WO2006005667A2 - Polypeptide protracting tags comprising a tetrazole moiety - Google Patents
Polypeptide protracting tags comprising a tetrazole moiety Download PDFInfo
- Publication number
- WO2006005667A2 WO2006005667A2 PCT/EP2005/052874 EP2005052874W WO2006005667A2 WO 2006005667 A2 WO2006005667 A2 WO 2006005667A2 EP 2005052874 W EP2005052874 W EP 2005052874W WO 2006005667 A2 WO2006005667 A2 WO 2006005667A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glp
- xaa
- peptide
- ethoxy
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*(C)C***[*@@](C)C1=C(C)C*CCCNN1 Chemical compound C*(C)C***[*@@](C)C1=C(C)C*CCCNN1 0.000 description 23
- MMAZQTVROYYWNI-UHFFFAOYSA-N CCCCCCCCCCCCCCCOc1ccc(C2NN=NN2)cc1 Chemical compound CCCCCCCCCCCCCCCOc1ccc(C2NN=NN2)cc1 MMAZQTVROYYWNI-UHFFFAOYSA-N 0.000 description 1
- QGQQCFJUGRMDHU-UHFFFAOYSA-O CCCNC(CCCCNC(CCCCCCCCCCCCCCCC(N[NH3+])=NNC)=O)C(N)=O Chemical compound CCCNC(CCCCNC(CCCCCCCCCCCCCCCC(N[NH3+])=NNC)=O)C(N)=O QGQQCFJUGRMDHU-UHFFFAOYSA-O 0.000 description 1
- DMCFVGMOPHPIPY-UHFFFAOYSA-N CS(CCCC=O)NC(CCCCCCCCCCCCCCCC(N)=NN)=O Chemical compound CS(CCCC=O)NC(CCCCCCCCCCCCCCCC(N)=NN)=O DMCFVGMOPHPIPY-UHFFFAOYSA-N 0.000 description 1
- KMTDMTZBNYGUNX-UHFFFAOYSA-N Cc1ccc(CO)cc1 Chemical compound Cc1ccc(CO)cc1 KMTDMTZBNYGUNX-UHFFFAOYSA-N 0.000 description 1
- XKSQSNARJSCEMH-DEOSSOPVSA-N N/C(/c(cc1)ccc1-c(cc1)ccc1-c(cc1)ccc1OOCNCCCC[C@@H](C(O)=O)NP)=N\N Chemical compound N/C(/c(cc1)ccc1-c(cc1)ccc1-c(cc1)ccc1OOCNCCCC[C@@H](C(O)=O)NP)=N\N XKSQSNARJSCEMH-DEOSSOPVSA-N 0.000 description 1
- JSTCPNFNKICNNO-UHFFFAOYSA-N Oc(cc1)ccc1N=O Chemical compound Oc(cc1)ccc1N=O JSTCPNFNKICNNO-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/61—Growth hormone [GH], i.e. somatotropin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/4164—1,3-Diazoles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/27—Growth hormone [GH], i.e. somatotropin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D257/00—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms
- C07D257/02—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms not condensed with other rings
- C07D257/04—Five-membered rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/006—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length of peptides containing derivatised side chain amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
- C07K1/113—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides without change of the primary structure
Definitions
- the present invention relates to compounds comprising a heterocyclic carboxylic acid bioisostere, methods for preparing the compounds and the medical applications of such compounds.
- Endogenous peptides are, however, not always suitable as drug candidates because these peptides often have half-lives of few minutes due to rapid degradation by peptidases and/or due to renal filtration and excretion in the urine.
- the half- life of polypeptides in human plasma varies strongly (from a few minutes to more than one week).
- the half-life of small molecule drugs is also highly variable. The reason for this strong variability of plasma half-lives of peptides, proteins, or other compounds is, however, not well understood.
- Serum albumin has a half-life of more than one week, and one approach to increasing the plasma half -life of peptides has been to derivatised the peptides with a chemical entity that binds to serum albumin.
- Knudsen et al. J. Med. Chem. 2000, 43, 1664-1669
- acylated GLP-1 peptides exhibit high receptor potency and a tenfold increase of plasma half-life in pigs. Zobel et al. (Bioorg. Med. Chem. Lett.
- a method for increasing the plasma half-life of a molecule comprising covalently linking this molecule to a heterocyclic carboxylic acid bioisostere.
- the present invention also relates to a method for increasing the plasma half-life of a molecule, comprising covalently linking this molecule to a 1 H-tetrazole.
- G, X, and Y independently represent a bond, -S-, -O-, -NH-, -(CH 2 )i-io-, or arylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, or heteroarylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, and
- Z represents a bond
- t 1-40
- the term 'molecule' refers to a compound comprising an amino group or a mercapto group, to which the group A or Q may be covalently linked.
- G, X, and Y independently represent a bond, -S-, -O-, -NH-, -(CH 2 )i-i 0 -, or arylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, or heteroarylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, and
- Z represents a bond
- E is a bond, O, S, or NH, and m, p, and q independently are 1-40, and
- t 1 -40
- the term 'molecule' refers to a compound comprising an amino group or a mercapto group, to which the group A or Q may be covalently linked.
- the present invention also provides a compound according to formula (I), wherein G, X and
- the present invention also provides a compound according to formula (I), wherein G, X and
- Y are all selected from -(CH 2 ) 1-10 -.
- the present invention also provides a compound according to formula (I), wherein t is 1.
- polyradical means a molecule or molecular moiety with more than one unshared electron.
- a polyradical according to this definition may be used to covalently link two or more (mono-)radicals together.
- small molecule drug means a therapeutic agent with a molecular weight ⁇ 1500 g/mol.
- therapeutic agent means a peptide, protein, small molecule drug, or any other type of compound, able to elicit a biological response.
- plasma half-life means the time required for the concentration of a given compound present in the plasma of a living mammal, such as a human, to decrease to one half of its original concentration.
- analog refers to a polypeptide in which less than 30% of the amino acids of the original polypeptide have been removed or replaced by other amino acids (including stereoisomeric, unnatural or chemically modified amino acids) or have been chemically modified, for instance by acylation or alkylation of the side chain.
- analog also refers to polypeptides in which the N-terminal amino group has been removed, alkylated with lower alkyl, or acylated with lower alkanoic, arylalkanoic, heteroarylalkanoic, or benzoic acids.
- analog also includes polypeptides in which the C-terminal carboxyl group has been removed or converted to an amide by condensation with ammonia, lower alkyl amines, lower dialkyl amines, aziridine, azetidine, pyrrolidine, piperidine, or azepine.
- analog also includes polypeptides in which the disulfide functionalities between two or more cystein groups have been reduced or the connectivity between two or more cystein groups has been modified.
- derivative as used herein in relation to a peptide means a chemically modified peptide or an analogue thereof, wherein at least one substituent is not present in the unmodified peptide or an analogue thereof, i.e. a peptide which has been covalently modified. Typical modifications are amides, carbohydrates, alkyl groups, acyl groups, esters and the like.
- An example of a derivative of GLP-1 (7-37) is Arg 34 Lys 26 (N ⁇ -( ⁇ -Glu(N 0C -hexadecanoyl)))-GLP-1 (7-37).
- unnatural amino acid refers to any compound comprising at least one primary or secondary amino group and at least one carboxyl group, without being L-alanine, L- arginine, L-asparagine, L-aspartic acid, L-cysteine, L-glutamine, L-glutamic acid, L-glycine, L-histidine, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, proline, L- serine, L-threonine, L-tryptophan, L-tyrosine, or L-valine.
- GLP-1 (7-37) refers to a peptide with the amino acid sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO. 1).
- GLP-1 peptide as used herein means GLP-1 (7-37), a GLP-1 analog, a GLP-1 derivative or a derivative of a GLP-1 analog.
- the GLP-1 peptide is an insulinotropic agent.
- exendin-4(1 -39) refers to a peptide with the amino acid sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO. 2).
- insulinotropic agent as used herein means a compound which is an agonist of the human GLP-1 receptor, i.e. a compound which stimulates the formation of cAMP in a suitable medium containing the human GLP-1 receptor. The potency of an insulinotropic agent is determined by calculating the EC 50 value from the dose-response curve as described below.
- Baby hamster kidney (BHK) cells expressing the cloned human GLP-1 receptor (BHK-467-12A) were grown in DMEM media with the addition of 100 IU/mL penicillin, 100 ⁇ L/mL streptomycin, 10% fetal calf serum and 1 mg/mL Geneticin G-418 (Life Technologies).
- Plasma membranes were prepared by homogenisation in buffer (10 mM Tris-HCI, 30 mM NaCI and 1 mM dithiothreitol, pH 7.4, containing, in addition, 5 mg/L leupeptin (Sigma, St.
- the homogenate was centrifuged on top of a layer of 41 w/v% sucrose. The white band between the two layers was diluted in buffer and centrifuged. Plasma membranes were stored at -80 0 C until used.
- the functional receptor assay was carried out by measuring cAMP as a response to stimulation by the insulinotropic agent.
- Incubation were carried out in 96-well microtiter plates in a total volume of 140 ⁇ L and with the following final concentrations: 50 mM Tris-HCI, 1 mM EGTA, 1.5 mM MgSO 4 , 1.7 mM ATP, 20 mM GTP, 2 mM 3-isobutyl-1 -methylxanthine (IBMX), 0.01 % Tween-20, pH 7.4.
- Compounds to be tested for agonist activity were dissolved and diluted in buffer.
- GTP was freshly prepared for each experiment : 2.5 ⁇ g of membrane was added to each well and the mixture was incubated for 90 min at room temperature in the dark with shaking. The reaction was stopped by the addition of 25 ⁇ L of 0.5 M HCI.
- DPP-IV protected as used herein referring to a polypeptide means a polypeptide which has been chemically modified in order to render said compound resistant to the plasma peptidase dipeptidyl aminopeptidase-4 (DPP-IV).
- DPP-IV enzyme in plasma is known to be involved in the degradation of several peptide hormones, e.g. GLP-1 , GLP-2, Exendin-4 etc.
- GLP-1 peptide dipeptidyl aminopeptidase-4
- Exendin-4 etc.
- Resistance of a peptide to degradation by dipeptidyl aminopeptidase IV is determined by the following degradation assay : Aliquots of the peptide (5 nmol) are incubated at 37 Q C with 1 ⁇ l_ of purified dipeptidyl aminopeptidase IV corresponding to an enzymatic activity of 5 mU for 10-180 minutes in 100 ⁇ l_ of 0.1 M triethylamine-HCI buffer, pH 7.4. Enzymatic reactions are terminated by the addition of 5 ⁇ l_ of 10% trifluoroacetic acid, and the peptide degradation products are separated and quantified using HPLC analysis.
- Peptides and their degradation products may be monitored by their absorbance at 220 nm (peptide bonds) or 280 nm (aromatic amino acids), and are quantified by integration of their peak areas related to those of standards.
- the rate of hydrolysis of a peptide by dipeptidyl aminopeptidase IV is estimated at incubation times which result in less than 10% of the peptide being hydrolysed.
- factor VII refers to the human factor VII of the blood clotting cascade.
- bioisostere refers to a molecular fragment capable of mimicking the biological properties of another molecular fragment. Typical bioisosteres of carboxylic acids include tetrazoles, phenols, N-acylsulfonamides, or other compounds with an acidic NH- or OH- group.
- halogen means F, Cl, Br or I.
- alkyl as used herein is intended to mean straight, branched, or cyclic CrCi 0 alkyl.
- lower alkyl refers to Ci-C 6 alkyl.
- aryl as used herein is intended to include carbocyclic aromatic ring systems such as phenyl, biphenylyl, naphthyl, anthracenyl, phenanthrenyl, fluorenyl, indenyl, pentalenyl, azulenyl and the like.
- arylene as used herein is intended to include arene-derived diradicals such as 1 ,2-phenylene, 1 ,3-phenylene, 1 ,4-phenylene, 1 ,2-naphthylene, 1 ,4-naphthylene, 4,4'- biphenylene, 4,4"-terphenylene, 4,4'"-quaterphenylene, and the like.
- heteroarylene as used herein is intended to include heteroarene-derived diradicals, such as 1 ,2,4-pyrazol-2,5-diyl, imida ⁇ ol-1 ,2-diyl, thiazol-2,4-diyl, and the like, as well as combinations of arylene with heteroarylene diradicals, such as (4-phenylimidazole)- 4,1'-diyl, (3,5-diphenyl-1 ,2,4-oxadiazole)-4,4"-diyl, and the like.
- aryloxy as used herein refers to the radical -O-aryl where aryl is as defined above. Non-limiting examples are phenoxy, naphthoxy, anthracenyloxy, phenanthrenyloxy, fluorenyloxy, indenyloxy and the like.
- heteroaryl as used herein is intended to include heterocyclic aromatic ring systems containing one or more heteroatoms selected from nitrogen, oxygen and sulfur such as furyl, thienyl, pyrrolyl, oxazolyl, thiazolyl, imidazolyl, isoxazolyl, isothiazolyl, 1 ,2,3- triazolyl, 1 ,2,4-tria ⁇ olyl, pyranyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, 1 ,2,3-triazinyl, 1 ,2,4-triazinyl, 1 ,3,5- triazinyl, 1 ,2,3-oxadiazolyl, 1 ,2,4-oxadiazolyl, 1 ,2,5-oxadiazolyl, 1 ,3,4- oxadiazolyl, 1 ,2,3-thiadiazolyl, 1 ,2,4-
- Heteroaryl is also intended to include the partially hydrogenated derivatives of the heterocyclic systems enumerated above.
- Non-limiting examples of such partially hydrogenated derivatives are 2,3-dihydrobenzofuranyl, pyrrolinyl, pyrazolinyl, indanyl, indolinyl, oxazolidinyl, oxazolinyl, oxazepinyl and the like. Certain of the above defined terms may occur more than once in the structural formulae, and upon such occurrence each term shall be defined independently of the other.
- the present invention provides a method for increasing the plasma half-life of a molecule, comprising covalently linking this molecule to a heterocyclic carboxylic acid bioisostere.
- the present invention provides a method for increasing the plasma half- life of a molecule, comprising covalently linking this molecule to a 1 H-tetrazole. In another aspect the present invention provides a method for increasing the plasma half- life of a molecule, comprising converting said molecule into a compound of the general formula (I):
- G, X, and Y independently represent a bond, -S-, -O-, -NH-, -(CH 2 )i-io-, or arylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, or heteroarylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, and
- Z represents a bond
- E is a bond, O, S, or NH, and m, p, and q independently are 1 -40, and
- t is 1 -40, and the term 'molecule 1 refers to a compound comprising an amino group or a mercapto group, to which the group A or Q may be covalentiy linked.
- Tetrazoles are slightly more lipophilic than carboxylic acids, but are resistant to many of the metabolic degradation pathways which befall carboxylic acids. Because tetrazoles cannot act as acylating reagents no protective group is required when acylating a protein with an ⁇ - (tetrazol-5-yl)carboxylic acid.
- an optional spacer i.e. a divalent or polyvalent molecular fragment able to covalentiy connect one or several tetrazoles to the molecule.
- This divalent or polyvalent molecular fragment may also have an influence on the biological properties of the conjugate compound-tetrazole(s), and structural modifications of this spacer may be used to adjust and improve the properties of the conjugate.
- This spacer may be a combination of one or several different structural elements selected from but not limited to alkylene chains, partially or fully fluorinated alkylene chains, arylenes, heteroarylenes, oligo(ethylene glycol), amide bonds, lysine, short peptides, short oligoamides, and other, similar fragments.
- polypeptides contain amino groups (e.g. the N-terminal amino group or lysine-side- chain amino groups), which can be acylated by a suitable acylating reagent, such as a carboxylic acid in the presence of a coupling reagent, a carboxylic acid O- hydroxysuccinimidyl ester, hydroxybenzotriazole esters, carboxylic acid anhydrides, carboxylic acid halides, carboxylic acid azides, nitrophenyl esters, mixed carboxylic carbonic anhydrides, mixed carboxylic sulfonic anhydrides, imidazolides, and the like.
- a suitable acylating reagent such as a carboxylic acid in the presence of a coupling reagent, a carboxylic acid O- hydroxysuccinimidyl ester, hydroxybenzotriazole esters, carboxylic acid anhydrides, carboxylic acid halides, carboxylic acid azides, nitrophenyl
- amino-group bearing polypeptides may be derivatized by conversion into a carbamate by treatment with an alkyl haloformiate, an O-succinimidylcarbonate, an alkyl azidoformiate, or a related reagent.
- amino-group bearing polypeptides may be derivatized by conversion into a urea by treatment with an isocyanate, a carbamoyl halide, a nitrophenyl carbamate, or a related reagent.
- amino-group bearing polypeptides may be derivatized by conversion into a sulfonamide by treatment with a sulfonyl halide or sulfonyl imidazolide.
- polypeptides contain thiol groups, which can be alkylated by treatment with a suitable alkylating reagent, such as an alkyl halide, an alkyl sulfonate, an N-alkylmaleimide, an acrylamide, or a related alkylating reagent, to covalently bind the tetrazole-bearing fragment to the polypeptide.
- a suitable alkylating reagent such as an alkyl halide, an alkyl sulfonate, an N-alkylmaleimide, an acrylamide, or a related alkylating reagent
- thiol groups may also be arylated by treatment with a suitable arylating reagent, such as an aryl halide, an aryl iodonium salt, an aryldiazonium salt or a similar reagent.
- Polypeptides with N-terminal serine or a related functional group can be oxidized by treatment with periodate to an aldehyde.
- This aldehyde reacts with O-alkylhydroxylamines to yield oximes, and may therefore be used to attach an O-alkylhydroxylamine-containing tetrazole to the polypeptide.
- aldehyde formed by oxidation of N-terminal serine also reacts with 2-aminoethylthiols (HS-C-C-NH) to yield thiazolidines, or with hydrazines to yield hydrazones, and these reactions may also be used for the attachment of a tetrazole-bearing fragment to a polypeptide.
- Aldehydes also react with C,H-acidic compounds such as 1 ,3-diketones, 3-oxobutyramides, malonodinitriles, barbituric acid derivatives, malonic acid derivatives, and the like to yield alcohols (aldol addition) or alkenes (Knoevenagel condensation).
- These reactions may also be used to attach tetrazoles to polypeptides.
- Enzymes enable the selective derivatization of polypeptides.
- carboxypeptidases can be used to form amides from amines and the C-terminal carboxylic acid group of a polypeptide.
- Transglutaminases may be used to form new amides from amines and the side chain of glutamine. If these enzymatic reactions are performed with a tetrazole-bearing amine, compounds as claimed in this invention will result. Alternatively, these enzymatic reactions may also be conducted with an amine which contains a functional group which enables a selective covalent attachment of a tetrazole-bearing fragment in a second operation.
- Such functional groups may be aldehydes, ketones, hydroxylamines, alkoxylamines, hydrazines, thiols, azides, 2-aminoethylthiols, 3-aminopropylthiols, 2- hydroxyethylthiols, 3-hydroxypropylthiols, alkynes, alkenes, nitriles, C,H-acidic compounds, or other functional groups which enable the selective covalent attachment of a tetrazole- bearing fragment.
- Treatment of an amine containing one or several of these functional groups will yield a polypeptide, which can be selectively derivatized.
- a methodology for the production of proteins containing unnatural amino acids by fermentation has recently been described (for instance L.
- the resulting protein, containing this unnatural amino acid, may then be converted into a tetrazole-containing protein by covalent binding of a suitable tetrazole derivative to the side chain of the unnatural amino acid.
- Polypeptides may contain one or several tyrosines. These may be selectively derivatized by azocoupling with an aryldiazonium salt. This technique may also be used to prepare compound according to the present invention, by treating said tyrosine-containing polypeptide with a tetrazole-containing aryldiazonium salt.
- the present invention provides a compound of the general formula (I):
- G, X, and Y independently represent a bond, -S-, -O-, -NH-, -(CH 2 ) M0 -, or arylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, or heteroarylene, optionally substituted with one or more alkyl, amino, cycloalkyl, aryl, heteroaryl, halogen, nitro, lower alkoxy, hydroxy, MeCONH-, alkanoyl, or cyano, and
- Z represents a bond or -(CH 2 ) n -, -0-(CHa) n -, -S-(CH 2 ) n -, -(OCH 2 CH 2 ) n -, -(CF 2 ) n -, -O-CH 2 -(CF 2 ) n -, -S-CH 2 -(CF 2 ) ⁇ -, wherein n is 1 -40, and
- A represents
- E is a bond, O, S, or NH, and m, p, and q independently are 1-40, and
- t 1 -40
- the term 'molecule' refers to a compound comprising an amino group or a mercapto group, to which the group A or Q may be covalently linked.
- the invention provides a compound according to formula (I), wherein G, X and Y are all a bond.
- the invention provides a compound according to formula (I), wherein G, X and Y are all selected from -(CH 2 ) M0 -.
- the invention provides a compound according to formula (I), wherein t is 1.
- the invention provides a compound according to formula (I), wherein the molecule is covalently linked to R via the ⁇ -amino group of a lysine residue. In another embodiment the invention provides a compound according to formula (I), wherein the molecule is covalently linked to R via the thiol group of a cysteine residue.
- the invention provides a compound according to formula (I), wherein the molecule is a therapeutic agent.
- the invention provides a compound according to formula (I), wherein the therapeutic agent is a biopolymer.
- the invention provides a compound according to formula (I), wherein the therapeutic agent is a polypeptide.
- the invention provides a compound according to formula (I), wherein the therapeutic agent is a small molecule drug.
- the present invention provides a compound according to formula (I), wherein the molecule is a polypeptide which is an insulinotropic peptide.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide which is GLP-1 (7-37) or a variant thereof.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide which is GLP-1 (7-37) or an analog thereof.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising the amino acid sequence of the formula (IV): Xaa 7 -Xaa 8 -Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaai6-Ser-Xaa 1 8-Xaa 1 9-Xaa 2 o-Glu-Xaa 22 -Xaa 2 3-Ala- Xaa 2 5-Xaa 26 -Xaa 27 -Phe-lle-Xaa 3 o-Trp-Leu-Xaa33-Xaa3 4 -Xaa35-Xaa36-Xaa37-Xaa3 8 -Xaa39- Xaa4o-Xaa4i -Xaa4 2 -Xaa43-Xaa44-Xaa45-Xaa46
- Formula (III) (SEQ ID No: 3) wherein Xaa 7 is L-histidine, D-histidine, desamino-histidine, 2-amino-3-(2-aminoimidazol-4- yl)propionic acid, ⁇ -hydroxy-histidine, homohistidine, N ⁇ -acetyl-histidine, ⁇ -fluoromethyl- histidine, ⁇ -methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine;
- Xaa 8 is Ala, GIy, VaI, Leu, lie, Lys, Aib, 1 -aminocyclopropanecarboxylic acid, 1 - aminocyclobutanecarboxylic acid, 1 -aminocyclopentanecarboxylic acid, 1 - aminocyclohexanecarboxylic acid, 1 -aminocycloheptanecarboxylic acid, or 1- aminocyclooctanecarboxylic acid;
- Xaaig is Tyr or GIn
- Xaa 22 is GIy, GIu or Aib;
- Xaa 23 is GIn, GIu 1 Lys or Arg;
- Xaa 2S is Ala or VaI
- Xaa 27 is GIu or Leu
- Xaa 30 is Ala, GIu or Arg
- Xaa 33 is VaI or Lys
- Xaa 36 is Arg, GIy or Lys
- Xaa 37 is GIy, Ala, GIu, Pro, Lys, amide or is absent;
- Xaa 3 a is Lys, Ser, amide or is absent;
- Xaa 39 is Ser, Lys, amide or is absent;
- Xaa 40 is GIy, amide or is absent;
- Xaa 4 i is Ala, amide or is absent;
- Xaa 42 is Pro, amide or is absent;
- Xaa 43 is Pro, amide or is absent;
- Xaa 44 is Pro, amide or is absent;
- Xaa 4 5 is Ser, amide or is absent;
- Xaa 46 is amide or is absent ; provided that if Xaa 3 8, Xaa 39 , Xaa4 0 , Xaa4i, Xaa4 2 , Xaa4 3 , Xaa44, Xaa4s or Xaa4 6 is absent then each amino acid residue downstream is also absent.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising the amino acid sequence of formula (V):
- Xaa 7 is L-histidine, D-histidine, desamino-histidine, 2-aminohistidine, ⁇ -hydroxy-histidine, homohistidine, N ⁇ -acetyl-histidine, ⁇ -fluoromethyl-histidine, ⁇ -methyl-histidine, 3- pyridylalanine, 2-pyridylalanine or 4-pyridylalanine;
- Xaa 8 is Ala, GIy, VaI, Leu, lie, Lys, Aib, 1 -aminocyclopropanecarboxylic acid, 1 - aminocyclobutanecarboxylic acid, 1-aminocyclopentanecarboxylic acid, 1- aminocyclohexanecarboxylic acid, 1 -aminocycloheptanecarboxylic acid, or 1- aminocyclooctanecarboxylic acid;
- Xaaie is Ser, Lys or Arg
- Xaa 22 is GIy, GIu or Aib
- Xaa 2 3 is GIn, GIu, Lys or Arg;
- Xaa 2 e is Lys, GIu or Arg;
- Xaa 3 o is Ala, GIu or Arg
- Xaa 34 is Lys, GIu or Arg; Xaa 35 is GIy or Aib;
- Xaa 3 e is Arg or Lys
- Xaa 3 7 is GIy, Ala, GIu or Lys;
- Xaa 38 is Lys, amide or is absent.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide selected from GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-amide, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40), GLP-1 (7-41 ) or an analog thereof.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising no more than fifteen amino acid residues which have been exchanged, added or deleted as compared to GLP-1 (7-37) (SEQ ID No. 1), or no more than ten amino acid residues which have been exchanged, added or deleted as compared to GLP-1 (7-37) (SEQ ID No. 1).
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising no more than six amino acid residues which have been exchanged, added or deleted as compared to GLP-1 (7-37) (SEQ ID No. 1).
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising no more than 4 amino acid residues which are not encoded by the genetic code.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide which is a DPP-IV protected insulinotropic peptide.
- the invention provides a compound according to formula (I), wherein the molecule is a polypeptide comprising an Aib residue in position 8.
- the invention provides a compound according to formula (I) 1 wherein the molecule is a GLP-1 (7-37) analog wherein the amino acid residue in position 7 of said polypeptide is selected from the group consisting of D-histidine, desamino-histidine, 2- amino-3-(2-aminoimidazol-4-yl)propionic acid, ⁇ -hydroxy-histidine, homohistidine, N ⁇ -acetyl- histidine, ⁇ -fluoromethyl-histidine, ⁇ -methyl-histidine, 3-pyridylalanine, 2-pyridylalanine and 4-pyridylalanine.
- the amino acid residue in position 7 of said polypeptide is selected from the group consisting of D-histidine, desamino-histidine, 2- amino-3-(2-aminoimidazol-4-yl)propionic acid, ⁇ -hydroxy-histidine, homohistidine, N ⁇ -acetyl- histidine, ⁇ -fluor
- the invention provides a compound according to formula (I), wherein the molecule is a GLP-1 (7-37) analog selected from the group consisting of Arg 34 GLP-1 (7- 37), Lys 38 Arg 26 ' 34 GLP-1 (7-38), Lys 38 Arg 26 ' 34 GLP-1 (7-38)-OH, Lys 36 Arg 26 ' 34 GLP-1 (7-36), Aib 8 ' 22 - 35 GLP-1 (7-37), Aib 8 ' 35 GLP-1 (7-37), Aib 8 ' 22 GLP-1 (7-37), Aib 8 ' 22 GLP-1 (7-37),
- the present invention provides a compound according to formula (I), wherein the molecule is exendin-4(1 -39) or an analog thereof.
- the invention provides a compound according to formula (I), wherein the molecule is an exendin-4 analog comprising no more than twelve amino acid residues which have been exchanged, added or deleted as compared to exendin-4(1-39) (SEQ ID No. 2), or no more than eight amino acid residues which have been exchanged, added or deleted as compared to exendin-4(1 -39) (SEQ ID No. 2).
- the invention provides a compound according to formula (I), wherein the molecule is ZP-10, i.e.
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-amide SEQ ID No. 5
- the invention provides a compound according to formula (I), wherein said compound is selected from the group consisting of N- ⁇ -26-(16-[5-tetrazolyl]hexadecanoyl)Arg 34 GLP-1 -(7-37),
- the present invention provides a compound according to formula (I), wherein the molecule is human growth hormone or an analog thereof. In another aspect the present invention provides a compound according to formula (I), wherein the molecule is human insulin or an analog thereof.
- the present invention provides a compound according to formula (I), wherein the molecule is factor VII or an analog thereof. In another aspect the present invention provides a compound according to formula (I), wherein the molecule is parathyroid hormone or an analog thereof.
- the present invention provides a compound according to formula (I), wherein the molecule is human follicle stimulating hormone or an analog thereof. In another embodiment the present invention provides a compound according to formula (I), wherein the molecule has a molar weight of less than 100 kDa, less than 50 kDa, or less than 10 kDa.
- the present invention provides a compound according to formula (I), wherein the molecule is selected from the group consisting of a growth factor such as platelet-derived growth factor (PDGF), transforming growth factor ⁇ (TGF- ⁇ ), transforming growth factor ⁇ (TGF- ⁇ ), epidermal growth factor (EGF), vascular endothelial growth factor (VEGF), a somatomedin such as insulin growth factor I (IGF-I), insulin growth factor Il (IFG-II), erythropoietin (EPO), thr ⁇ ' mbopoietin (TPO) or angiopoietin, interferon, pro-urokinase, urokinase, tissue plasminogen activator (t-PA), plasminogen activator inhibitor 1 , plasminogen activator inhibitor 2, von Willebrandt factor, a cytokine, e.g.
- a growth factor such as platelet-derived growth factor (PDGF), transforming growth factor ⁇
- interleukin such as interleukin (IL) 1 , IL-1 Ra, IL-2, IL-4, IL- 5, IL-6, IL-9, IL-11 , IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-20 or IL-21
- IL interleukin
- CFS colony stimulating factor
- stem cell factor such as GM-CSF
- tumor necrosis factor such as TNF- ⁇ , lymphotoxin- ⁇ , lymphotoxin- ⁇ , CD40L, or CD30L
- protease inhibitor e.g.
- aprotinin an enzyme such as superoxide dismutase, asparaginase, arginase, arginine deaminase, adenosine deaminase, ribonuclease, catalase, uricase, bilirubin oxidase, trypsin, papain, alkaline phosphatase, ⁇ -glucoronidase, purine nucleoside phosphorylase or batroxobin, an opioid, e.g. endorphins, enkephalins or non-natural opioids, a hormone or neuropeptide, e.g.
- an opioid e.g. endorphins, enkephalins or non-natural opioids
- a hormone or neuropeptide e.g.
- calcitonin glucagon, gastrins, adrenocorticotropic hormone (ACTH), cholecystokinins, lutenizing hormone, gonadotropin-releassing hormone, chorionic gonadotropin, corticotrophin-releasing factor, vasopressin, oxytocin, antidiuretic hormones, thyroid-stimulating hormone, thyrotropin-releasing hormone, relaxin, prolactin, peptide YY, neuropeptide Y, pancreastic polypeptide, leptin, CART (cocaine and amphetamine regulated transcript), a CART related peptide, perilipin, melanocortins (melanocyte-stimulating hormones) such as MC-4, melanin-concentrating hormones, natriuretic peptides, adrenomedullin, endothelin, secretin, amylin, vasoactive intestinal peptide (VIP),
- the present invention provides a compound of the general formula (II)
- G, X, Y, Z, A, Q, and R represent groups as defined in claim 3, and Lg is a leaving group, such as Cl, Br, I, OH, -OSO 2 Me, -OSO 2 CF 3 , -OTs, -SMe 2 + , -OSu, -OBt, -OAt, -OPh, or -0(4-NO 2 )Ph.
- Lg is a leaving group, such as Cl, Br, I, OH, -OSO 2 Me, -OSO 2 CF 3 , -OTs, -SMe 2 + , -OSu, -OBt, -OAt, -OPh, or -0(4-NO 2 )Ph.
- the present invention provides the use of a compound according to formula (II) for the synthesis of a compound according to formula (I).
- the therapeutic polypeptides can be produced by classical peptide synthesis, e.g. solid phase peptide synthesis using t-Boc or F-Moc chemistry or other well established techniques., see e.g. Green and Wuts, "Protecting Groups in Organic Synthesis", Jogn Wiley & Sons, 1999.
- the therapeutic polypeptides can also be produced by a method which comprises culturing a host cell containing a DNA sequence encoding the polypeptide and capable of expressing the polypeptide in a suitable nutrient medium under conditions permitting the expression of the peptide, after which the resulting peptide is recovered from the culture.
- the medium used to culture the cells may be any conventional medium suitable for growing the host cells, such as minimal or complex media containing appropriate supplements. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g. in catalogues of the American Type Culture Collection).
- the peptide produced by the cells may then be recovered from the culture medium by conventional procedures including separating the host cells from the medium by centrifugation or filtration.
- the proteinaceous components of the supernatant are isolated by filtration, column chromatography or precipitation, e.g. microfiltation, ultrafiltration, isoelectric precipitation, purification by a variety of chromatographic procedures, e.g. ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, affinity chromatography, or the like, dependent on the type of polypeptide in question.
- chromatographic procedures e.g. ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, affinity chromatography, or the like, dependent on the type of polypeptide in question.
- intracellular or periplasmic products the cells isolated from the culture medium are disintegrated or permeabilised and extracted to recover the product polypeptide or precursor thereof.
- the DNA sequence encoding the therapeutic polypeptide may suitably be of genomic or cDNA origin, for instance obtained by preparing a genomic or cDNA library and screening for DNA sequences coding for all or part of the peptide by hybridisation using synthetic oligonucleotide probes in accordance with standard techniques (see, for example, Sambrook, J, Fritsch, EF and Maniatis, T, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor
- the DNA sequence encoding the polypeptide may also be prepared synthetically by established standard methods, e.g. the phosphoamidite method described by Beaucage and Caruthers, Tetrahedron Letters 22 (1981), 1859 - 1869, or the method described by Matthes et al., EMBO Journal 3 (1984), 801 - 805.
- the DNA sequence may also be prepared by polymerase chain reaction using specific primers, for instance as described in US 4,683,202 or Saiki et al., Science 239 (1988), 487 - 491.
- the DNA sequence may be inserted into any vector which may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced.
- the vector may be an autonomously replicating vector, i.e. a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid.
- the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.
- the vector is preferably an expression vector in which the DNA sequence encoding the polypeptide is operably linked to additional segments required for transcription of the DNA, such as a promoter.
- the promoter may be any DNA sequence which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell. Examples of suitable promoters for directing the transcription of the DNA encoding the peptide of the invention in a variety of host cells are well known in the art, cf . for instance Sambrook et al., supra.
- the DNA sequence encoding the polypeptide may also, if necessary, be operably connected to a suitable terminator, polyadenylation signals, transcriptional enhancer sequences, and translational enhancer sequences.
- the recombinant vector of the invention may further comprise a DNA sequence enabling the vector to replicate in the host cell in question.
- the vector may also comprise a selectable marker, e.g. a gene the product of which complements a defect in the host cell or one which confers resistance to a drug, e.g. ampicillin, kanamycin, tetracyclin, chloramphenicol, neomycin, hygromycin or methotrexate.
- the selectable marker preferably is not antibiotic resistance, e.g. antibiotic resistance genes in the vector are preferably excised when the vector is used for large scale manufacture. Methods for eliminating antibiotic resistance genes from vectors are known in the art, see e.g. US 6,358,705 which is incorporated herein by reference.
- a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) may be provided in the recombinant vector.
- the secretory signal sequence is joined to the DNA sequence encoding the peptide in the correct reading frame.
- Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the peptide.
- the secretory signal sequence may be that normally associated with the peptide or may be from a gene encoding another secreted protein.
- the host cell into which the DNA sequence or the recombinant vector is introduced may be any cell which is capable of producing the present peptide and includes bacteria, yeast, fungi and higher eukaryotic cells.
- suitable host cells well'known and used in the art are, without limitation, E. coli, Saccharomyces cerevisiae, or mammalian BHK or CHO cell lines.
- compositions containing a compound according to the present invention may be prepared by conventional techniques, e.g. as described in Remington's
- One object of the present invention is to provide a pharmaceutical formulation comprising a compound according to the present invention which is present in a concentration from about 0.1 mg/ml to about 25 mg/ml, and wherein said formulation has a pH from 2.0 to 10.0.
- the formulation may further comprise a buffer system, preservative(s), isotonicity agent(s), chelating agent(s), stabilizers and surfactants.
- the pharmaceutical formulation is an aqueous formulation, i.e. formulation comprising water. Such formulation is typically a solution or a suspension.
- the pharmaceutical formulation is an aqueous solution.
- aqueous formulation is defined as a formulation comprising at least 50 %w/w water.
- aqueous solution is defined as a solution comprising at least 50 %w/w water
- aqueous suspension is defined as a suspension comprising at least 50 %w/w water.
- the pharmaceutical formulation is a freeze-dried formulation, whereto the physician or the patient adds solvents and/or diluents prior to use.
- the pharmaceutical formulation is a dried formulation (e.g. freeze-dried or spray-dried) ready for use without any prior dissolution.
- the invention relates to a pharmaceutical formulation comprising an aqueous solution of a compound according to the present invention, and a buffer, wherein said compound is present in a concentration from 0.1 mg/ml or above, and wherein said formulation has a pH from about 2.0 to about 10.0.
- a pharmaceutical formulation comprising an aqueous solution of a compound according to the present invention, and a buffer, wherein said compound is present in a concentration from about 1 mg/ml or above, and wherein said formulation has a pH from about 7.0 to about 8.5.
- the pH of the formulation is selected from the list consisting of 2.0, 2.1 , 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1 , 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1 , 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1 , 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1 , 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1 , 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1 , 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, and 10.0
- the buffer is selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine, glycine, lysine, arginin, sodium dihydrogen phosphate, disodium hydrogen phosphate, sodium phosphate, and tris(hydroxymethyl)-aminomethan, bicine, tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric acid, aspartic acid or mixtures thereof.
- Each one of these specific buffers constitutes an alternative embodiment of the invention.
- the formulation further comprises a pharmaceutically acceptable preservative.
- the preservative is selected from the group consisting of phenol, o-cresol, m-cresol, p-cresol, methyl p-hydroxybenzoate, propyl p-hydroxybenzoate, 2-phenoxyethanol, butyl p- hydroxybenzoate, 2-phenylethanol, benzyl alcohol, chlorobutanol, and thiomerosal, bronopol, benzoic acid, imidurea, chlorohexidine, sodium dehydroacetate, chlorocresol, ethyl p-hydroxybenzoate, benzethonium chloride, chlorphenesine (3p- chlorphenoxypropane-1 ,2-diol) or mixtures thereof.
- the preservative is present in a concentration from 0.1 mg/ml to 20 mg/ml. In a further embodiment of the invention the preservative is present in a concentration from 0.1 mg/ml to 5 mg/ml. In a further embodiment of the invention the preservative is present in a concentration from 5 mg/ml to 10 mg/ml. In a further embodiment of the invention the preservative is present in a concentration from 10 mg/ml to 20 mg/ml. Each one of these specific preservatives constitutes an alternative embodiment of the invention.
- the use of a preservative in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19* 1 edition, 1995.
- the formulation further comprises an isotonic agent.
- the isotonic agent is selected from the group consisting of a salt (e.g. sodium chloride), a sugar or sugar alcohol, an amino acid (e.g. L-glycine, L-histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g. glycerol (glycerine), 1 ,2-propanediol (propyleneglycol), 1 ,3- propanediol, 1 ,3-butanediol) polyethyleneglycol (e.g.
- Any sugar such as mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, soluble starch, hydroxyethyl starch and carboxymethylcellulose-Na may be used.
- the sugar additive is sucrose.
- Sugar alcohol is defined as a C4-C8 hydrocarbon having at least one -OH group and includes, for example, mannitol, sorbitol, inositol, galacititol, dulcitol, xylitol, and arabitol.
- the sugar alcohol additive is mannitol.
- the sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to the amount used, as long as the sugar or sugar alcohol is soluble in the liquid preparation and does not adversely effect the stabilizing effects achieved using the methods of the invention.
- the sugar or sugar alcohol concentration is between about 1 mg/ml and about 150 mg/ml.
- the isotonic agent is present in a concentration from 1 mg/ml to 50 mg/ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 1 mg/ml to 7 mg/ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 8 mg/ml to 24 mg/ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 25 mg/ml to 50 mg/ml. Each one of these specific isotonic agents constitutes an alternative embodiment of the invention.
- the use of an isotonic agent in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19* 1 edition, 1995.
- the formulation further comprises a chelating agent.
- the chelating agent is selected from salts of ethylenediaminetetraacetic acid (EDTA), citric acid, and aspartic acid, and mixtures thereof.
- the chelating agent is present in a concentration from 0.1 mg/ml to 5mg/ml.
- the chelating agent is present in a concentration from 0.1 mg/ml to 2mg/ml.
- the chelating agent is present in a concentration from 2mg/ml to 5mg/ml.
- Each one of these specific chelating agents constitutes an alternative embodiment of the invention.
- the use of a chelating agent in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19 th edition, 1995.
- the formulation further comprises a stabiliser.
- a stabilizer in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19* edition, 1995.
- compositions of the invention are stabilized liquid pharmaceutical compositions whose therapeutically active components include a polypeptide that possibly exhibits aggregate formation during storage in liquid pharmaceutical formulations.
- aggregate formation is intended a physical interaction between the polypeptide molecules that results in formation of oligomers, which may remain soluble, or large visible aggregates that precipitate from the solution.
- during storage is intended a liquid pharmaceutical composition or formulation once prepared, is not immediately administered to a subject. Rather, following preparation, it is packaged for storage, either in a liquid form, in a frozen state, or in a dried form for later reconstitution into a liquid form or other form suitable for administration to a subject.
- liquid pharmaceutical composition or formulation is dried either by freeze drying (i.e., lyophilization; see, for example, Williams and PoIIi (1984) J. Parenteral Sci. Technol. 38:48-59), spray drying (see Masters (1991) in Spray-Drying Handbook (5th ed; Longman Scientific and Technical,
- compositions of the invention may further comprise an amount of an amino acid base sufficient to decrease aggregate formation by the polypeptide during storage of the composition.
- amino acid base is intended an amino acid or a combination of amino acids, where any given amino acid is present either in its free base form or in its salt form. Where a combination of amino acids is used, all of the amino acids may be present in their free base forms, all may be present in their salt forms, or some may be present in their free base forms while others are present in their salt forms.
- amino acids to use in preparing the compositions of the invention are those carrying a charged side chain, such as arginine, lysine, aspartic acid, and glutamic acid. Any stereoisomer (i.e.
- R or S-isomers - or L, D or DL-isomer) of a particular amino acid e.g. alanine, methionine methionine, histidine, imidazole, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine and mixtures thereof
- a particular amino acid e.g. alanine, methionine methionine, histidine, imidazole, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine and mixtures thereof
- the L-stereoisomer is used, which denotes the most abundant form of aminoacids.
- the L-form may be an R or an S isomer dependent on the specific aminoacid.
- compositions of the invention may also be formulated with analogues of these amino acids.
- amino acid analogue is intended a derivative of the naturally occurring amino acid that brings about the desired effect of decreasing aggregate formation by the polypeptide during storage of the liquid pharmaceutical compositions of the invention.
- suitable arginine analogues include, for example, aminoguanidine, ornithine and N-monoethyl L-arginine
- suitable methionine analogues include S-ethyl homocysteine and S-butyl homocysteine
- suitable cystein analogues include S-methyl-L cystein.
- the amino acid analogues are incorporated into the compositions in either their free base form or their salt form.
- the amino acids or amino acid analogues are used in a concentration, which is sufficient to prevent or delay aggregation of the protein.
- methionine (or other sulphur containing amino acids or amino acid analogous) may be added to inhibit oxidation of methionine residues to methionine sulfoxide when the polypeptide acting as the therapeutic agent is a polypeptide comprising at least one methionine residue susceptible to such oxidation.
- inhibitor is intended minimal accumulation of methionine oxidized species over time. Inhibiting methionine oxidation results in greater retention of the polypeptide in its proper molecular form. Any stereoisomer of methionine (L, D, or DL isomer) or combinations thereof can be used.
- the amount to be added should be an amount sufficient to inhibit oxidation of the methionine residues such that the amount of methionine sulfoxide is acceptable to regulatory agencies. Typically, this means that the composition contains no more than about 10% to about 30% methionine sulfoxide. Generally, this can be achieved by adding methionine such that the ratio of methionine added to methionine residues ranges from about 1 :1 to about 1000:1 , such as 10:1 to about 100:1.
- the formulation further comprises a stabiliser selected from the group of high molecular weight polymers or low molecular compounds.
- the stabilizer is selected from polyethylene glycol (e.g.
- PEG 3350 polyvinylalcohol (PVA), polyvinylpyrrolidone, carboxy- /hydroxycellulose or derivates thereof (e.g. HPC, HPC-SL, HPC-L and HPMC) 1 cyclodextrins, sulphur-containing substances as monothioglycerol, thioglycolic acid and 2- methylthioethanol, and different salts (e.g. sodium chloride).
- PVA polyvinylalcohol
- PVA polyvinylpyrrolidone
- carboxy- /hydroxycellulose or derivates thereof e.g. HPC, HPC-SL, HPC-L and HPMC
- sulphur-containing substances e.g. sodium chloride
- compositions may also comprise additional stabilizing agents, which further enhance stability of a therapeutically active polypeptide therein.
- Stabilizing agents of particular interest to the present invention include, but are not limited to, methionine and EDTA, which protect the polypeptide against methionine oxidation, and a nonionic surfactant, which protects the polypeptide against aggregation associated with freeze-th awing or mechanical shearing.
- the formulation further comprises a surfactant.
- the surfactant is selected from a detergent, ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides, sorbitan fatty acid esters, polyoxypropylene-polyoxyethylene block polymers (eg. poloxamers such as Pluronic ® F68, poloxamer 188 and 407, Triton X-100 ), polyoxyethylene sorbitan fatty acid esters, polyoxyethylene and polyethylene derivatives such as alkylated and alkoxylated derivatives (tweens, e.g.
- Tween-20, Tween-40, Tween-80 and Brij-35 monoglycerides or ethoxylated derivatives thereof, diglycerides or polyoxyethylene derivatives thereof, alcohols, glycerol, lecitins and phospholipids (eg. phosphatidyl serine, phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl inositol, diphosphatidyl glycerol and sphingomyelin), derivates of phospholipids (eg. dipalmitoyl phosphatidic acid) and lysophospholipids (eg.
- phospholipids eg. dipalmitoyl phosphatidic acid
- lysophospholipids eg.
- ceramides e.g. sodium tauro-dihydrofusidate etc.
- C6-C12 e.g.
- acylcarnitines and derivatives N ⁇ -acylated derivatives of lysine, arginine or histidine, or side-chain acylated derivatives of lysine or arginine, N ⁇ -acylated derivatives of dipeptides comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, N ⁇ -acylated derivative of a tripeptide comprising any combination of a neutral amino acid and two charged amino acids, DSS (docusate sodium, CAS registry no [577-11-7]), docusate calcium, CAS registry no [128-49-4]), docusate potassium, CAS registry no [7491-09-0]), SDS (sodium dodecyl sulfate or sodium lauryl sulfate), sodium caprylate, cholic acid or derivatives thereof, bile acids and salts thereof and glycine or taurine
- N-alkyl-N,N- dimethylammonio-1 -propanesulfonates 3-cholamido-1 -propyldimethylammonio-1 - propanesulfonate
- cationic surfactants quarternary ammonium bases
- cetyl- trimethylammonium bromide cetylpyridinium chloride
- non-ionic surfactants eg. dodecyl ⁇ - D-glucopyranoside
- poloxamines eg.
- Tetronic's which are tetrafunctional block copolymers derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine, or the surfactant may be selected from the group of imidazoline derivatives, or mixtures thereof. Each one of these specific surfactants constitutes an alternative embodiment of the invention.
- Such additional ingredients may include wetting agents, emulsifiers, antioxidants, bulking agents, tonicity modifiers, chelating agents, metal ions, oleaginous vehicles, proteins (e.g., human serum albumin, gelatin or proteins) and a zwitterion (e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
- additional ingredients should not adversely affect the overall stability of the pharmaceutical formulation of the present invention.
- compositions containing a compound according to the present invention may be' administered to a patient in need of such treatment at several sites, for example, at topical sites, for example, skin and mucosal sites, at sites which bypass absorption, for example, administration in an artery, in a vein, in the heart, and at sites which involve absorption, for example, administration in the skin, under the skin, in a muscle or in the abdomen.
- topical sites for example, skin and mucosal sites
- sites which bypass absorption for example, administration in an artery, in a vein, in the heart
- sites which involve absorption for example, administration in the skin, under the skin, in a muscle or in the abdomen.
- Administration of pharmaceutical compositions according to the invention may be through several routes of administration, for example, lingual, sublingual, buccal, in the mouth, oral, in the stomach and intestine, nasal, pulmonary, for example, through the bronchioles and alveoli or a combination thereof, epidermal, dermal, transdermal, vaginal, rectal, ocular, for examples through the conjunctiva, uretal, and parenteral to patients in need of such a treatment.
- routes of administration for example, lingual, sublingual, buccal, in the mouth, oral, in the stomach and intestine, nasal, pulmonary, for example, through the bronchioles and alveoli or a combination thereof, epidermal, dermal, transdermal, vaginal, rectal, ocular, for examples through the conjunctiva, uretal, and parenteral to patients in need of such a treatment.
- compositions of the current invention may be administered in several dosage forms, for example, as solutions, suspensions, emulsions, microemulsions, multiple emulsion, foams, salves, pastes, plasters, ointments, tablets, coated tablets, rinses, capsules, for example, hard gelatine capsules and soft gelatine capsules, suppositories, rectal capsules, drops, gels, sprays, powder, aerosols, inhalants, eye drops, ophthalmic ointments, ophthalmic rinses, vaginal pessaries, vaginal rings, vaginal ointments, injection solution, in situ transforming solutions, for example in situ gelling, in situ setting, in situ precipitating, in situ crystallization, infusion solution, and implants.
- solutions for example, suspensions, emulsions, microemulsions, multiple emulsion, foams, salves, pastes, plasters, ointments, tablets, coated tablets, rinses,
- compositions of the invention may further be compounded in, or attached to, for example through covalent, hydrophobic and electrostatic interactions, a drug carrier, drug delivery system and advanced drug delivery system in order to further enhance stability of the compound, increase bioavailability, increase solubility, decrease adverse effects, achieve chronotherapy well known to those skilled in the art, and increase patient compliance or any combination thereof.
- carriers, drug delivery systems and advanced drug delivery systems include, but are not limited to, polymers, for example cellulose and derivatives, polysaccharides, for example dextran and derivatives, starch and derivatives, polyvinyl alcohol), acrylate and methacrylate polymers, polylactic and polyglycolic acid and block co-polymers thereof, polyethylene glycols, carrier proteins, for example albumin, gels, for example, thermogelling systems, for example block co-polymeric systems well known to those skilled in the art, micelles, liposomes, microspheres, nanoparticulates, liquid crystals and dispersions thereof, L2 phase and dispersions there of, well known to those skilled in the art of phase behaviour in lipid-water systems, polymeric micelles, multiple emulsions, self-emulsifying, self-microemulsifying, cyclodextrins and derivatives thereof, and dendrimers.
- polymers for example cellulose and derivatives, polysaccharides, for example dextran and derivatives
- compositions of the current invention are useful in the formulation of solids, semisolids, powder and solutions for pulmonary administration of the compound, using, for example a metered dose inhaler, dry powder inhaler and a nebulizer, all being devices well known to those skilled in the art.
- compositions of the current invention are specifically useful in the formulation of controlled, sustained, protracting, retarded, and slow release drug delivery systems. More specifically, but not limited to, compositions are useful in formulation of parenteral controlled release and sustained release systems (both systems leading to a many-fold reduction in number of administrations), well known to those skilled in the art. Even more preferably, are controlled release and sustained release systems administered subcutaneous.
- examples of useful controlled release system and compositions are hydrogels, oleaginous gels, liquid crystals, polymeric micelles, microspheres, nanoparticles,
- Methods to produce controlled release systems useful for compositions of the current invention include, but are not limited to, crystallization, condensation, co- cystallization, precipitation, co-precipitation, emulsification, dispersion, high pressure homogenization, encapsulation, spray drying, microencapsulation, coacervation, phase separation, solvent evaporation to produce microspheres, extrusion and supercritical fluid processes.
- General reference is made to Handbook of Pharmaceutical Controlled Release (Wise, D. L., ed.
- Parenteral administration may be performed by subcutaneous, intramuscular, intraperitoneal or intravenous injection by means of a syringe, optionally a pen-like syringe. Alternatively, parenteral administration can be performed by means of an infusion pump.
- a further option is a composition which may be a solution or suspension for the administration of the compound according to the present invention in the form of a nasal or pulmonal spray.
- the pharmaceutical compositions containing the compound of the invention can also be adapted to transdermal administration, e.g. by needle-free injection or from a patch, optionally an iontophoretic patch, or transmucosal, e.g. buccal, administration.
- stabilized formulation refers to a formulation with increased physical stability, increased chemical stability or increased physical and chemical stability.
- physical stability of the protein formulation as used herein refers to the tendency of the protein to form biologically inactive and/or insoluble aggregates of the protein as a result of exposure of the protein to thermo-mechanical stresses and/or interaction with interfaces and surfaces that are destabilizing, such as hydrophobic surfaces and interfaces.
- Physical stability of the aqueous protein formulations is evaluated by means of visual inspection and/or turbidity measurements after exposing the formulation filled in suitable containers (e.g. cartridges or vials) to mechanical/physical stress (e.g. agitation) at different temperatures for various time periods. Visual inspection of the formulations is performed in a sharp focused light with a dark background.
- the turbidity of the formulation is characterized by a visual score ranking the degree of turbidity for instance on a scale from 0 to 3 (a formulation showing no turbidity corresponds to a visual score 0, and a formulation showing visual turbidity in daylight corresponds to visual score 3).
- a formulation is classified physical unstable with respect to protein aggregation, when it shows visual turbidity in daylight.
- the turbidity of the formulation can be evaluated by simple turbidity measurements well-known to the skilled person.
- Physical stability of the aqueous protein formulations can also be evaluated by using a spectroscopic agent or probe of the conformational status of the protein.
- the probe is preferably a small molecule that preferentially binds to a non-native conformer of the protein.
- Thioflavin T is a fluorescent dye that has been widely used for the detection of amyloid fibrils. In the presence of fibrils, and perhaps other protein configurations as well, Thioflavin T gives rise to a new excitation maximum at about 450 nm and enhanced emission at about 482 nm when bound to a fibril protein form. Unbound Thioflavin T is essentially non-fluorescent at the wavelengths.
- hydrophobic patch probes that bind preferentially to exposed hydrophobic patches of a protein.
- the hydrophobic patches are generally buried within the tertiary structure of a protein in its native state, but become exposed as a protein begins to unfold or denature.
- these small molecular, spectroscopic probes are aromatic, hydrophobic dyes, such as antrhacene, acridine, phenanthroline or the like.
- spectroscopic probes are metal-amino acid complexes, such as cobalt metal complexes of hydrophobic amino acids, such as phenylalanine, leucine, isoleucine, methionine, and valine, or the like.
- chemical stability of the protein formulation refers to chemical covalent changes in the protein structure leading to formation of chemical degradation products with potential less biological potency and/or potential increased immunogenic properties compared to the native protein structure.
- chemical degradation products can be formed depending on the type and nature of the native protein and the environment to which the protein is exposed. Elimination of chemical degradation can most probably not be completely avoided and increasing amounts of chemical degradation products is often seen during storage and use of the protein formulation as well-known by the person skilled in the art.
- Most proteins are prone to deamidation, a process in which the side chain amide group in glutaminyl or asparaginyl residues is hydrolysed to form a free carboxylic acid.
- a “stabilized formulation” refers to a formulation with increased physical stability, increased chemical stability or increased physical and chemical stability.
- a formulation must be stable during use and storage (in compliance with recommended use and storage conditions) until the expiration date is reached.
- the pharmaceutical formulation comprising the compound according to the present invention is stable for more than 6 weeks of usage and for more than 3 years of storage. In another embodiment of the invention the pharmaceutical formulation comprising the compound according to the present invention is stable for more than 4 weeks of usage and for more than 3 years of storage.
- the pharmaceutical formulation comprising the compound according to the present invention is stable for more than 4 weeks of usage and for more than two years of storage.
- the pharmaceutical formulation comprising the compound is stable for more than 2 weeks of usage and for more than two years of storage.
- the present invention relates to the use of a compound according to the invention for the preparation of a medicament.
- a compound according to the invention wherein the therapeutic agent is a GLP-1 peptide is used for the preparation of a medicament for the treatment or prevention of hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, obesity, hypertension, syndrome X, dyslipidemia,disorders associated with toxic hypervolemia, cognitive disorders, atherosclerosis, myocardial infarction, coronary heart disease, stroke and other cardiovascular disorders, inflammatory bowel syndrome, dyspepsia and gastric ulcers.
- a compound according to the invention wherein the therapeutic agent is a GLP-1 peptide is used for the preparation of a medicament for delaying or preventing disease progression in type 2 diabetes.
- a compound according to the invention wherein the therapeutic agent is a GLP-1 peptide is used for the preparation of a medicament for decreasing food intake, decreasing ⁇ -cell apoptosis, increasing ⁇ -cell function and ⁇ -cell mass, stimulating ⁇ -cell regeneration, and/or for restoring glucose sensitivity to ⁇ -cells.
- the present invention relates to the use of a compound according to the invention wherein the therapeutic agent is a GLP-2 peptide for the preparation of a medicament for the treatment of small bowel syndrome, inflammatory bowel syndrome or Crohns disease.
- the present invention relates to the use of a compound according to the invention wherein the therapeutic agent is an insulin peptide for the preparation of a medicament for the treatment of hyperglycemia, type 1 diabetes, type 2 diabetes or ⁇ -cell deficiency.
- the treatment with a compound according to the present invention may also be combined with combined with a second or more pharmacologically active substances, e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
- a second or more pharmacologically active substances e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
- Examples of these pharmacologically active substances are : Insulin, GLP-1 agonists, sulphonylureas, biguanides, meglitinides, glucosidase inhibitors, glucagon antagonists, DPP-IV (dipeptidyl peptidase-IV) inhibitors, inhibitors of hepatic enzymes involved in stimulation of gluconeogenesis and/or glycogenosis, glucose uptake modulators, compounds modifying the lipid metabolism such as antihyperlipidemic agents as HMG CoA inhibitors (statins), compounds lowering food intake, RXR agonists and agents acting on the ATP-dependent potassium channel of the ⁇ -cells; Cholestyramine, colestipol, clofibrate, gemfibrozil, lovastatin, pravastatin, simvastatin, probucol, dextrothyroxine, neteglinide, repaglinide; ⁇ - blockers such as alprenolo
- DMPU 1 ,3-dimethyltetrahydropyrimidin-2-one EDC or EDAC N-ethyl-N'-(3-dimethylaminopropyl)carbodiimide hydrochloride
- HOAt 3-hydroxy-3H-[1 ,2,3]triazolo[4,5-b]pyridine, 4-aza-3-hydroxybenzotriazole
- HOBt N-hydroxybenzotriazole, 1 -hydroxybenzotriazole
- HONSu N-hydroxysuccinimide
- Trt trityl, triphenylmethyl
- HPLC-systems from Merck-Hitachi (HibarTM RT 250-4, LichrosorbTM RP 18, 5.0 ⁇ m, 4.0 x 250 mm, gradient elution, 20% to 80% acetonitrile in water within 30 min, 1.0 ml/min, detection at 254 nm) and Waters (SymmetryTM, C18, 3.5 ⁇ m, 3.0 x 150 mm, gradient elution, 5% to 90% acetonitrile in water within 15 min, 1.0 ml/min, detection at 214 nm) were 5 used.
- HPLC method h8 The reverse phase analysis was performed using UV detections at 214, 254, 276 and 301 nm on a 218TP54 4.6 mm x 150 mm C-18 silica column, which was eluted at 1 ml/min at 42 S C.
- the column was equilibrated with 5% acetonitrile, 85% water and 10% of a solution of 0 0.5% trifluoroacetic acid in water and eluted by a linear gradient from 5% acetonitrile, 85% water and 10% of a solution of 0.5% trifluoroacetic acid to 90% acetonitrile and 10% of a solution of 0.5% trifluoroacetic acid over 15 min.
- HPLC method A The RP-analysis was performed using a Waters 2690 systems fitted with a Waters 996 5 diode array detector. L)V detections were collected at 214, 254, 276, and 301 nm on a 218TP54 4.6 mm x 250 mm 5 ⁇ C-18 silica column (The Seperations Group, Hesperia), which was eluted at 1 ml/min at 42 0 C. The column was equilibrated with 5% acetonitrile (+ 0.1% TFA) in an aqueous solution of TFA in water (0.1%). After injection, the sample was eluted by a gradient of 0% to 90% acetonitrile (+ 0.1% TFA) in an aqueous solution of TFA 0 in water (0.1%) during 50 min.
- the compounds of formula (I) according to the invention may be prepared by the general procedure (A):
- a molecule of which a prolonged halflife in plasma is required and which contains at least one acylable amino group is dissolved in a suitable solvent (water, alcohols, DMF, DMSO, DMPL ) , or mixtures thereof) and a solution or suspension of (II) in DMF or DMSO is added.
- a suitable solvent water, alcohols, DMF, DMSO, DMPL ) , or mixtures thereof
- a solution or suspension of (II) in DMF or DMSO is added.
- the mixture is stirred at room temperature and the progress of the reaction is followed by HPLC. If the reaction proceeds too slowly catalytic amounts of DMAP may be added.
- the product is isolated by preparative HPLC of the whole reaction mixture.
- a ⁇ -haloalkanoic acid or ester is treated with a slight excess of NaCN or KCN in a suitable solvent, such as DMF, DMSO, acetone, or an alcohol until complete conversion to the nitrile has taken place.
- a suitable solvent such as DMF, DMSO, acetone, or an alcohol.
- the reaction is followed by analyzing samples by 1 H NMR.
- the resulting ⁇ -cyanoalkanoic acid or ester is isolated by dilution with water and extraction with AcOEt or DCM.
- the general procedure (B) may also be conducted with an co-halo alkanoic ester instead of an acid. Saponification of the resulting o>(tetrazol-5-yl)alkanoic ester to the corresponding acid can be performed by treatment with an excess KOH or NaOH in a mixture of water and ethanol.
- An «>-(5-tetrazolyl)alkanoic acid is converted into an acyl halide or N-hydroxysuccinimidyl ester, and then coupled to lysine methyl ester. Saponification of the resulting product yields N,N'-bis( ⁇ >-(5-tetrazolyl)alkanoyl)lysine.
- a ⁇ -haloalkanoic acid or ester is treated with a cyanophenol, cyanothiophenol, dicyanophenol, cyanobiphenylol, cyanoterphenylol, cyanoaniline, cyanohydroxyheteroarene, or a related reagent containing at least one cyano group and one arene- or heteroarene-bound hydroxyl group in the presence of a base such as K 2 CO 3 or DBU in a suitable solvent, such as DMF, DMSO, acetone, or an alcohol until complete conversion to the aryl or heteroarylether, -thioether, or -amine has taken place.
- a base such as K 2 CO 3 or DBU
- a suitable solvent such as DMF, DMSO, acetone, or an alcohol until complete conversion to the aryl or heteroarylether, -thioether, or -amine has taken place.
- the reaction is followed by analyzing samples by 1 H NMR, The resulting ⁇ -aryloxy-, ⁇ -arylthio-, or ⁇ - arylaminoalkanoic acid or ester is isolated by dilution with water and extraction with AcOEt or DCM.
- Treatment of this product with NaN 3 in the presence of AcOH and NEt 3 in DMF at 140 0 C until all the starting material is consumed (as determined by 1 H NMR) yields the corresponding ⁇ -(5-tetrazolyl)aryloxy-, ⁇ -(5-tetrazolyl)arylthio-, or ⁇ -(5- tetrazolyl)arylaminoalkanoic acid or ester.
- the ester it is converted to the acid by treatment with an excess of NaOH or KOH in a mixture of water and an alcohol.
- the peptides were synthesized on Fmoc protected Rink amide resin (Novabiochem), Fmoc protected Wang resin or chlorotrityl resin using Fmoc strategy on an Applied Biosystems 433A peptide synthesizer in 0.25 mmol scale using the manufacturer supplied FastMoc UV protocols which employ HBTU mediated couplings in NMP and UV monitoring of the deprotection of the Fmoc protection group.
- the protected amino acid derivatives used were standard Fmoc-amino acids (Anaspec) supplied in preweighed cartridges suitable for the ABI 433A synthesizer with the exception of unnatural aminoacids such as Fmoc-Aib-OH (Fmoc-aminoisobutyric acid).
- the amino acid (4 molar equivalents relative to resin) was dissolved in NMP (10 ml). HOBt (4 molar equivalents relative to resin) and diisopropylcarbodiimide (4 molar equivalents relative to resin) were added and the solution was stirred for 15 min. The solution was added to the resin and DIPEA (4 molar equivalents relative to resin) was added. The resin was shaken 24 hours at room temperature. The resin was washed with NMP (2 x 20 ml), NMFI/DCM (1 :1 ; 2 x 20ml) and DCM (2 x 20 ml).
- Procedure for cleaving the peptide from the resin The peptide was cleaved from the resin by stirring for 180 min at room temperature with a mixture of TFA, water and triisopropylsilane (95:2.5:2.5). The cleavage mixture was filtered and the filtrate was concentrated to an oil by a stream of nitrogen. The crude peptide was precipitated from this oil with 45 ml diethyl ether and washed 3 times with 45 ml diethyl ether.
- the crude peptide was purified by semipreparative HPLC on a 25 mm x 250 mm column packed with 5 ⁇ C-18 silica.
- B1 Equilibration of the column with 0.1% TFA / H2O and elution by a gradient of 0% CH3CN / 0.1% TFA / H2O to 60% CH3CN / 0.1% TFA / H2O during 50 min.
- B6 Equilibration of the column with 0.1% TFA / H2O and elution by a gradient of 0% CH3CN / 0.1% TFA / H2O to 90% CH3CN / 0.1% TFA / H2O during 50 min.
- LCMS was performed on a setup consisting of Hewlett Packard series 1100 G1312A Bin Pump, Hewlett Packard series 1100 Column compartment, Hewlett Packard series 1100 G1315A DAD diode array detector, Hewlett Packard series 1100 MSD and Sedere 75 Evaporative Light Scattering detectorcontrolled by HP Chemstation software.
- the HPLC pump is connected to two eluent reservoirs containing: A: 10mM NH4OH in water B: 1OmM NH4OH in 90% acetonitrile
- the analysis was performed at 23 0 C by injecting an appropriate volume of the sample (preferably 20 ⁇ l) onto the column which is eluted with a gradient of A and B.
- an appropriate volume of the sample preferably 20 ⁇ l
- the HPLC conditions, detector settings and mass spectrometer settings used are giving in the following table.
- ELS analogue output from ELS
- a resin (Fmoc-Gly-Wang resin, 0.6 mmol/g Novabiochem 0.25 mmole) was used to produce the primary sequence on an ABI 433A machine according to manufacturers guidelines.
- the resin (0.25 mmole) was placed in a manual shaker/filtration apparatus and treated with 2% hydrazine in NMP in (2x12 min. 2x20 ml) to remove the Dde group.
- the resin was washed with NMP (4x20 ml).
- Fmoc-8-amino-3,6-dioxaoctanoic acid (Neosystem FA03202) (4 molar equivalents relative to resin) was dissolved in NMP/DCM (1 :1 , 20 ml).
- the crude peptide was purified by preparative HPLC on a 20 mm x 250 mm column packed with 7 ⁇ C-18 silica.
- the crude peptide was dissolved in 5 ml 50% acetic acid in water and diluted to 20 ml with H2O and injected on the column which then was eluted with a gradient of 40-60 % (CH3CN in water with 0.1 % TFA) 10 ml/min during 50 min at 40 0 C.
- the peptide containing fractions were collected.
- the purified peptide was lyophilized after dilution of the eluate with water.
- the binding assay was performed with purified plasma membranes containing the human GLP-1 receptor.
- the plasma membranes containing the receptors were purified from stably expressing BHK tk-ts 13 cells.
- 16-Bromohexadecanoic acid methyl ester A mixture of 16-bromohexadecanoic acid (15.5 g, 46.2 mmol), MeOH (100 ml), PhMe (30 ml), trimethylorthoformate (30 ml), and polystyrene-bound benzenesulfonic acid (3.6 g) was stirred at 55 °C. After 69 h the mixture was filtered through celite and the filtrate was concentrated to yield 16.85 g of an oil (100% yield).
- 16-(4'-(5-Tetrazolyl)biphenyl-4-yloxy)hexadecanoic acid methyl ester A mixture of (4'-cyanobiphenyl-4-yloxy)hexadecanoic acid methyl ester (2.75 g, 5.93 mmol), DMF (7.0 ml), NEt 3 (4.0 ml, 28.9 mmol), AcOH (1.75 ml, 29.1 mmol), and NaN 3 (2.50 g, 38.5 mmol) was stirred at 140 0 C. After 17 h water (50 ml) and 1 N HCI (50 ml) were added, followed by acidification with cone. HCI (approx 2 ml).
- 16-(4'-(5-Tetrazolyl)biphenyl-4-yloxy)hexadecanoic acid A mixture of 16-(4'-(5-tetrazolyl)biphenyl-4-yloxy)hexadecanoic acid methyl ester (2.87 g, 5.66 mmol), MeOH (30 ml), and a solution of NaOH (1.51 g, 37.8 mmol) in water (2.0 ml) was stirred at 70 °C. After 4 d water (100 ml) and 1 N HCI (50 ml) were added, and the product was filtered, washed with water, coevaporated with MeCN/PhMe, and dried under reduced pressure. 2.68 g (96%) of 16-(4'-(5-tetrazolyl)biphenyl-4-yloxy)hexadecanoic acid was obtained.
- This compound was prepared by acylation with 16-[5-tetrazolyl]hexadecanoic acid (Example 1 ) of unprotected Arg 34 GLP-1 -(7-37) peptide in solution.
- the succinimidyl ester of 16-[5- tetrazolyl]hexadecanoic acid was prepared by mixing the acid (29 mg) with THF (0.9 ml), DIPEA (17 microliter), and TSTU (30 mg), and stirring the resulting mixture at room temperature for 1 h.
- Example 6 The title compound was prepared as Example 6 from ⁇ 4-[N-(16- ⁇ 5- tetrazolyl ⁇ hexadecanoyl)sulfamoyl]butyric acid (21 mg; Example 2) and Gly 8 ,Arg 26 ' 34 GLP-
- This compound was prepared as Example 5 from ⁇ 4-[N-(16- ⁇ 5- tetrazolyl ⁇ hexadecanoyl)sulfamoyl]butyric acid (21 mg; Example 2) and Arg 34 GLP-1 (7-37) peptide (0.3 g, 30% pure). 10.1 mg of the title compound was obtained.
- Example 10 Human growth hormone (100 mg, hGH) was dissolved in H 2 O (6 ml), DIEA (7.5 ⁇ l), and NMP (6 ml) and cooled to 0 0 C. 16-(Tetrazol-5-yl)hexadecanoyl-ONSu (3.5 mg, 2 eq), dissolved in NMP (100 ⁇ l), was added. The reaction mixture was stirred for 1 h and purified by ion exchange chromatography. Purification of monoacylated hGH in position 140 or 145. The crude reaction mixture was diluted five times in 50 mM Tris pH 8.5 and applied to a Mono Q column.
- fractions containing monoacylated hGH (peak 2) was pooled and subsequently ultrafiltrated using a Amicon with a YM10 filter.
- the washing buffer was 50 mM Ammoniumcarbonate pH 8.0.
- the acylated protein was lyophillised.
- Peak 1 contains native hGH
- Peak 2 contains monoacylated hGH in position 38 or 45 or 70.
- Peak 3 contains monoacylated hGH in position 140 or 145
- Peak 4 contains diacylated hGH
- Peak 5 contains triacylated hGH
- Gly 8 Glu 22 ' 23 ' 30 Arg 18 ' 26 ' 34
- GLP-1 (7-37)Lys(16-(1 H-tetrazol-5-yl)hexadecanoic acid [2-(2- ⁇ [2-(2- carbamoylmethoxyethoxy)ethylcarbamoyl]methoxy ⁇ ethoxy)ethyl]amide)-NH 2
- GLP-1-(7-37) peptide was prepared on an Advanced Chemtech APEX 348 peptide synthesizer using standard Fmoc methodology and using 2-chlorotrityl chloride resin (0.400 g, loading: 1.4 mmol/g) as starting resin. Lys38 was protected as Fmoc-Lys(ivDde)-OH.
- GLP-1 (7-37) peptide was prepared on an Advanced ChemTech APEX 348 peptide synthesizer using Standard Fmoc methodology and using 2-chlorotrityl chloride resin (0.400 g, loading: 1.4 mmol/g) as starting resin. Lys37 was protected as Fmoc- Lys(ivDde)-OH. IvDde was removed with 3% hydrazine and 3% piperidin in NMP for 60 min.
- the resin-bound peptide was acylated with N-Fmoc (2-(2- aminoethoxy)ethoxy)acetic acid (0.59 mmol), followed by Fmoc-group removal and acylation with 0.62 mmol of 16-(4-(5-tetrazolyl)phenoxy)hexadecanoic acid.
- the peptide was cleaved from the support (90% TFA, 5% Tis, 2% thioanisol, 3% water, 2 h), precipitated with Et 2 O, lyophilized, and purified by preparative RP-HPLC (gradient elution 0-5 min: 80% A, 20% B; 5-45 min to 40% A, 60% B; A: water + 0.1% TFA; B: MeCN + 0.07% TFA).
- LCMS 4005. Calculated: 4005.6
- [Lys32]Exendin[1 -39] peptide was prepared on the Advanced ChemTech APEX 348 peptide synthesizer using standard Fmoc methodology and 2-chlorotrityl chloride resin (0.150 g, loading: 1.4 mmol/g) as starting resin. Lys38 was protected as Fmoc-Lys(ivDde)- OH. lvDde protection was removed with 3% hydrazine and 3% piperidin in NMP for 60 min.
- the resin-bound peptide was acylated with N-Fmoc (2-(2- aminoethoxy)ethoxy)acetic acid (0.35 mmol), followed by Fmoc-group removal and acylation with 0.32 mmol of 4-(16-(5-tetrazolyl)hexadecanoyl)sulfamoylbutyric acid.
- the peptide was cleaved from the support (90% TFA, 5% Tis, 2% thioanisol, 3% water, 2 h), precipitated with Et 2 O, lyophilized, and purified by preparative RP-HPLC (gradient elution 0- 5 min: 80% A, 20% B; 5-45 min to 40% A, 60% B; A: water + 0.1% TFA; B: MeCN + 0.07% TFA).
- [3-(4-Imidazolyl)Propionyl7,Aib22,35,Arg26,34,Lys37]GLP-1 (7-37) peptide was prepared on a 433A peptide synthesizer using standard Fmoc-methodology and using Fmoc- Lys(Boc)-trityl polystyrene (0.51 g, loading: 0.50 mmol/g) as starting resin. After purification by preparative HPLC 159 mg of [3-(4-imidazolyl)propionyl7,Aib22,35,Arg26,34,Lys37]GLP-1 (7-37) peptide was obtained.
- Step 1 Synthesis of 2-(16-2H-Tetrazol-5-yl-hexadecanoylamino)pentanedioic acid 1 -tert- butyl ester
- 16-(2H-Tetrazol-5-yl)hexadecanoic acid (433 mg, 1.34 mmol) was heated in toluene (5 mL) and 2,2-dimethoxypropane (2 mL, 16 mmol) to reflux for to minutes. The solvent was removed in vacuo. Ethyl acetate (10 mL) was added, followed by N-(3- dimethylaminopropyl)- ⁇ / -ethylcarbodiimide hydrochloride (359 mg, 1.87 mmol) and 1 hydroxybenzotriazol (281 mg, 2 mmol).
- Step 2 Synthesis of 2-(16-2H-Tetrazol-5-yl-hexadecanoylamino)pentanedioic acid 1-tert- butyl ester 5-(2,5-dioxopyrrolidin-1 -yl) ester.
- Step 3 Synthesis of N £B29 -(16-2H-Tetrazol-5-yl-hexadecanoyl) ⁇ amma-Glu-des(B30) human insulin
- A1 B1 BocBoc des(B30) insulin (Kurtzhals P; Havelund S; Jonassen I; Kiehr B; Larsen UD; Ribel U; Markussen J Biochemical Journal, 1995, 312, 725-731) (0.2 g, 0.034 mmol) was dissolved in DMSO (3 mL).
- Triethylamine (0.047 mL, 0.34 mmol) and a solution of 2-(16-2W- tetrazol-5-yl-hexadecanoylamino)pentanedioic acid 1 -tert-butyl ester 5-(2,5-dioxo-pyrrolidin- 1-yl) ester (58 mg, 0.096 mmol) in DMSO (1mL) were added, and the mixture was shaken at room temperature for 1 hour. The mixture was cooled with an icebath (the DMSO froze), water (10 mL) was added and the frozen mixture was allowed to meit. The pH was adjusted to 5.2 with 1 N HCI.
- N B29 ⁇ -4-[4"-(1 H-Tetrazol-5-yl)[1 ,1';4',1 "]terphenyl-4-yloxy]butyroyl des(B30) insulin was purified by RP-HPLC on C4-column, buffer A: 20% EtOH + 0.1% TFA, buffer B: 80% EtOH + 0.1% TFA; gradient 15-60% B, followed by HPLC on C4-column, buffer A: 10 mM Tris + 15 mM ammonium sulphate in 20% EtOH 1 pH 7.3, buffer B: 80% EtOH, gradient 15-60% B.
- 16-(4'-(5-Tetrazolyl)biphenyl-4-yloxy)hexadecanoic acid (309 mg, 0.63 mmol) was suspended in DMF (4 ml) and treated with TSTU (227 mg, 0.75 mmol) and DIEA (127 ⁇ l_, 0.75 mmol). The mixture was stirred overnight. The solvent was removed in vacuo and the residue was partitioned between ethyl acetate and 0.1 M HCI.
- N B29 ⁇ -16-[4'-(1 H-Tetrazol-5-yl)biphenyl-4-yloxy]hexadecanoyl des(B30) insulin was purified by RP-HPLC on C4-column, buffer A: 20% EtOH + 0.1% TFA, buffer B: 80% EtOH + 0.1% TFA; gradient 15-60% B, followed by HPLC on C4-column, buffer A: 10 mM Tris + 15 mM ammonium sulphate in 20% EtOH, pH 7.3, buffer B: 80% EtOH, gradient 15-60% B.
- HPLC-method B4 A: acetonitril B: water
- the title compound was prepared as example 6 from 17,17-bis(5-tetrazolyl)heptadecanoic acid and [Gly8,Arg26,34]GLP-1 -(7-37) peptide (45 mg). 12.5 mg of the title product was obtained.
- the resin was treated with a 20%-solution of piperidine in DMF (2 x 10 min), and washed extensively with DMF and dichloromethane.
- the resin was then extensively washed with DMF, dichloromethane and methanol, and suspended in a mixture of trifluoroacetic acid and dichloromethane (25:75; vol). After 0.5 h the resin was filtered, rinsed with dichloromethane, the combined filtrates were concentrated and the residue recrystallized from MeCN to yield 0.26 g of the title compound.
- the title compound was prepared as example 6 from (2-(2-(4-(16-(5- tetrazolyOhexadecanoylaminosulfonylJbutyrylaminoJethoxyJethoxyJacetic acid and [(3-(4- imidazolyl)propionyl)7,Arg34]GLP-1-(7-37) peptide (27 mg). 9.5 mg of the title product was obtained.
- the title compound was prepared as example 6 from 4-(16-(5- tetrazolyl)hexadecanoylaminosulfonyl)butyric acid and [Lys14;Arg26,34]GLP-1-(7-37) peptide (65 mg).19 mg of the title product was obtained.
- Example 54 N ⁇ 26 -((2-(2-(2-(2-(2-(4-(16-(Tetrazol-5- yl)hexadecanoylsulfamoyl)butyryl)ethoxy)ethoxy)acetylamino)ethoxy)ethoxy)acetyl)- [Aib8,Arg34]GLP-1-(7-37) peptide
- the title compound was prepared as example 6 from (6- ⁇ 16-[1 H-tetrazol-5- yl]hexadecanoyl ⁇ sulfamoylhexanoic acid and [Arg34]GLP-1-(7-37) peptide.67.5 mg of the title product was obtained.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Endocrinology (AREA)
- Epidemiology (AREA)
- Diabetes (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Emergency Medicine (AREA)
- Toxicology (AREA)
- Urology & Nephrology (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Rheumatology (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BRPI0512988-5A BRPI0512988A (pt) | 2004-07-08 | 2005-06-21 | método para aumentar a meia-vida plasmática de uma molécula, composto, uso do mesmo, e, composição farmacêutica |
| MXPA06015049A MXPA06015049A (es) | 2004-07-08 | 2005-06-21 | Marcadores prolongadores de polipeptidos que comprenden una porcion tetrazol. |
| JP2007519766A JP2008507477A (ja) | 2004-07-08 | 2005-06-21 | ポリペプチド延長タグ |
| EP05754105.4A EP1765408B1 (en) | 2004-07-08 | 2005-06-21 | Polypeptide protracting tags comprising a tetrazole moiety |
| CNA2005800274689A CN101005857A (zh) | 2004-07-08 | 2005-06-21 | 多肽延长标记 |
| ES05754105.4T ES2564167T3 (es) | 2004-07-08 | 2005-06-21 | Conjugados de polipéptidos de acción prolongada que contienen una fracción tetrazol |
| CA 2572770 CA2572770A1 (en) | 2004-07-08 | 2005-06-21 | Polypeptide protracting tags comprising a tetrazole moiety |
| US11/631,889 US20090111730A1 (en) | 2004-07-08 | 2005-06-21 | Polypeptide protracting tags |
| US13/327,378 US9061067B2 (en) | 2004-07-08 | 2011-12-15 | Polypeptide protracting tags |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DKPA200401083 | 2004-07-08 | ||
| DKPA200401083 | 2004-07-08 | ||
| EP05102167 | 2005-03-18 | ||
| EP05102167.3 | 2005-03-18 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/631,889 A-371-Of-International US20090111730A1 (en) | 2004-07-08 | 2005-06-21 | Polypeptide protracting tags |
| US13/327,378 Continuation US9061067B2 (en) | 2004-07-08 | 2011-12-15 | Polypeptide protracting tags |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006005667A2 true WO2006005667A2 (en) | 2006-01-19 |
| WO2006005667A3 WO2006005667A3 (en) | 2006-10-12 |
Family
ID=35453538
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2005/052874 Ceased WO2006005667A2 (en) | 2004-07-08 | 2005-06-21 | Polypeptide protracting tags comprising a tetrazole moiety |
Country Status (12)
| Country | Link |
|---|---|
| US (2) | US20090111730A1 (enExample) |
| EP (3) | EP2289560B1 (enExample) |
| JP (1) | JP2008507477A (enExample) |
| KR (1) | KR20070029247A (enExample) |
| CN (1) | CN101005857A (enExample) |
| AU (1) | AU2005261740A1 (enExample) |
| BR (1) | BRPI0512988A (enExample) |
| CA (1) | CA2572770A1 (enExample) |
| ES (2) | ES2542228T3 (enExample) |
| MX (1) | MXPA06015049A (enExample) |
| RU (1) | RU2006144821A (enExample) |
| WO (1) | WO2006005667A2 (enExample) |
Cited By (62)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008023050A1 (en) * | 2006-08-25 | 2008-02-28 | Novo Nordisk A/S | Acylated exendin-4 compounds |
| WO2007104789A3 (en) * | 2006-03-15 | 2008-03-13 | Novo Nordisk As | Amylin derivatives |
| WO2008087187A1 (en) * | 2007-01-18 | 2008-07-24 | Novo Nordisk A/S | Peptides for use in the treatment of obesity |
| US20080207507A1 (en) * | 2005-03-18 | 2008-08-28 | Novo Nordisk A/S | Extended Glp-1 Compounds |
| WO2008087188A3 (en) * | 2007-01-18 | 2008-09-04 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087189A3 (en) * | 2007-01-18 | 2008-09-04 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087186A3 (en) * | 2007-01-18 | 2008-10-23 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087190A3 (en) * | 2007-01-18 | 2009-01-15 | Novo Nordisk As | Use of peptides in combination with surgical intervention for the treatment of obesity |
| WO2009030774A1 (en) * | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Truncated glp-1 derivatives and their therapeutical use |
| WO2009030771A1 (en) | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Peptides derivatized with a-b-c-d- and their therapeutical use |
| WO2009030738A1 (en) * | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Glucagon-like peptide-1 derivatives and their pharmaceutical use |
| WO2009138511A1 (en) * | 2008-05-16 | 2009-11-19 | Novo Nordisk A/S | Long-acting y2 and/or y4 receptor agonists |
| WO2009141392A1 (en) * | 2008-05-22 | 2009-11-26 | Novo Nordisk A/S | Process |
| EP2235042A1 (en) * | 2008-01-23 | 2010-10-06 | Novo Nordisk Health Care AG | New blood coagulation factor inhibitors |
| US7834142B2 (en) * | 2005-11-21 | 2010-11-16 | Dalian D.N. Bio-Engineering Co., Ltd. | Shortened glucagon-like peptide 1(sGLP-1) preparation method and application |
| WO2011033068A1 (en) * | 2009-09-18 | 2011-03-24 | Novo Nordisk A/S | Long-acting y2 receptor agonists |
| WO2011058165A1 (en) * | 2009-11-13 | 2011-05-19 | Novo Nordisk A/S | Long-acting y2 receptor agonists |
| WO2012080471A1 (en) | 2010-12-16 | 2012-06-21 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| EP2384338A4 (en) * | 2008-12-29 | 2013-01-16 | Panacea Biotec Ltd | GLP-1 ANALOGS AND THEIR APPLICATIONS |
| WO2013098191A1 (en) | 2011-12-29 | 2013-07-04 | Novo Nordisk A/S | Dipeptide comprising a non-proteogenic amino acid |
| US8513192B2 (en) | 2009-01-22 | 2013-08-20 | Novo Nordisk A/S | Stable growth hormone compounds resistant to proteolytic degradation |
| US8536122B2 (en) | 2005-03-18 | 2013-09-17 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| WO2014060472A1 (en) | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Fatty acid acylated amino acids for oral peptide delivery |
| US8779109B2 (en) | 2010-01-22 | 2014-07-15 | Novo Nordisk Health Care Ag | Growth hormones with prolonged in-vivo efficacy |
| US8815802B2 (en) | 2009-12-16 | 2014-08-26 | Novo Nordisk A/S | GLP-1 analogues and derivatives |
| US8841249B2 (en) | 2009-08-06 | 2014-09-23 | Novo Nordisk A/S | Growth hormones with prolonged in-vivo efficacy |
| US8865868B2 (en) | 2008-08-06 | 2014-10-21 | Novo Nordisk Healthcare Ag | Conjugated proteins with prolonged in vivo efficacy |
| US8895504B2 (en) | 2008-10-21 | 2014-11-25 | Novo Nordisk A/S | Amylin derivatives |
| US9085637B2 (en) | 2013-11-15 | 2015-07-21 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| EP2910571A1 (en) | 2008-03-18 | 2015-08-26 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| US9211342B2 (en) | 2010-01-22 | 2015-12-15 | Novo Nordisk Healthcare Ag | Stable growth hormone compounds resistant to proteolytic degradation |
| US9266940B2 (en) | 2011-04-12 | 2016-02-23 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| WO2016055550A1 (en) | 2014-10-07 | 2016-04-14 | Cyprumed Gmbh | Pharmaceutical formulations for the oral delivery of peptide or protein drugs |
| WO2017060500A1 (en) | 2015-10-07 | 2017-04-13 | Cyprumed Gmbh | Pharmaceutical formulations for the oral delivery of peptide drugs |
| US9732137B2 (en) | 2007-12-28 | 2017-08-15 | Novo Nordisk A/S | Semi-recombinant preparation of GLP-1 analogues |
| WO2018065634A1 (en) | 2016-10-07 | 2018-04-12 | Cyprumed Gmbh | Pharmaceutical compositions for the nasal delivery of peptide or protein drugs |
| US10005824B2 (en) | 2015-06-12 | 2018-06-26 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| WO2019016300A1 (en) | 2017-07-19 | 2019-01-24 | Novo Nordisk A/S | EGF ANALOGUES (A), PREPARATION, FORMULATIONS AND USES THEREOF |
| US10221138B2 (en) | 2013-06-27 | 2019-03-05 | Lg Chem, Ltd. | Biaryl derivatives as GPR120 agonists |
| EP3488857A1 (en) | 2012-03-22 | 2019-05-29 | Novo Nordisk A/S | Compositions of glp-1 peptides and preparation thereof |
| WO2019149880A1 (en) | 2018-02-02 | 2019-08-08 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist, a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant |
| EP3542790A1 (en) | 2012-03-22 | 2019-09-25 | Novo Nordisk A/S | Compositions comprising a delivery agent and preparation thereof |
| WO2019193204A1 (en) | 2018-04-06 | 2019-10-10 | Cyprumed Gmbh | Pharmaceutical compositions for the transmucosal delivery of therapeutic peptides and proteins |
| WO2019215063A1 (en) | 2018-05-07 | 2019-11-14 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| WO2019229242A1 (en) | 2018-05-31 | 2019-12-05 | Novo Nordisk A/S | Derivatives comprising an apelin analogue and uses thereof |
| US10583172B2 (en) | 2013-11-15 | 2020-03-10 | Novo Nordisk A/S | HPYY(1-36) having a beta-homoarginine substitution at position 35 |
| CN111333714A (zh) * | 2020-03-05 | 2020-06-26 | 成都奥达生物科技有限公司 | 一种长效glp-1化合物 |
| US11033499B2 (en) | 2012-06-20 | 2021-06-15 | Novo Nordisk A/S | Tablet formulation comprising a GLP-1 peptide and a delivery agent |
| US11045523B2 (en) | 2013-04-05 | 2021-06-29 | Novo Nordisk Healthcare Ag | Formulation of growth hormone albumin-binder conjugate |
| EP3712164A4 (en) * | 2017-11-14 | 2021-08-18 | Senju Pharmaceutical Co., Ltd. | PEPTIDE STABILIZED BY PACAP |
| US11098102B2 (en) | 2018-12-11 | 2021-08-24 | Sanofi | Insulin conjugates |
| US11123296B2 (en) | 2012-03-22 | 2021-09-21 | Novo Nordisk A/S | Compositions comprising a delivery agent and preparation thereof |
| WO2021219710A1 (en) | 2020-04-29 | 2021-11-04 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and histidine |
| WO2022049310A1 (en) | 2020-09-07 | 2022-03-10 | Cyprumed Gmbh | Improved pharmaceutical formulations of glp-1 receptor agonists |
| WO2023012263A1 (en) | 2021-08-04 | 2023-02-09 | Novo Nordisk A/S | Solid oral peptide formulations |
| WO2024141760A1 (en) | 2022-12-30 | 2024-07-04 | Algipharma As | Compositions and methods to increase the systemic bioavailability of a polypeptide therapeutic agent undergoing oral administration |
| WO2024165571A2 (en) | 2023-02-06 | 2024-08-15 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| US12239739B2 (en) | 2013-05-02 | 2025-03-04 | Novo Nordisk A/S | Oral dosing of GLP-1 compounds |
| WO2025125576A2 (en) | 2023-12-15 | 2025-06-19 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| WO2025133348A1 (en) | 2023-12-22 | 2025-06-26 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| WO2025196502A1 (en) | 2024-03-20 | 2025-09-25 | North Carolina Agricultural & Technical State University | Choline kinase inhibitors as a therapeutic treatment for obesity |
| EP4686757A1 (en) | 2024-07-31 | 2026-02-04 | e-therapeutics PLC | Inhibitors of expression and/or function |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2692495T3 (es) | 2009-01-23 | 2018-12-03 | Novo Nordisk A/S | Derivados del FGF21 con aglutinante de albúmina A-B-C-D-E- y sus usos |
| EP2560675A1 (en) | 2010-04-20 | 2013-02-27 | Novo Nordisk A/S | Long-acting gastrin derivatives |
| CN103415300B (zh) | 2010-07-20 | 2018-02-23 | 诺沃—诺迪斯克有限公司 | N‑末端修饰的fgf21化合物 |
| CN103304502B (zh) * | 2013-06-02 | 2015-03-04 | 张远强 | 一类抗糖尿病化合物、其制备方法和用途 |
| CN103304501B (zh) * | 2013-06-02 | 2015-03-04 | 张远强 | 一类抗糖尿病化合物、其制备方法和用途 |
| CN103304499B (zh) * | 2013-06-02 | 2015-03-04 | 张远强 | 抗糖尿病化合物、其制备方法和用途 |
| CN103304503B (zh) * | 2013-06-02 | 2015-03-04 | 张远强 | 抗糖尿病化合物、其制备方法和用途 |
| HUE044783T2 (hu) | 2014-12-23 | 2019-11-28 | Novo Nordisk As | FGF21 származékok és alkalmazásaik |
| CN107589246B (zh) * | 2017-03-07 | 2019-10-01 | 上海原科实业发展有限公司 | 一种纤维蛋白激活剂、其制备方法,包括该激活剂的试剂盒及采用该试剂盒的检测方法 |
| CN119060162A (zh) * | 2019-12-30 | 2024-12-03 | 甘李药业股份有限公司 | 长效glp-1化合物 |
| CN120731085A (zh) * | 2023-03-02 | 2025-09-30 | 甘李药业股份有限公司 | 一种glp-1化合物的医药用途 |
Family Cites Families (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3869437A (en) * | 1970-05-08 | 1975-03-04 | Nat Res Dev | Mono-, di, and N{HD A1{B , N{HU B1{B , N{HU B29{B -tri-acylated insulin |
| US4423224A (en) * | 1980-09-08 | 1983-12-27 | Sds Biotech Corporation | 4-Me-1-(2-(1H-tetrazol-5-yl)ethyl)benzene sulfonate and N-2-(1H-tetrazol-5-yl)ethyl methanesulfonamide |
| JPS604165A (ja) * | 1983-06-21 | 1985-01-10 | Taiho Yakuhin Kogyo Kk | スルホニウム誘導体 |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| DE3626130A1 (de) * | 1986-08-01 | 1988-02-11 | Merck Patent Gmbh | Aminosaeurederivate |
| AU8091091A (en) | 1990-07-26 | 1992-02-18 | University Of Iowa Research Foundation, The | Novel drug delivery systems for proteins and peptides using albumin as a carrier molecule |
| US6492531B1 (en) * | 1992-02-18 | 2002-12-10 | Warner-Lambert Company | Method of treating cognitive disorders |
| TW289757B (enExample) * | 1993-05-08 | 1996-11-01 | Hoechst Ag | |
| US5776927A (en) * | 1994-04-18 | 1998-07-07 | Corvas International, Inc. | Methionine sulfone and S-substituted cysteine sulfone derivatives as enzyme inhibitors |
| US5883107A (en) * | 1994-06-17 | 1999-03-16 | Corvas International, Inc. | Arginine mimic derivatives as enzyme inhibitors |
| US5789434A (en) * | 1994-11-15 | 1998-08-04 | Bayer Corporation | Derivatives of substituted 4-biarylbutyric acid as matrix metalloprotease inhibitors |
| US5693609A (en) | 1994-11-17 | 1997-12-02 | Eli Lilly And Company | Acylated insulin analogs |
| DE19521653A1 (de) * | 1995-06-14 | 1996-12-19 | Hoechst Schering Agrevo Gmbh | Substituierte Tetrazole, Verfahren zu ihrer Herstellung und ihre Verwendung als Herbizide und Pflanzenwachstumsregulatoren |
| JPH09136878A (ja) | 1995-09-12 | 1997-05-27 | Ono Pharmaceut Co Ltd | テトラゾール誘導体 |
| EP0761680A3 (en) * | 1995-09-12 | 1999-05-06 | Ono Pharmaceutical Co., Ltd. | Tetrazole compounds having Interleukin-1beta converting enzyme inhibitory activity |
| US5905140A (en) * | 1996-07-11 | 1999-05-18 | Novo Nordisk A/S, Novo Alle | Selective acylation method |
| ATE229015T1 (de) | 1998-05-12 | 2002-12-15 | Wyeth Corp | Zur behandlung von insulin-resistenz und hyperglycemie geeignete biphenyl-oxo-essigsäuren |
| US6358705B1 (en) | 1998-07-16 | 2002-03-19 | Novo Nordisk A/S | Method of making proteins in transformed yeast cells |
| US6337340B1 (en) * | 1998-08-14 | 2002-01-08 | Gpi Nil Holdings, Inc. | Carboxylic acids and isosteres of heterocyclic ring compounds having multiple heteroatoms for vision and memory disorders |
| DE60032331T2 (de) * | 1999-01-14 | 2007-06-21 | Amylin Pharmaceuticals, Inc., San Diego | Exendine zur glucagon suppression |
| US7385063B2 (en) * | 2001-01-26 | 2008-06-10 | Chugai Seiyaku Kabushiki Kaisha | Method for preparing imidazole derivatives |
| PL204456B1 (pl) * | 2001-02-20 | 2010-01-29 | Chugai Pharmaceutical Co Ltd | Związki azolowe, ich zastosowanie i środek farmaceutyczny |
| JP2004535433A (ja) * | 2001-06-20 | 2004-11-25 | メルク エンド カムパニー インコーポレーテッド | 糖尿病治療用のジペプチジルペプチダーゼ阻害薬 |
| US7186797B2 (en) * | 2001-08-10 | 2007-03-06 | Epix Pharmaceuticals, Inc. | Polypeptide conjugates with extended circulating half-lives |
| HUP0401492A3 (en) * | 2001-09-14 | 2008-05-28 | Novo Nordisk As | Novel ligands for the hisb10 zn2+ sites of r-state insulin hexa |
| WO2003045371A1 (en) * | 2001-11-30 | 2003-06-05 | Pfizer Products Inc. | Pharmaceutical compositions and methods for administering ep2 receptor selective agonists |
| AU2003202994B2 (en) * | 2002-01-18 | 2007-11-22 | Merck Sharp & Dohme Corp. | N-(benzyl)aminoalkylcarboxylates, phosphinates, phosphonates and tetrazoles as Edg receptor agonists |
| US20050070506A1 (en) * | 2002-01-18 | 2005-03-31 | Doherty George A. | Selective s1p1/edg1 receptor agonists |
| TW200400035A (en) * | 2002-03-28 | 2004-01-01 | Glaxo Group Ltd | Novel compounds |
| AR039891A1 (es) * | 2002-05-28 | 2005-03-09 | Dimensional Pharm Inc | Compuestos tiofen-amidinas, sus composiciones farmaceuticas y su uso para la preparacion de medicamentos para tratar enfermedades y trastornos mediados por c1s |
| WO2003103635A1 (en) | 2002-06-07 | 2003-12-18 | Ranbaxy Laboratories Limited | Extended release formulation of divalproex sodium |
| WO2003103653A1 (en) * | 2002-06-11 | 2003-12-18 | Elan Pharmaceuticals, Inc. | Methods of treating alzheimer's disease using aryl alkanoic acid amides |
| AU2003297562A1 (en) * | 2002-11-27 | 2004-06-23 | Artesian Therapeutics, Inc. | COMPOUNDS WITH MIXED PDE-INHIBITORY AND Beta-ADRENERGIC ANTAGONIST OR PARTIAL AGONIST ACTIVITY FOR TREATMENT OF HEART FAILURE |
| US7648738B2 (en) * | 2002-12-03 | 2010-01-19 | Ciba Specialty Chemicals Corporation | Oxime ester photoinitiators with heteroaromatic groups |
| AU2003291972A1 (en) | 2002-12-20 | 2004-07-14 | Novo Nordisk A/S | Pharmaceutical compositions comprising insulin and legends of insulin hexamer |
| EP1610812A1 (en) | 2003-03-11 | 2006-01-04 | Novo Nordisk A/S | Pharmaceutical preparations comprising acid-stabilised insulin |
| CA2539253A1 (en) * | 2003-09-19 | 2005-03-31 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
| US20050096466A1 (en) * | 2003-09-19 | 2005-05-05 | Schwinden Mark D. | Process for the preparation of tetrazol-derived compounds as growth hormone secretagogues |
| JP2007537981A (ja) * | 2003-09-19 | 2007-12-27 | ノボ ノルディスク アクティーゼルスカブ | 新規の血漿タンパク質親和性タグ |
| BRPI0417684A (pt) * | 2003-12-18 | 2007-03-20 | Novo Nordisk As | composto, composição farmacêutica, e, uso de um composto |
| EP2256130B1 (en) * | 2005-02-02 | 2013-09-25 | Novo Nordisk A/S | Novel insulin derivatives |
| JP6352806B2 (ja) * | 2011-09-23 | 2018-07-04 | ノヴォ ノルディスク アー/エス | 新規のグルカゴン類似体 |
-
2005
- 2005-06-21 ES ES10176012.2T patent/ES2542228T3/es not_active Expired - Lifetime
- 2005-06-21 KR KR20077000466A patent/KR20070029247A/ko not_active Withdrawn
- 2005-06-21 BR BRPI0512988-5A patent/BRPI0512988A/pt not_active IP Right Cessation
- 2005-06-21 ES ES05754105.4T patent/ES2564167T3/es not_active Expired - Lifetime
- 2005-06-21 EP EP20100176012 patent/EP2289560B1/en not_active Expired - Lifetime
- 2005-06-21 RU RU2006144821/04A patent/RU2006144821A/ru unknown
- 2005-06-21 WO PCT/EP2005/052874 patent/WO2006005667A2/en not_active Ceased
- 2005-06-21 CN CNA2005800274689A patent/CN101005857A/zh active Pending
- 2005-06-21 JP JP2007519766A patent/JP2008507477A/ja active Pending
- 2005-06-21 EP EP20100179209 patent/EP2292272A3/en not_active Withdrawn
- 2005-06-21 MX MXPA06015049A patent/MXPA06015049A/es unknown
- 2005-06-21 CA CA 2572770 patent/CA2572770A1/en not_active Abandoned
- 2005-06-21 US US11/631,889 patent/US20090111730A1/en not_active Abandoned
- 2005-06-21 EP EP05754105.4A patent/EP1765408B1/en not_active Expired - Lifetime
- 2005-06-21 AU AU2005261740A patent/AU2005261740A1/en not_active Abandoned
-
2011
- 2011-12-15 US US13/327,378 patent/US9061067B2/en not_active Expired - Fee Related
Cited By (104)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8603972B2 (en) * | 2005-03-18 | 2013-12-10 | Novo Nordisk A/S | Extended GLP-1 compounds |
| US8536122B2 (en) | 2005-03-18 | 2013-09-17 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| US20080207507A1 (en) * | 2005-03-18 | 2008-08-28 | Novo Nordisk A/S | Extended Glp-1 Compounds |
| US7834142B2 (en) * | 2005-11-21 | 2010-11-16 | Dalian D.N. Bio-Engineering Co., Ltd. | Shortened glucagon-like peptide 1(sGLP-1) preparation method and application |
| US8486890B2 (en) | 2006-03-15 | 2013-07-16 | Novo Nordisk A/S | Amylin derivatives |
| WO2007104789A3 (en) * | 2006-03-15 | 2008-03-13 | Novo Nordisk As | Amylin derivatives |
| JP2009530250A (ja) * | 2006-03-15 | 2009-08-27 | ノボ・ノルデイスク・エー/エス | アミリン誘導体 |
| US9012398B2 (en) | 2006-08-25 | 2015-04-21 | Novo Nordisk A/S | Acylated exendin-4 compounds |
| WO2008023050A1 (en) * | 2006-08-25 | 2008-02-28 | Novo Nordisk A/S | Acylated exendin-4 compounds |
| WO2008087189A3 (en) * | 2007-01-18 | 2008-09-04 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087186A3 (en) * | 2007-01-18 | 2008-10-23 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087188A3 (en) * | 2007-01-18 | 2008-09-04 | Novo Nordisk As | Peptides for use in the treatment of obesity |
| WO2008087187A1 (en) * | 2007-01-18 | 2008-07-24 | Novo Nordisk A/S | Peptides for use in the treatment of obesity |
| WO2008087190A3 (en) * | 2007-01-18 | 2009-01-15 | Novo Nordisk As | Use of peptides in combination with surgical intervention for the treatment of obesity |
| US9657079B2 (en) | 2007-09-05 | 2017-05-23 | Novo Nordisk A/S | Truncated GLP-1 derivatives and their therapeutical use |
| WO2009030774A1 (en) * | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Truncated glp-1 derivatives and their therapeutical use |
| JP2010538048A (ja) * | 2007-09-05 | 2010-12-09 | ノボ・ノルデイスク・エー/エス | A−b−c−d−で誘導体化されたペプチドとその治療用途 |
| JP2010538042A (ja) * | 2007-09-05 | 2010-12-09 | ノボ・ノルデイスク・エー/エス | グルカゴン様ペプチド−1誘導体及びそれらの医薬用途 |
| WO2009030771A1 (en) | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Peptides derivatized with a-b-c-d- and their therapeutical use |
| US8895694B2 (en) | 2007-09-05 | 2014-11-25 | Novo Nordisk A/S | Glucagon-Like Peptide-1 derivatives and their pharmaceutical use |
| WO2009030738A1 (en) * | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Glucagon-like peptide-1 derivatives and their pharmaceutical use |
| US9409966B2 (en) | 2007-09-05 | 2016-08-09 | Novo Nordisk A/S | Glucagon-like peptide-1 derivatives and their pharmaceutical use |
| US9732137B2 (en) | 2007-12-28 | 2017-08-15 | Novo Nordisk A/S | Semi-recombinant preparation of GLP-1 analogues |
| EP2235042A1 (en) * | 2008-01-23 | 2010-10-06 | Novo Nordisk Health Care AG | New blood coagulation factor inhibitors |
| JP2011510043A (ja) * | 2008-01-23 | 2011-03-31 | ノボ ノルディスク ヘルス ケア アーゲー | 新規血液凝固因子インヒビター |
| US8486892B2 (en) | 2008-01-23 | 2013-07-16 | Novo Nordisk Health Care Ag | Blood coagulation factor inhibitors |
| EP2910571A1 (en) | 2008-03-18 | 2015-08-26 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| EP2910569A1 (en) | 2008-03-18 | 2015-08-26 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| EP2910570A1 (en) | 2008-03-18 | 2015-08-26 | Novo Nordisk A/S | Protease stabilized, acylated insulin analogues |
| US20110275559A1 (en) * | 2008-05-16 | 2011-11-10 | Novo Nordisk A/S | Long-Acting Y2 and/or Y4 Receptor Agonists |
| AU2009248041B2 (en) * | 2008-05-16 | 2013-10-03 | Novo Nordisk A/S | Long-acting Y2 and/or Y4 receptor agonists |
| CN102027007A (zh) * | 2008-05-16 | 2011-04-20 | 诺沃-诺迪斯克有限公司 | 长效的y2和/或y4受体激动剂 |
| RU2504550C2 (ru) * | 2008-05-16 | 2014-01-20 | Ново Нордиск А/С | Длительно действующие агонисты рецепторов y2 и(или) y4 |
| WO2009138511A1 (en) * | 2008-05-16 | 2009-11-19 | Novo Nordisk A/S | Long-acting y2 and/or y4 receptor agonists |
| WO2009141392A1 (en) * | 2008-05-22 | 2009-11-26 | Novo Nordisk A/S | Process |
| US8865868B2 (en) | 2008-08-06 | 2014-10-21 | Novo Nordisk Healthcare Ag | Conjugated proteins with prolonged in vivo efficacy |
| US8895504B2 (en) | 2008-10-21 | 2014-11-25 | Novo Nordisk A/S | Amylin derivatives |
| EP2384338A4 (en) * | 2008-12-29 | 2013-01-16 | Panacea Biotec Ltd | GLP-1 ANALOGS AND THEIR APPLICATIONS |
| US8513192B2 (en) | 2009-01-22 | 2013-08-20 | Novo Nordisk A/S | Stable growth hormone compounds resistant to proteolytic degradation |
| US8841249B2 (en) | 2009-08-06 | 2014-09-23 | Novo Nordisk A/S | Growth hormones with prolonged in-vivo efficacy |
| WO2011033068A1 (en) * | 2009-09-18 | 2011-03-24 | Novo Nordisk A/S | Long-acting y2 receptor agonists |
| WO2011058165A1 (en) * | 2009-11-13 | 2011-05-19 | Novo Nordisk A/S | Long-acting y2 receptor agonists |
| US8815802B2 (en) | 2009-12-16 | 2014-08-26 | Novo Nordisk A/S | GLP-1 analogues and derivatives |
| US9556250B2 (en) | 2009-12-16 | 2017-01-31 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| US9695226B2 (en) | 2010-01-22 | 2017-07-04 | Novo Nordisk Healthcare Ag | Growth hormones with prolonged in-vivo efficacy |
| US9211342B2 (en) | 2010-01-22 | 2015-12-15 | Novo Nordisk Healthcare Ag | Stable growth hormone compounds resistant to proteolytic degradation |
| US8779109B2 (en) | 2010-01-22 | 2014-07-15 | Novo Nordisk Health Care Ag | Growth hormones with prolonged in-vivo efficacy |
| WO2012080471A1 (en) | 2010-12-16 | 2012-06-21 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| US11382957B2 (en) | 2010-12-16 | 2022-07-12 | Novo Nordisk A/S | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| EP3730127A1 (en) | 2010-12-16 | 2020-10-28 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| US10960052B2 (en) | 2010-12-16 | 2021-03-30 | Novo Nordisk A/S | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl) amino) caprylic acid |
| EP3326620A1 (en) | 2010-12-16 | 2018-05-30 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2- hydroxybenzoyl)amino)caprylic acid |
| US9527900B2 (en) | 2011-04-12 | 2016-12-27 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| US9266940B2 (en) | 2011-04-12 | 2016-02-23 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| US11117947B2 (en) | 2011-04-12 | 2021-09-14 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| US11034746B2 (en) | 2011-04-12 | 2021-06-15 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| US10005827B2 (en) | 2011-04-12 | 2018-06-26 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
| WO2013098191A1 (en) | 2011-12-29 | 2013-07-04 | Novo Nordisk A/S | Dipeptide comprising a non-proteogenic amino acid |
| US10954267B2 (en) | 2011-12-29 | 2021-03-23 | Novo Nordisk A/S | Dipeptide comprising a non-proteogenic amino acid |
| US11759503B2 (en) | 2012-03-22 | 2023-09-19 | Novo Nordisk A/S | Compositions of GLP-1 peptides and preparation thereof |
| US11759501B2 (en) | 2012-03-22 | 2023-09-19 | Novo Nordisk A/S | Compositions of GLP-1 peptides and preparation thereof |
| EP4331667A2 (en) | 2012-03-22 | 2024-03-06 | Novo Nordisk A/S | Compositions comprising a delivery agent and preparation thereof |
| EP3488857A1 (en) | 2012-03-22 | 2019-05-29 | Novo Nordisk A/S | Compositions of glp-1 peptides and preparation thereof |
| EP4324475A1 (en) | 2012-03-22 | 2024-02-21 | Novo Nordisk A/S | Compositions of glp-1 peptides and preparation thereof |
| EP3542790A1 (en) | 2012-03-22 | 2019-09-25 | Novo Nordisk A/S | Compositions comprising a delivery agent and preparation thereof |
| US11759502B2 (en) | 2012-03-22 | 2023-09-19 | Novo Nordisk A/S | Compositions of GLP-1 peptides and preparation thereof |
| US10933120B2 (en) | 2012-03-22 | 2021-03-02 | Novo Nordisk A/S | Compositions of GLP-1 peptides and preparation thereof |
| US11123296B2 (en) | 2012-03-22 | 2021-09-21 | Novo Nordisk A/S | Compositions comprising a delivery agent and preparation thereof |
| US11033499B2 (en) | 2012-06-20 | 2021-06-15 | Novo Nordisk A/S | Tablet formulation comprising a GLP-1 peptide and a delivery agent |
| WO2014060472A1 (en) | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Fatty acid acylated amino acids for oral peptide delivery |
| US11045523B2 (en) | 2013-04-05 | 2021-06-29 | Novo Nordisk Healthcare Ag | Formulation of growth hormone albumin-binder conjugate |
| US12514822B2 (en) | 2013-05-02 | 2026-01-06 | Novo Nordisk A/S | Oral dosing of GLP-1 compounds |
| US12239739B2 (en) | 2013-05-02 | 2025-03-04 | Novo Nordisk A/S | Oral dosing of GLP-1 compounds |
| US10221138B2 (en) | 2013-06-27 | 2019-03-05 | Lg Chem, Ltd. | Biaryl derivatives as GPR120 agonists |
| US10583172B2 (en) | 2013-11-15 | 2020-03-10 | Novo Nordisk A/S | HPYY(1-36) having a beta-homoarginine substitution at position 35 |
| US9085637B2 (en) | 2013-11-15 | 2015-07-21 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| US10246497B2 (en) | 2013-11-15 | 2019-04-02 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| WO2016055550A1 (en) | 2014-10-07 | 2016-04-14 | Cyprumed Gmbh | Pharmaceutical formulations for the oral delivery of peptide or protein drugs |
| US10005824B2 (en) | 2015-06-12 | 2018-06-26 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| WO2017060500A1 (en) | 2015-10-07 | 2017-04-13 | Cyprumed Gmbh | Pharmaceutical formulations for the oral delivery of peptide drugs |
| WO2018065634A1 (en) | 2016-10-07 | 2018-04-12 | Cyprumed Gmbh | Pharmaceutical compositions for the nasal delivery of peptide or protein drugs |
| WO2019016300A1 (en) | 2017-07-19 | 2019-01-24 | Novo Nordisk A/S | EGF ANALOGUES (A), PREPARATION, FORMULATIONS AND USES THEREOF |
| US12304932B2 (en) | 2017-11-14 | 2025-05-20 | Senju Pharmaceutical Co., Ltd. | PACAP stabilized peptide |
| EP3712164A4 (en) * | 2017-11-14 | 2021-08-18 | Senju Pharmaceutical Co., Ltd. | PEPTIDE STABILIZED BY PACAP |
| US12396953B2 (en) | 2018-02-02 | 2025-08-26 | Novo Nordisk A/S | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| US11833248B2 (en) | 2018-02-02 | 2023-12-05 | Novo Nordisk A/S | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| EP4299118A2 (en) | 2018-02-02 | 2024-01-03 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist, a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant |
| WO2019149880A1 (en) | 2018-02-02 | 2019-08-08 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist, a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant |
| WO2019193204A1 (en) | 2018-04-06 | 2019-10-10 | Cyprumed Gmbh | Pharmaceutical compositions for the transmucosal delivery of therapeutic peptides and proteins |
| WO2019215063A1 (en) | 2018-05-07 | 2019-11-14 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| EP4674479A2 (en) | 2018-05-07 | 2026-01-07 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| WO2019229242A1 (en) | 2018-05-31 | 2019-12-05 | Novo Nordisk A/S | Derivatives comprising an apelin analogue and uses thereof |
| US11098102B2 (en) | 2018-12-11 | 2021-08-24 | Sanofi | Insulin conjugates |
| US12195510B2 (en) | 2018-12-11 | 2025-01-14 | Sanofi | Insulin conjugates |
| CN111333714A (zh) * | 2020-03-05 | 2020-06-26 | 成都奥达生物科技有限公司 | 一种长效glp-1化合物 |
| WO2021219710A1 (en) | 2020-04-29 | 2021-11-04 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and histidine |
| WO2022049310A1 (en) | 2020-09-07 | 2022-03-10 | Cyprumed Gmbh | Improved pharmaceutical formulations of glp-1 receptor agonists |
| WO2023012263A1 (en) | 2021-08-04 | 2023-02-09 | Novo Nordisk A/S | Solid oral peptide formulations |
| WO2024141760A1 (en) | 2022-12-30 | 2024-07-04 | Algipharma As | Compositions and methods to increase the systemic bioavailability of a polypeptide therapeutic agent undergoing oral administration |
| WO2024165571A2 (en) | 2023-02-06 | 2024-08-15 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| WO2025125576A2 (en) | 2023-12-15 | 2025-06-19 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| WO2025133348A1 (en) | 2023-12-22 | 2025-06-26 | E-Therapeutics Plc | Inhibitors of expression and/or function |
| WO2025196502A1 (en) | 2024-03-20 | 2025-09-25 | North Carolina Agricultural & Technical State University | Choline kinase inhibitors as a therapeutic treatment for obesity |
| EP4686757A1 (en) | 2024-07-31 | 2026-02-04 | e-therapeutics PLC | Inhibitors of expression and/or function |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2005261740A1 (en) | 2006-01-19 |
| ES2564167T3 (es) | 2016-03-18 |
| KR20070029247A (ko) | 2007-03-13 |
| CA2572770A1 (en) | 2006-01-19 |
| CN101005857A (zh) | 2007-07-25 |
| EP2289560B1 (en) | 2015-04-22 |
| ES2542228T3 (es) | 2015-08-03 |
| EP2289560A3 (en) | 2011-10-19 |
| RU2006144821A (ru) | 2008-08-20 |
| JP2008507477A (ja) | 2008-03-13 |
| MXPA06015049A (es) | 2007-02-08 |
| US20120088716A1 (en) | 2012-04-12 |
| EP1765408A2 (en) | 2007-03-28 |
| US9061067B2 (en) | 2015-06-23 |
| US20090111730A1 (en) | 2009-04-30 |
| EP2289560A2 (en) | 2011-03-02 |
| WO2006005667A3 (en) | 2006-10-12 |
| BRPI0512988A (pt) | 2008-04-22 |
| EP1765408B1 (en) | 2015-12-09 |
| EP2292272A2 (en) | 2011-03-09 |
| EP2292272A3 (en) | 2011-10-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2289560B1 (en) | Polypeptide protracting tags comprising a tetrazole moiety | |
| US7897560B2 (en) | Plasma protein affinity tags | |
| JP5209463B2 (ja) | アシル化glp−1化合物 | |
| EP1704165B1 (en) | Glp-1 compounds | |
| ES2672770T3 (es) | Derivados del péptido-1 similar al glucagón y su uso farmacéutico | |
| AU2004273573B2 (en) | Albumin-binding derivatives of therapeutic peptides | |
| ES2532116T3 (es) | Péptidos derivados con A-B-C-D y sus usos terapéuticos | |
| EP2330126B1 (en) | Protracted exendin-4 compounds | |
| US20090005312A1 (en) | Novel glp-1 analogues linked to albumin-like agents | |
| EP1799710A2 (en) | Protracted glp-1 compounds | |
| JP2008516621A (ja) | 成長ホルモン結合体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2005754105 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005261740 Country of ref document: AU Ref document number: 7689/DELNP/2006 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/015049 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2572770 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020077000466 Country of ref document: KR |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007519766 Country of ref document: JP |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2005261740 Country of ref document: AU Date of ref document: 20050621 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005261740 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006144821 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200580027468.9 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020077000466 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005754105 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: PI0512988 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11631889 Country of ref document: US |