multi-chain chimeric antigen receptor
US10759868B2 (en) 2014-09-04 2020-09-01 Cellectis Trophoblast glycoprotein (5T4, TPBG) specific chimeric antigen receptors for cancer immunotherapy
US11987639B2 (en) 2014-09-04 2024-05-21 Cellectis Trophoblast glycoprotein (5T4, TPBG) specific chimeric antigen receptors for cancer immunotherapy
WO2016034666A1 (en) 2014-09-04 2016-03-10 Cellectis Trophoblast glycoprotein (5t4, tpbg) specific chimeric antigen receptors for cancer immunotherapy
EP3699188A1 (en) 2014-09-04 2020-08-26 Cellectis 5t4 (tpbg) specific chimeric antigen receptors for cancer immunotherapy
US10920208B2 (en) 2014-10-22 2021-02-16 President And Fellows Of Harvard College Evolution of proteases
US11760986B2 (en) 2014-10-22 2023-09-19 President And Fellows Of Harvard College Evolution of proteases
WO2016120217A1 (en) 2015-01-26 2016-08-04 Cellectis Anti-hsp70 specific chimeric antigen receptors (cars) for cancer immunotherapy
US11014989B2 (en) 2015-01-26 2021-05-25 Cellectis Anti-CLL1 specific single-chain chimeric antigen receptors (scCARs) for cancer immunotherapy
WO2016142532A1 (en) 2015-03-11 2016-09-15 Cellectis Methods for engineering allogeneic t cell to increase their persistence and/or engraftment into patients
US11299729B2 (en) 2015-04-17 2022-04-12 President And Fellows Of Harvard College Vector-based mutagenesis system
US10752670B2 (en) 2015-05-20 2020-08-25 Cellectis Anti-GD3 specific chimeric antigen receptors for cancer immunotherapy
US11473082B2 (en) 2015-06-17 2022-10-18 Poseida Therapeutics, Inc. Compositions and methods for directing proteins to specific loci in the genome
EP4043556A1 (en) 2015-06-30 2022-08-17 Cellectis Methods for improving functionality in nk cell by gene inactivation using specific endonuclease
US11104967B2 (en) 2015-07-22 2021-08-31 President And Fellows Of Harvard College Evolution of site-specific recombinases
US11905623B2 (en) 2015-07-22 2024-02-20 President And Fellows Of Harvard College Evolution of site-specific recombinases
US11524983B2 (en) 2015-07-23 2022-12-13 President And Fellows Of Harvard College Evolution of Bt toxins
US10612011B2 (en) 2015-07-30 2020-04-07 President And Fellows Of Harvard College Evolution of TALENs
US11078469B2 (en) 2015-07-30 2021-08-03 President And Fellows Of Harvard College Evolution of TALENs
US11913040B2 (en) 2015-07-30 2024-02-27 President And Fellows Of Harvard College Evolution of TALENs
WO2017024602A1 (zh) * 2015-08-07 2017-02-16 苏州大学张家港工业技术研究院 一种测定非同源末端连接修复活性的方法
US9863933B2 (en) 2015-08-07 2018-01-09 Soochow University Method for determining the repair activity of non-homologous end joining
WO2017025323A1 (en) 2015-08-11 2017-02-16 Cellectis Cells for immunotherapy engineered for targeting cd38 antigen and for cd38 gene inactivation
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
WO2017178585A1 (en) 2016-04-15 2017-10-19 Cellectis A method of engineering drug-specific hypersensitive t-cells for immunotherapy by gene inactivation
WO2017178586A1 (en) 2016-04-15 2017-10-19 Cellectis A method of engineering prodrug-specific hypersensitive t-cells for immunotherapy by gene expression
EP4219731A2 (en) 2016-05-18 2023-08-02 Amyris, Inc. Compositions and methods for genomic integration of nucleic acids into exogenous landing pads
US12577580B2 (en) 2016-05-26 2026-03-17 Nunhems B.V. Seedless fruit producing plants
US11174493B2 (en) 2016-05-26 2021-11-16 Nunhems B.V. Seedless fruit producing plants
US11761018B2 (en) 2016-05-26 2023-09-19 Nunhems B.V. Seedless fruit producing plants
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
WO2018115189A1 (en) 2016-12-21 2018-06-28 Cellectis Stably enginereed proteasome inhibitor resistant immune cells for immunotherapy
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
EP4414380A2 (en) 2017-03-31 2024-08-14 Cellectis SA Universal anti-cd22 chimeric antigen receptor engineered immune cells
WO2018178378A1 (en) 2017-03-31 2018-10-04 Cellectis Sa New universal chimeric antigen receptor t cells specific for cd22
WO2018178377A1 (en) 2017-03-31 2018-10-04 Cellectis Sa Universal anti-cd22 chimeric antigen receptor engineered immune cells
US11690873B2 (en) 2017-03-31 2023-07-04 Cellectis Sa Universal chimeric antigen receptor T cells specific for CD22
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
WO2019002633A1 (en) 2017-06-30 2019-01-03 Cellectis CELLULAR IMMUNOTHERAPY FOR REPETITIVE ADMINISTRATION
US11447809B2 (en) 2017-07-06 2022-09-20 President And Fellows Of Harvard College Evolution of tRNA synthetases
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US12060553B2 (en) 2017-08-25 2024-08-13 President And Fellows Of Harvard College Evolution of BoNT peptidases
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11624130B2 (en) 2017-09-18 2023-04-11 President And Fellows Of Harvard College Continuous evolution for stabilized proteins
WO2019072824A1 (en) 2017-10-09 2019-04-18 Cellectis IMPROVED ANTI-CD123 CAR IN UNIVERSAL MODIFIED IMMUNE T LYMPHOCYTES
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
WO2019122360A1 (en) 2017-12-22 2019-06-27 Kws Saat Se Regeneration of plants in the presence of histone deacetylase inhibitors
US11700805B2 (en) 2017-12-22 2023-07-18 KWS SAAT SE & Co. KGaA Regeneration of plants in the presence of histone deacetylase inhibitors
EP3501268A1 (en) 2017-12-22 2019-06-26 Kws Saat Se Regeneration of plants in the presence of histone deacetylase inhibitors
WO2019134884A1 (en) 2018-01-03 2019-07-11 Kws Saat Se Regeneration of genetically modified plants
EP4234701A2 (en) 2018-01-03 2023-08-30 Basf Se Regeneration of genetically modified plants
EP3508581A1 (en) 2018-01-03 2019-07-10 Kws Saat Se Regeneration of genetically modified plants
WO2019138083A1 (en) 2018-01-12 2019-07-18 Basf Se Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a
WO2019149743A1 (en) 2018-01-30 2019-08-08 Cellectis Combination comprising allogeneic immune cells deficient for an antigen present on both t-cells and pathological cells and therapeutic antibody against said antigen
EP3545756A1 (en) 2018-03-28 2019-10-02 KWS SAAT SE & Co. KGaA Regeneration of plants in the presence of inhibitors of the histone methyltransferase ezh2
WO2019185849A1 (en) 2018-03-28 2019-10-03 KWS SAAT SE & Co. KGaA Regeneration of plants in the presence of inhibitors of the histone methyltransferase ezh2
WO2019195492A1 (en) 2018-04-05 2019-10-10 Juno Therapeutics, Inc. Methods of producing cells expressing a recombinant receptor and related compositions
WO2019195491A1 (en) 2018-04-05 2019-10-10 Juno Therapeutics, Inc. T cells expressing a recombinant receptor, related polynucleotides and methods
EP3567111A1 (en) 2018-05-09 2019-11-13 KWS SAAT SE & Co. KGaA Gene for resistance to a pathogen of the genus heterodera
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US11913044B2 (en) 2018-06-14 2024-02-27 President And Fellows Of Harvard College Evolution of cytidine deaminases
US12146142B2 (en) 2018-06-15 2024-11-19 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant II
WO2019238911A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant ii
WO2019238908A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for enhancing genome engineering efficiency
US12043837B2 (en) 2018-06-15 2024-07-23 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant
WO2019238832A1 (en) 2018-06-15 2019-12-19 Nunhems B.V. Seedless watermelon plants comprising modifications in an abc transporter gene
WO2019238909A1 (en) 2018-06-15 2019-12-19 KWS SAAT SE & Co. KGaA Methods for improving genome engineering and regeneration in plant
WO2020007593A1 (en) 2018-07-02 2020-01-09 Cellectis Chimeric antigen receptors (car)-expressing cells and combination treatment for immunotherapy of patients with relapse refractory adverse genetic risk aml
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
WO2020053313A1 (en) 2018-09-11 2020-03-19 KWS SAAT SE & Co. KGaA Beet necrotic yellow vein virus (bnyvv)-resistance modifying gene
EP3623379A1 (en) 2018-09-11 2020-03-18 KWS SAAT SE & Co. KGaA Beet necrotic yellow vein virus (bnyvv)-resistance modifying gene
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12606839B2 (en) 2019-01-29 2026-04-21 The University Of Warwick Methods for enhancing genome engineering efficiency
WO2020157573A1 (en) 2019-01-29 2020-08-06 The University Of Warwick Methods for enhancing genome engineering efficiency
WO2020182971A1 (en) 2019-03-12 2020-09-17 KWS SAAT SE & Co. KGaA Improving plant regeneration
EP3708651A1 (en) 2019-03-12 2020-09-16 KWS SAAT SE & Co. KGaA Improving plant regeneration
US12139717B2 (en) 2019-03-12 2024-11-12 KWS SAAT SE & Co. KGaA Improving plant regeneration
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11788080B2 (en) 2019-03-26 2023-10-17 Encodia, Inc. Modified cleavases, uses thereof and related kits
CN113993997A (zh) * 2019-03-26 2022-01-28 Encodia 公司 修饰的切割酶,及其使用和相关试剂盒
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12435120B2 (en) 2019-05-01 2025-10-07 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified CD247 locus, related polynucleotides and methods
WO2020223535A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods
WO2020223571A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods
WO2020229241A1 (en) 2019-05-10 2020-11-19 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US12492382B2 (en) 2019-05-10 2025-12-09 The Regents Of The University Of California Blood type O Rh—hypo-immunogenic cells
EP3757219A1 (en) 2019-06-28 2020-12-30 KWS SAAT SE & Co. KGaA Enhanced plant regeneration and transformation by using grf1 booster gene
WO2020260682A1 (en) 2019-06-28 2020-12-30 KWS SAAT SE & Co. KGaA Enhanced plant regeneration and transformation by using grf1 booster gene
WO2021022223A1 (en) 2019-08-01 2021-02-04 Sana Biotechnology, Inc. Dux4 expressing cells and uses thereof
WO2021041316A1 (en) 2019-08-23 2021-03-04 Sana Biotechnology, Inc. Cd24 expressing cells and uses thereof
WO2021048316A1 (en) 2019-09-12 2021-03-18 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021069387A1 (en) 2019-10-07 2021-04-15 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
WO2021093943A1 (en) 2019-11-12 2021-05-20 KWS SAAT SE & Co. KGaA Gene for resistance to a pathogen of the genus heterodera
WO2021110582A1 (en) 2019-12-03 2021-06-10 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2021146222A1 (en) 2020-01-13 2021-07-22 Sana Biotechnology, Inc. Modification of blood type antigens
WO2021146627A1 (en) 2020-01-17 2021-07-22 Sana Biotechnology, Inc. Safety switches for regulation of gene expression
US12473563B2 (en) 2020-02-28 2025-11-18 KWS SAAT SE & Co. KGaA Immature inflorescence meristem editing
WO2021195426A1 (en) 2020-03-25 2021-09-30 Sana Biotechnology, Inc. Hypoimmunogenic neural cells for the treatment of neurological disorders and conditions
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
WO2021231549A3 (en) * 2020-05-12 2022-01-06 Factor Bioscience Inc. Engineered gene-editing proteins
WO2021231661A2 (en) 2020-05-13 2021-11-18 Juno Therapeutics, Inc. Process for producing donor-batched cells expressing a recombinant receptor
WO2021260186A1 (en) 2020-06-26 2021-12-30 Juno Therapeutics Gmbh Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods
WO2022036150A1 (en) 2020-08-13 2022-02-17 Sana Biotechnology, Inc. Methods of treating sensitized patients with hypoimmunogenic cells, and associated methods and compositions
WO2022098787A1 (en) 2020-11-04 2022-05-12 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods
US12527270B2 (en) 2020-12-22 2026-01-20 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in plants
EP4019638A1 (en) 2020-12-22 2022-06-29 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in beta vulgaris
EP4019639A1 (en) 2020-12-22 2022-06-29 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in beta vulgaris
WO2022136535A1 (en) 2020-12-22 2022-06-30 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in beta vulgaris
WO2022136557A1 (en) 2020-12-22 2022-06-30 KWS SAAT SE & Co. KGaA Promoting regeneration and transformation in plants
WO2022146891A2 (en) 2020-12-31 2022-07-07 Sana Biotechnology, Inc. Methods and compositions for modulating car-t activity
WO2022251367A1 (en) 2021-05-27 2022-12-01 Sana Biotechnology, Inc. Hypoimmunogenic cells comprising engineered hla-e or hla-g
WO2023287827A2 (en) 2021-07-14 2023-01-19 Sana Biotechnology, Inc. Altered expression of y chromosome-linked antigens in hypoimmunogenic cells
WO2023019226A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy
WO2023019225A2 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy to reduce instant blood mediated inflammatory reactions
WO2023019229A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified primary cells for allogeneic cell therapy
WO2023019227A1 (en) 2021-08-11 2023-02-16 Sana Biotechnology, Inc. Genetically modified cells for allogeneic cell therapy to reduce complement-mediated inflammatory reactions
WO2023081900A1 (en) 2021-11-08 2023-05-11 Juno Therapeutics, Inc. Engineered t cells expressing a recombinant t cell receptor (tcr) and related systems and methods
WO2023158836A1 (en) 2022-02-17 2023-08-24 Sana Biotechnology, Inc. Engineered cd47 proteins and uses thereof
WO2023173123A1 (en) 2022-03-11 2023-09-14 Sana Biotechnology, Inc. Genetically modified cells and compositions and uses thereof
WO2023183313A1 (en) 2022-03-22 2023-09-28 Sana Biotechnology, Inc. Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods
WO2024083579A1 (en) 2022-10-20 2024-04-25 Basf Se Regulatory nucleic acid molecules for enhancing gene expression in plants
WO2024097314A2 (en) 2022-11-02 2024-05-10 Sana Biotechnology, Inc. Methods and systems for determining donor cell features and formulating cell therapy products based on cell features
WO2024097315A2 (en) 2022-11-02 2024-05-10 Sana Biotechnology, Inc. Cell therapy products and methods for producing same
WO2024097311A2 (en) 2022-11-02 2024-05-10 Sana Biotechnology, Inc. Hypoimmunogenic mail cells, methods of making and methods of using same
WO2024097313A1 (en) 2022-11-02 2024-05-10 Sana Biotechnology, Inc. Methods for producing t cell therapy products
WO2024100604A1 (en) 2022-11-09 2024-05-16 Juno Therapeutics Gmbh Methods for manufacturing engineered immune cells
WO2024151541A1 (en) 2023-01-09 2024-07-18 Sana Biotechnology, Inc. Type-1 diabetes autoimmune mouse
WO2024161021A1 (en) 2023-02-03 2024-08-08 Juno Therapeutics Gmbh Methods for non-viral manufacturing of engineered immune cells
WO2024229302A1 (en) 2023-05-03 2024-11-07 Sana Biotechnology, Inc. Methods of dosing and administration of engineered islet cells
WO2024243236A2 (en) 2023-05-22 2024-11-28 Sana Biotechnology, Inc. Methods of delivery of islet cells and related methods
WO2025043172A1 (en) 2023-08-23 2025-02-27 Sana Biotechnology, Inc. Modified cd47 proteins and their uses
CN117344048A (zh) * 2023-09-28 2024-01-05 江苏省农业科学院 检测无毒基因Avr-Pik的RPA-LFD引物探针组、试剂盒及其应用
WO2025137646A1 (en) 2023-12-22 2025-06-26 Recode Therapeutics, Inc. Gene editing methods and compositions for treating cystic fibrosis
WO2025181336A1 (en) 2024-03-01 2025-09-04 Cellectis Sa Compositions and methods for hbb-editing in hspc
WO2025212519A1 (en) 2024-04-01 2025-10-09 Moonlight Bio, Inc. Dll3 binding proteins and uses thereof
WO2025235851A1 (en) 2024-05-10 2025-11-13 Juno Therapeutics, Inc. Genetically engineered t cells expressing a cd19 chimeric antigen receptor (car) and uses thereof for allogeneic cell therapy

Also Published As

Publication number Publication date
EP2694091A2 (en) 2014-02-12
JP6695239B2 (ja) 2020-05-20
WO2012138927A3 (en) 2013-04-25
JP2017018125A (ja) 2017-01-26
JP6839691B2 (ja) 2021-03-10
EP2694089B1 (en) 2024-06-05
CN103608027A (zh) 2014-02-26
SG10201602651YA (en) 2016-05-30
JP5996630B2 (ja) 2016-09-21
AU2012240110B2 (en) 2017-08-03
CA3111953A1 (en) 2012-10-11
HK1253952A1 (en) 2019-07-05
CA2832534A1 (en) 2012-10-11
US20220010292A1 (en) 2022-01-13
AU2017248447B2 (en) 2019-01-24
IL228747B (en) 2020-04-30
JP2019010119A (ja) 2019-01-24
KR101982360B1 (ko) 2019-05-24
AU2012240110A1 (en) 2013-10-31
EP2694091B1 (en) 2019-03-13
ES2728436T3 (es) 2019-10-24
DK2694091T3 (da) 2019-06-03
IL228747A0 (en) 2013-12-31
AU2017248447A1 (en) 2017-11-02
US11136566B2 (en) 2021-10-05
CN103608027B (zh) 2016-01-20
JP2014511698A (ja) 2014-05-19
KR20140050602A (ko) 2014-04-29
WO2012138939A1 (en) 2012-10-11
CA3111953C (en) 2023-10-24
CA2832534C (en) 2022-01-04
EP2694089A1 (en) 2014-02-12
US20190316100A1 (en) 2019-10-17
US9315788B2 (en) 2016-04-19
US20160298098A1 (en) 2016-10-13
SG194115A1 (en) 2013-11-29
US20140115726A1 (en) 2014-04-24
US20130117869A1 (en) 2013-05-09
EP3320910A1 (en) 2018-05-16
US11198856B2 (en) 2021-12-14

Similar Documents

Publication Publication Date Title
US20220010292A1 (en) Method for the generation of compact tale-nucleases and uses thereof
US9540623B2 (en) Method for increasing the efficiency of double-strand-break induced mutagenesis
EP2633040B1 (en) Method for increasing the efficiency of double-strand break-induced mutagenesis
US11220683B2 (en) Method to overcome DNA chemical modifications sensitivity of engineered TALE DNA binding domains
EP2951295B1 (en) Tevi chimeric endonucleases and their preferential cleavage sites
WO2012138901A1 (en) Method for enhancing rare-cutting endonuclease efficiency and uses thereof
HK1192709B (en) Method for the generation of compact tale-nucleases and uses thereof
HK1192709A (en) Method for the generation of compact tale-nucleases and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12725896

Country of ref document: EP

Kind code of ref document: A2

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 2014504007

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2832534

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2012725896

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2012240110

Country of ref document: AU

Date of ref document: 20120405

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20137029369

Country of ref document: KR

Kind code of ref document: A