US20230131421A1 - Application of cas protein, method for detecting target nucleic acid molecule and kit - Google Patents
Application of cas protein, method for detecting target nucleic acid molecule and kit Download PDFInfo
- Publication number
- US20230131421A1 US20230131421A1 US18/085,121 US202218085121A US2023131421A1 US 20230131421 A1 US20230131421 A1 US 20230131421A1 US 202218085121 A US202218085121 A US 202218085121A US 2023131421 A1 US2023131421 A1 US 2023131421A1
- Authority
- US
- United States
- Prior art keywords
- nucleic acid
- target
- target nucleic
- cas12a
- cas protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000000034 method Methods 0.000 title claims abstract description 126
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 106
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 105
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 105
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 91
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 80
- 108700004991 Cas12a Proteins 0.000 claims abstract description 145
- 238000006243 chemical reaction Methods 0.000 claims abstract description 122
- 108020005004 Guide RNA Proteins 0.000 claims abstract description 56
- 108020004711 Nucleic Acid Probes Proteins 0.000 claims abstract description 40
- 239000002853 nucleic acid probe Substances 0.000 claims abstract description 40
- 108020004414 DNA Proteins 0.000 claims description 232
- 102000053602 DNA Human genes 0.000 claims description 143
- 238000001514 detection method Methods 0.000 claims description 120
- 238000003776 cleavage reaction Methods 0.000 claims description 87
- 108020004682 Single-Stranded DNA Proteins 0.000 claims description 71
- 230000000694 effects Effects 0.000 claims description 71
- 230000007017 scission Effects 0.000 claims description 67
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 61
- 230000003321 amplification Effects 0.000 claims description 59
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 52
- 239000000523 sample Substances 0.000 claims description 49
- 238000013518 transcription Methods 0.000 claims description 37
- 230000035897 transcription Effects 0.000 claims description 37
- 239000000872 buffer Substances 0.000 claims description 34
- 238000001917 fluorescence detection Methods 0.000 claims description 25
- 101000860092 Francisella tularensis subsp. novicida (strain U112) CRISPR-associated endonuclease Cas12a Proteins 0.000 claims description 21
- 239000007850 fluorescent dye Substances 0.000 claims description 21
- 238000002360 preparation method Methods 0.000 claims description 20
- 238000012408 PCR amplification Methods 0.000 claims description 19
- 230000007018 DNA scission Effects 0.000 claims description 15
- 230000000295 complement effect Effects 0.000 claims description 12
- 238000010791 quenching Methods 0.000 claims description 12
- 230000000171 quenching effect Effects 0.000 claims description 11
- 230000004544 DNA amplification Effects 0.000 claims description 7
- 238000011144 upstream manufacturing Methods 0.000 claims description 7
- 230000001404 mediated effect Effects 0.000 claims description 6
- 239000003153 chemical reaction reagent Substances 0.000 claims description 4
- 238000007834 ligase chain reaction Methods 0.000 claims description 4
- 244000000010 microbial pathogen Species 0.000 claims description 4
- 238000005096 rolling process Methods 0.000 claims description 4
- 206010064571 Gene mutation Diseases 0.000 claims description 3
- 101000708790 Homo sapiens SPARC-related modular calcium-binding protein 2 Proteins 0.000 claims description 3
- 101000615384 Homo sapiens Stromal membrane-associated protein 2 Proteins 0.000 claims description 3
- 102100021250 Stromal membrane-associated protein 2 Human genes 0.000 claims description 3
- 239000000203 mixture Substances 0.000 claims description 3
- 102100035102 E3 ubiquitin-protein ligase MYCBP2 Human genes 0.000 claims 10
- 102100039087 Peptidyl-alpha-hydroxyglycine alpha-amidating lyase Human genes 0.000 description 41
- 229920002401 polyacrylamide Polymers 0.000 description 41
- 238000007397 LAMP assay Methods 0.000 description 36
- 108091034117 Oligonucleotide Proteins 0.000 description 36
- 238000012360 testing method Methods 0.000 description 35
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 34
- 239000000047 product Substances 0.000 description 24
- 241000588724 Escherichia coli Species 0.000 description 22
- 230000007423 decrease Effects 0.000 description 21
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 21
- 238000000137 annealing Methods 0.000 description 20
- 101150013736 gyrB gene Proteins 0.000 description 18
- 230000035772 mutation Effects 0.000 description 18
- 230000004044 response Effects 0.000 description 18
- 238000001816 cooling Methods 0.000 description 17
- 238000004925 denaturation Methods 0.000 description 17
- 230000036425 denaturation Effects 0.000 description 17
- 239000013612 plasmid Substances 0.000 description 16
- 239000012295 chemical reaction liquid Substances 0.000 description 15
- 230000005284 excitation Effects 0.000 description 15
- 241000282414 Homo sapiens Species 0.000 description 14
- 238000000746 purification Methods 0.000 description 13
- 230000035945 sensitivity Effects 0.000 description 13
- 239000002532 enzyme inhibitor Substances 0.000 description 11
- 229940125532 enzyme inhibitor Drugs 0.000 description 11
- 108091092562 ribozyme Proteins 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 244000005700 microbiome Species 0.000 description 10
- 108091033409 CRISPR Proteins 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 201000005569 Gout Diseases 0.000 description 8
- 238000005516 engineering process Methods 0.000 description 8
- 230000007613 environmental effect Effects 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 239000013642 negative control Substances 0.000 description 7
- 239000000758 substrate Substances 0.000 description 7
- 238000011160 research Methods 0.000 description 6
- 108010042407 Endonucleases Proteins 0.000 description 5
- 102000004533 Endonucleases Human genes 0.000 description 5
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 5
- 239000004202 carbamide Substances 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000010354 CRISPR gene editing Methods 0.000 description 4
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 4
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 4
- 241000660147 Escherichia coli str. K-12 substr. MG1655 Species 0.000 description 4
- 101150080074 TP53 gene Proteins 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 108700025694 p53 Genes Proteins 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 241000193412 Alicyclobacillus acidoterrestris Species 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 210000000981 epithelium Anatomy 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 239000000376 reactant Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 2
- 102220613830 Casein kinase II subunit alpha 3_D1255A_mutation Human genes 0.000 description 2
- 102220613440 Casein kinase II subunit alpha 3_D917A_mutation Human genes 0.000 description 2
- 102220613443 Casein kinase II subunit alpha 3_E1006A_mutation Human genes 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108091027544 Subgenomic mRNA Proteins 0.000 description 2
- 108010006785 Taq Polymerase Proteins 0.000 description 2
- 102100026260 Titin Human genes 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000003936 denaturing gel electrophoresis Methods 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000000799 fluorescence microscopy Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000011901 isothermal amplification Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 101150012629 parE gene Proteins 0.000 description 2
- 239000011535 reaction buffer Substances 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000012137 tryptone Substances 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- 241000093740 Acidaminococcus sp. Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 241001063273 Alicyclobacillus acidiphilus Species 0.000 description 1
- 241000850382 Alicyclobacillus contaminans Species 0.000 description 1
- 241000532138 Alicyclobacillus herbarius Species 0.000 description 1
- 241000850379 Alicyclobacillus kakegawensis Species 0.000 description 1
- 241000850381 Alicyclobacillus macrosporangiidus Species 0.000 description 1
- 241001408449 Asca Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000380736 Bacteroidales bacterium KA00251 Species 0.000 description 1
- 241001232588 Bacteroidetes oral taxon 274 str. F0058 Species 0.000 description 1
- 108091079001 CRISPR RNA Proteins 0.000 description 1
- 108010040467 CRISPR-Associated Proteins Proteins 0.000 description 1
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 241000721561 Helcococcus kunzii ATCC 51366 Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 241000448225 Lachnospiraceae bacterium MC2017 Species 0.000 description 1
- 241000689677 Lachnospiraceae bacterium NC2008 Species 0.000 description 1
- 241000689670 Lachnospiraceae bacterium ND2006 Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 241001169825 Oribacterium sp. Species 0.000 description 1
- 239000012807 PCR reagent Substances 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 108010076818 TEV protease Proteins 0.000 description 1
- 241000605257 Thiomicrospira sp. Species 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 101800005109 Triakontatetraneuropeptide Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000907316 Zika virus Species 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 230000027455 binding Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000002038 chemiluminescence detection Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000007672 fourth generation sequencing Methods 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 230000007614 genetic variation Effects 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- CJWXCNXHAIFFMH-AVZHFPDBSA-N n-[(2s,3r,4s,5s,6r)-2-[(2r,3r,4s,5r)-2-acetamido-4,5,6-trihydroxy-1-oxohexan-3-yl]oxy-3,5-dihydroxy-6-methyloxan-4-yl]acetamide Chemical compound C[C@H]1O[C@@H](O[C@@H]([C@@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O)[C@H](O)[C@@H](NC(C)=O)[C@@H]1O CJWXCNXHAIFFMH-AVZHFPDBSA-N 0.000 description 1
- 238000007481 next generation sequencing Methods 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 238000011897 real-time detection Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000011896 sensitive detection Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 238000005382 thermal cycling Methods 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- NMEHNETUFHBYEG-IHKSMFQHSA-N tttn Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 NMEHNETUFHBYEG-IHKSMFQHSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6816—Hybridisation assays characterised by the detection means
- C12Q1/6823—Release of bound markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6816—Hybridisation assays characterised by the detection means
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6827—Hybridisation assays for detection of mutation or polymorphism
- C12Q1/683—Hybridisation assays for detection of mutation or polymorphism involving restriction enzymes, e.g. restriction fragment length polymorphism [RFLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2563/00—Nucleic acid detection characterized by the use of physical, structural and functional properties
- C12Q2563/107—Nucleic acid detection characterized by the use of physical, structural and functional properties fluorescence
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention belongs to the field of biotechnology, and in particular, the present invention relates to a method for the detection of target nucleic acid molecules.
- nucleic acid diagnostics plays an important role in the field of food safety, environmental microbial pollution detection, human pathogen infections and the like.
- NADs nucleic acid diagnostics
- the NAD methods can also detect single nucleotide polymorphisms (SNPs) in human beings or other species. Understanding the relationship between genetic variation and biological function at the genomic level may provide a new perspective for modern molecular biology, among which SNPs are closely related to biological function, evolution, disease and the like, thus the development of techniques for detection and analysis of SNPs is particularly important.
- PCR technique is the first established and currently most commonly used amplification method. Based on the PCR method, fluorescence labelled probes are introduced to facilitate realtime detection of the amplification of target (named as Realtime PCR), which is a rapid and highly sensitive detection method and can be used for quantitative analysis.
- Realtime PCR fluorescence labelled probes
- many alternative methods have been created, such as the ligase chain reaction, the branched DNA amplification, NASBA, SDA, transcription-mediated amplification, loop-mediated isothermal amplification (LAMP), rolling circle amplification (RCA), Recombinase Polymerase Amplification (RPA) and the like.
- SNPs first also needs to be amplified by PCR and other methods to obtain enough amounts of fragments containing SNP site regions for further detection. Common approaches include primer extension, hybridization, ligation and enzymatic cleavage. After completing the above methods, you need to use specific methods for detection, such as mass spectrometry detection, fluorescence detection, chemiluminescence detection, etc.
- RNA molecule is designed as an RNA fluorescence reporter system
- RPA isothermal amplification technology
- Zhang Feng team called this detection method as SHERLOCK (Specific High Sensitivity Enzymatic Reporter UnLOCKing).
- SHERLOCK Specific High Sensitivity Enzymatic Reporter UnLOCKing
- Cas12a (formerly known as Cpf1), which is an RNA-guided specific DNA endonuclease like the commonly used Cas9 protein; but compared with Cas9, Cas12a has its own characteristics, such as the need for crRNA to guide the specific cleavage of double-stranded DNA and produce cohesive ends.
- the object of the present invention is to provide a method for detecting target nucleic acid molecules.
- Another object of the present invention is to provide a use of a Cas protein in a method for detecting target nucleic acid molecules.
- kits comprising a guide RNA, a Cas protein, a nucleic acid probe and a buffer.
- a method for detecting target nucleic acid molecules which comprises adding a guide RNA, a Cas protein, a nucleic acid probe and a buffer into the reaction system containing the target nucleic acid molecules to be detected, and then detecting the target nucleic acid molecules (especially by detection of the fluorescence intensity).
- the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a.
- the Cas protein is Cas12a.
- the Cas12a is preferably one of FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a or Lb4Cas12a.
- the Cas12a is LbCas12a.
- the guide RNA refers to an RNA that directs the Cas protein to specifically bind to the target DNA.
- the nucleic acid probe is a single-stranded DNA; the single-stranded DNA is preferably a fluorescently labelled single-stranded DNA; and the single-stranded DNA is preferably a fluorescent probe labelled with a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end.
- the detection method of the nucleic acid probe is preferably a fluorescence detection method; and the fluorescence detection method is preferably by using a microplate reader or a fluorescence spectrophotometer.
- the target nucleic acid molecules to be detected in the reaction system of the target nucleic acid molecules to be detected are obtained after amplification.
- the detection method of the present invention can detects pathogenic microorganisms, gene mutations or specific target DNA.
- the Cas protein comprises Cas12b (C2c1).
- a Cas protein in a method for detecting target nucleic acid molecules, or for preparing a preparation for the detection of target nucleic acid molecules.
- the complex cleaves other single-stranded DNA molecules in the system.
- the guide RNA refers to an RNA that directs the Cas protein to specifically bind to the target DNA.
- kits comprising a guide RNA, a Cas protein and a nucleic acid probe.
- the kit further comprises a buffer.
- a detection system for detecting target nucleic acid molecules comprising:
- a Cas protein which is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
- nucleic acid probe which is a single-stranded DNA
- target nucleic acid molecule is a target DNA.
- the detection system further comprises (d) a buffer.
- the detection system further comprises target nucleic acid molecules to be detected.
- the concentration of the target nucleic acid molecules to be detected in the detection system is from 1 to 100 copies/ ⁇ L or 10 15 copies/ ⁇ L, preferably from 1 to 10 copies/ ⁇ L, more preferably from 1 to 5 copies/ ⁇ L.
- the molar ratio of the nucleic acid probe to the target nucleic acid molecule is from 10 3 :1 to 10 14 :1, preferably from 10 4 :1 to 10 7 :1.
- the detection site of the target nucleic acid molecule is located at positions 1-12 downstream of the PAM sequence of the guide RNA.
- the length of the guide RNA is 15-30 nt, preferably 15-18 nt.
- the target DNA comprises cDNA.
- the target DNA is selected from the group consisting of: single-stranded DNA, double-stranded DNA, or a combination thereof.
- the nucleic acid probe has a fluorescent group and a quenching group.
- the fluorescent group and the quenching group are each independently located at the 5′ end, the 3′ end, and the middle of the nucleic acid probe.
- the length of the nucleic acid probe is from 3 to 300 nt, preferably from 5 to 100 nt, more preferably from 6 to 50 nt, and most preferably from 8 to 20 nt.
- the target nucleic acid molecules comprise target nucleic acid molecules derived from a species selected from the group consisting of: a plant, an animal, an insect, a microorganism, a virus, or a combination thereof.
- the target DNA is a artificially synthesized or a naturally occurring DNA.
- the target DNA comprises a wild-type or a mutant DNA.
- the target DNA comprises DNA obtained by RNA reverse transcription or amplification, such as cDNA and the like.
- the Cas12a is selected from the group consisting of: FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a, Lb4Cas12a or a combination thereof; more preferably, the Cas12a is LbCas12a.
- the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (i.e., C2c1).
- the Cas12b protein is selected from the group consisting of: AacCas12b ( Alicyclobacillus acidoterrestris ), Aac2Cas12b ( Alicyclobacillus acidiphilus ), AkCas12b ( Alicyclobacillus kakegawensis ), AmCas12b ( Alicyclobacillus macrosporangiidus ), AhCas12b ( Alicyclobacillus herbarius ), and AcCas12b ( Alicyclobacillus contaminans ).
- AacCas12b Alicyclobacillus acidoterrestris
- Aac2Cas12b Alicyclobacillus acidiphilus
- AkCas12b Alicyclobacillus kakegawensis
- AmCas12b Alicyclobacillus macrosporangiidus
- AhCas12b Alicyclobacillus herbarius
- AcCas12b Ali
- the nucleic acid probe comprises a single-stranded DNA with a detectable label.
- the single-stranded DNA is a single-stranded DNA labelled with fluorescence and biotin.
- the single-stranded DNA is a single-stranded DNA labelled with fluorescence.
- the single-stranded DNA is a fluorescent probe labelled with a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end.
- kit for detecting target nucleic acid molecules comprising:
- a first container and a Cas protein located in the first container wherein the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
- RNA optionally a second container and a guide RNA located in the second container, wherein the guide RNA directs the Cas protein to specifically bind to the target nucleic acid molecules;
- target nucleic acid molecule is a target DNA.
- any two, three, or four (or all) of the first, second, third, and fourth container may be the same or different container.
- the nucleic acid probe has a fluorescent group and a quenching group.
- nucleic acid probe is cleaved by the Cas protein, it indicates that the target nucleic acid molecule is present in the sample; and if the nucleic acid probe is not cleaved by the Cas protein, it indicates that the target nucleic acid molecule is not present in the sample.
- the sample to be detected comprises an unamplified sample and an amplified (or nucleic acid amplified) sample.
- the sample to be detected is a sample obtained by amplification.
- the nucleic acid amplification method is selected from the group consisting of: PCR amplification, LAMP amplification, RPA amplification, ligase chain reaction, branched DNA amplification, NASBA, SDA, transcription-mediated amplification, rolling circle amplification, HDA, SPIA, NEAR, TMA and SMAP2.
- the PCR comprises high temperature PCR, normal temperature PCR, and low temperature PCR.
- the method is for detecting whether there is an SNP, a point mutation, a deletion, and/or an insertion for nucleic acids at a target site.
- nucleic acid amplification was carried out using primers introduced with PAM.
- the primer introduced with PAM has a structure of formula I from 5′ to 3′:
- P1 is a 5′ segment sequence complementary or non-complementary to the sequence of the target nucleic acid molecule at the 5′ end;
- P2 is a PAM sequence
- P3 is a 3′ segment sequence complementary to the sequence of the target nucleic acid molecule at the 3′ end.
- the PAM primer specifically binds upstream or downstream of the target nucleic acid molecule.
- P1 has a length of 0 to 20 nt.
- P3 has a length of 5 to 20 nt.
- the PAM primer has a length of 18 to 50 nt, preferably 20 to 35 nt.
- the complementation comprises full complementation and partial complementation.
- At least one primer with a PAM sequence is used in the nucleic acid amplification.
- primers with or without a PAM sequence can be used, and the amplified amplification product contains the PAM sequence.
- the detection in step (b) comprises a fluorescence detection method.
- a microplate reader or a fluorescence spectrophotometer is used in the fluorescence detection method.
- a Cas protein for the preparation of a detection reagent or kit for detecting target nucleic acid molecules based on a collateral single-stranded DNA cleavage, wherein the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a.
- the Cas12a is selected from the group consisting of: FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a, Lb4Cas12a or a combination thereof; more preferably, the Cas12a is LbCas12a.
- the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (or C2c1).
- the Cas12b protein is selected from the group consisting of: AacCas12b.
- FIG. 1 A-G shows the cis-cleavage characteristics of the Cas12a cleaving target single-stranded DNA.
- FIGS. 1 C and 1 D discloses SEQ ID NOS 3 and 3, respectively, in order of appearance.
- FIG. 2 A-B shows Cas12a cleaves target single-stranded DNA independent of PAM sequence required for cleaving double strands.
- FIG. 2 B discloses SEQ ID NOS 3, 11, 13, 12, 1, 3, 14, 11, 16, 13, 15, and 12, respectively, in order of appearance.
- FIG. 3 A-D shows the trans-cleavage characteristics of the Cas12a cleaving single-stranded DNA.
- FIG. 4 A-D shows 10 different sources of Cas12a tested, all of which have cis- and trans-cleavage activity for single-stranded DNA.
- FIG. 5 A-D shows through Cas12a single-point mutation experiment, the sites in Cas12a that may be related to the cis- and trans-cleavage activity of single-stranded DNA were identified.
- FIG. 6 shows the structures of Cas12a and Cas12b (i.e., C2c1) monomers and their complexes with guide RNA and target DNA.
- FIG. 7 shows different Cas12a uses specific double-stranded DNA substrates and single-stranded DNA (HEX-N12-BHQ1) as the fluorescent detection probe to obtain the fluorescence value.
- the negative control group does not add specific substrates. No specific substrate added was employed as the negative control group.
- FIG. 8 shows schematic of target DNA detection by the HOLMES method based on target DNA amplification and Cas12a trans-cleavage activity against collateral single-stranded DNA.
- FIG. 9 A-B shows sensitivity test of target DNA by direct use of FnCas12a or LbCas12a, or in combination of the HOLMES method.
- FIG. 10 A-B shows fluorescence detection value of the HOLMES method using crRNAs with different lengths of the guide sequence combined with FnCas12a or LbCas12a on target sequences with different single point mutations.
- FIG. 11 A-B shows using FAM-labeled fluorescent probes, 10 Cas12a proteins were selected to test whether the FAM-labeled single-stranded DNA probe is trans-cleaved after adding the target single-stranded DNA.
- FIG. 12 shows using HEX-N12-BHQ1 as a probe, 10 Cas12a proteins were selected to test the fluorescence value after adding the target single-stranded DNA.
- FIG. 13 A-B (A) Single-stranded DNA fluorescent probes labeled with HEX and BHQ1 at both ends show HOLMES detection values using the gyrB gene fragment as the target sequence and different concentrations of pure cultured E. coli MG1655 as the positive control template. It is shown that as the concentration of E. coli MG1655 decreases, its fluorescence response value gradually decreases. (B) Detection values of environmental water samples in different locations.
- FIG. 14 A-F shows schematic diagram of the HOLMES method for detecting SNPs, and the fluorescence detection values of 5 SNP sites.
- FIG. 15 shows the fluorescence detection values in key sites when using HOLMES method for detecting TP53 gene (a cancer-related gene).
- FIG. 16 A-E shows the detection values of 5 SNP sites (gout related) by using HOLMES method.
- FIG. 17 shows the detection values of 1 SNP site (gout related) by using HOLMES method, with samples from 21 volunteers.
- FIG. 18 shows a scheme for primers design in one Example of the present invention, which could be used for HOLMES detection of SNP in any site.
- FIG. 19 A-B shows the detection of E. coli with the combination of LAMP and HOLMES in the system.
- A The electrophoretogram of the E. coli gyrB gene amplified by LAMP. Two groups of primers (i.e. gyrB-1 and gyrB-2) were used to amplify the gyrB gene, which is the informative gene of E. coli.
- B Detection of the LAMP amplification products with HOLMES detection system. Negative control: The sample was sterilized water, and the gyrB gene was amplified or the result thereof was detected with gyrB-1 amplification primers.
- gyrB-1 The sample was the E.
- gyrB-2 The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the second group of gyrB gene amplification primers.
- FIG. 20 A-B shows the detection of the genotypes of human HEK293T cells through the combination detection of LAMP and HOLMES.
- A The electrophoretogram of SNP detection template corresponding to human HEK293T amplified by LAMP.
- Negative control The sample was sterilized water, and the amplification result was detected with rs5082 amplification primers.
- rs5082 The sample was the total genomic DNA from human HEK293T cells, and the amplification result was detected with rs5082 amplification primers.
- rs1467558 The sample was the genomic DNA from human HEK293T cells, and the amplification result was detected with rs1467558 amplification primers.
- FIG. 21 A-B shows the detection of E. coli with the combination of RPA and HOLMES in the system.
- A Amplification of the E. coli gyrB gene with RPA. Two groups of primers (i.e. gyrB-1 and gyrB-2) were used to amplify the gyrB gene, which is the informative gene of E. coli.
- B Detection of the RPA amplification products with HOLMES detection system. Negative control: The sample was sterilized water, and the gyrB gene was amplified or the result thereof was detected with gyrB-1 amplification primers.
- gyrB-1 The sample was the E.
- gyrB-2 The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the second group of gyrB amplification primers.
- FIG. 22 shows the detection of the collateral ssDNA cleavage activity of Cas12b with ssDNA as target DNA.
- the reactants were subject to denatured gel electrophoresis separation with 12% urea and detected with the fluorescence imaging system. The number in the brackets stood for the final concentration, in nM, of reactants.
- the 50 nM ssDNA of 66 nts was used as the target DNA, and 50 nM 5′-end FAM-labelled ssDNA was used as the ssDNA probe.
- FAM-labelled ssDNA was cleaved into fragments, demonstrating that Cas12b had collateral ssDNA cleavage activity.
- FIG. 23 shows the detection of the collateral ssDNA cleavage activity of Cas12b with ssDNA or dsDNA as target DNA.
- the reactants were detected with a fluorescence microplate reader.
- the amount of Cas12b and guide RNA was 500 nM.
- 50 nM ssDNA (66-nt) or dsDNA (66-nt) was used as the target DNA.
- 500 nM ssDNA probe containing fluorescence reporter and quencher group (HEX-N12-BHQ1) was used as the ssDNA probe.
- the collateral ssDNA cleavage activity could be detected.
- FIG. 24 shows the collateral ssDNA trans-cleavage activity generated by Cas12b with the combination of LAMP amplification for low-concentration target DNA.
- the present inventors have developed a technical solution for target nucleic acid detection, by studying the cleavage properties of Cas enzymes such as Cas12a and Cas12b enzymes.
- the experimental results show that the above technical solutions are successfully used to rapidly detect nucleic acids. For example, identification of whether the water contains a certain concentration of microorganisms such as Escherichia coli and rapid identification of SNP genotypes are accomplished. On this basis, the present invention has been completed.
- guide RNA refers to an RNA that directs the Cas protein to specifically bind to a target DNA sequence.
- crRNA refers to CRISPR RNA, which is a short RNA that directs Cas12a to bind to a target DNA sequence.
- CRISPR refers to clustered regular interspaced short palindromic repeats, which are the immune systems of many prokaryotes.
- Cas protein refers to a CRISPR-associated protein which is a related protein in the CRISPR system.
- Cas12a refers to a crRNA-dependent endonuclease, which is an enzyme of type V-A in the CRISPR system classification.
- Cas12b and “C2c1” are used interchangeably and refer to a crRNA-dependent endonuclease, which is an enzyme of type V-B in the CRISPR system classification.
- LAMP is a loop-mediated isothermal amplification technique and is a thermostatic nucleic acid amplification technique suitable for gene diagnosis.
- the term “PAM” refers to a protospacer-adjacent motif, which is required for Cas12a cleavage.
- the PAM of FnCas12a is the sequence TTN
- the PAM of LbCas12a is the sequence TTTN
- the PAM of AacCas12b is the sequence TTN.
- the present invention provides a method for detecting target nucleic acid molecules, which comprises adding a guide RNA, a Cas protein, a nucleic acid probe and a buffer into the reaction system containing the target nucleic acid molecules to be detected, and then detecting the fluorescence intensity thereof
- the Cas protein is Cas12a or Cas12b.
- the Cas12a is preferably one of FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a or Lb4Cas12a; the Cas12a is preferably LbCas12a.
- the Cas12b is preferably AacCas12b, Aac2Cas12b, AkCas12b, AmCas12b, AhCas12b, and AcCas12b.
- the guide RNA refers to an RNA that directs the Cas protein to specifically target a DNA sequence.
- the target nucleic acid molecules to be detected in the reaction system containing the target nucleic acid molecules to be detected are obtained after amplification.
- the detection method detects pathogenic microorganisms, gene mutations or specific target DNA.
- the present invention provides a use of a Cas protein in a method for detecting target nucleic acid molecules.
- the complex cleaves other single-stranded DNA molecules in the system.
- the guide RNA refers to an RNA that directs the Cas protein to specifically target a DNA sequence.
- the invention also provides a kit, comprising a guide RNA, a Cas protein and a nucleic acid probe. Furthermore, the kit of the invention may further comprise a buffer.
- the present invention provides a detection method for rapidly detecting target nucleic acid molecules with high specificity. Once the target DNA (single or double stranded), the crRNA, and the Cas12a protein form a ternary complex, the complex cleaves other single-stranded DNA molecules in the system.
- the target DNA a DNA sequence to be detected
- crRNA and Cas12a protein are added to the detection system.
- the nucleic acid probe in the present invention is preferably a fluorescent probe.
- the invention provides the application of Cas12 enzyme based on Cas12a, Cas12b and the like in nucleic acid detection.
- Cas12a as an example.
- Cas12a has the activity of trans cleavage, ie, once the target DNA, crRNA and Cas12a protein form a ternary complex, other single-stranded DNA (collateral single-stranded DNA) in the system will be cleaved.
- a specific DNA detection method was designed based on this principle. Firstly, the collateral DNA was designed as a fluorescent probe consisting of a random sequence with a length of 12 nt, and labelled with the fluorescent group HEX at the 5′-terminal end and labelled with the quenching group BHQ1 (HEX-N12-BHQ1) at the 3′-terminal end.
- a ternary complex of the target DNA, crRNA and Cas12a protein will be formed.
- the probe is cleaved, and the fluorescence emitted from the HEX fluorescent group can be detected by the fluorescence detector (excitation at 535 nM, and emission at 556 nM).
- 10 different Cas12a were tested, and the target sequence was double-stranded DNA, as shown in FIG. 7 . It can be seen that the complex composed of the target double-stranded DNA and each Cas12a protein can achieve trans cleavage activity.
- HOLMES Response Sensitivity Next, the sensitivities of FnCas12a and LbCas12a response to target DNA were tested. That is, the lowest concentration of target DNA that can respond was examined. As shown in FIG. 9 , when the test target was directly added, the target DNA with concentration above 0.1 nM was able to respond, and the response was significant at a concentration above 1 nM. If the PCR technique is combined (i.e. HOLMES method), as shown in FIG. 8 , i.e. the target fragment is first amplified by PCR and then subjected to Cas12a cleavage reaction, the response sensitivity can be as low as 10 aM, as shown in FIG. 9 .
- SNP test Next, whether the HOLMES method can detect the SNP genotype was tested. T1 was used as the target sequence, and mutations were introduced in the PAM or single point mutation was introduced in the target sequence at position of 1-18. And the difference between the non-mutated sequence and the mutant sequences was compared for the crRNAs of different lengths.
- the target complementary sequence is a 24 nt crRNA (crRNA-24 nt)
- the single point mutations at position of 8-18 are not significantly different from the wild type.
- there is any mutation in the PAM and there is any point mutation at position of 1-7 there is a significant drop on the fluorescence value.
- the crRNA was truncated and the length of the paired target sequence was 18 nt
- the fluorescence value of the target sequence mutated at position 8-16 nt was significantly lower than that of the target sequence with a length of 24 nt.
- the length was shortened to 16 nt or 17 nt, the decrease of fluorescence value of the target sequence after mutation was more obvious.
- the fluorescence values of the target sequence and the mutation are weak for the target sequence, but still strong for other target sequences, which can be used for detection.
- 15 nt, 16 nt and 17 nt crRNAs are most suitable for detection of SNPs.
- Cas12a cleaves single-stranded DNA.
- a programmed cleavage mode wherein Cas12a cleaves single-stranded DNA independent of PAM sequence is called cis cleavage; and once a ternary complex Cas12a/crRNA/target DNA is formed, it shows the activity of trans-cleavage, that is, the activity of cleavage of any non-target single-stranded DNA in the system.
- HOLMES one Hour Low-cost Multipurpose Efficient Simple assay
- the invention also provides a method of nucleic acid detection based on the collateral cleavage activity of a Cas12 enzyme, including Cas12a or Cas12b.
- the detection of the invention can be performed on SNPs, in particular by PCR amplification followed by detection.
- the synthesized crRNA based on the guide sequence designed according to the PAM site can be used for HOLMES detection.
- the background signal is relatively low; for the same guide sequence, the signal difference between different SNP templates is relatively large.
- a typical procedure comprises designing a primer near the SNP site, carrying a PAM site on the primer, and the 3′ end sequence at the PAM site needs to be paired with the template DNA. There is no special requirements for the primer at the other end, and it only needs to be paired with the template DNA and can be subjected to PCR amplification. As shown in FIG. 18 , the PAM site was successfully introduced after PCR amplification.
- the SNP site is located at the position of the first 16 bases of from 5′ end of the crRNA guide sequence, preferably 1-14, more preferably 1-12, more preferably 1-11 or 1-10, and most preferably 1-8 or 1-7.
- the method of the present invention has extremely high sensitivity and can detect DNA at a concentration of 10 aM.
- Multi-purpose It can detect different nucleic acid samples, including DNA samples and RNA samples.
- the RNase inhibitor was purchased from TaKaRa.
- the high-fidelity DNA polymerase KOD FX was purchased from ToYoBo.
- the primers (oligonucleotides) were synthesized by Shanghai Sangon Biotech.
- the T7 RNA polymerase was purchased from Thermo.
- the RNA purification and concentration kit (RNA Clean & ConcentratorTM-5) was purchased from Zymo Research. Wizard® SV Gel and PCR Clean-Up System was purchased from Promega.
- the media e.g. Tryptone, Yeast Extract, etc.
- OXOID OXOID.
- Target-T1-R Single-stranded DNA
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M Cas12a, 0.01 ⁇ M target single-stranded DNA (target-T1-R), 0.01 ⁇ M nucleic acid probe (N25-5′ FAM), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. For blank control reaction, all other components were added except single-stranded DNA target sequence. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection Electrophoresis was carried out with urea-polyacrylamide gel electrophoresis (Urea-PAGE) and then detection was carried out with the fluorescence luminescence imager. As shown in FIG. 11 , different Cas12as showed distinct target defection effects. For example, HkCas12a and the like cleaved the probe even without target single-stranded DNA being added. However, LbCas12a and the like cleaved the probe only with target single-stranded DNA being added, and were good Cas12a protein candidates.
- Target-T1-R Single-stranded DNA
- T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R were annealed and used to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M Cas12a, 0.01 ⁇ M target single-stranded DNA (target-T1-R), 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1. i.e. 12 nt single-stranded DNA labelled with HEX at the 5′ end and BHQ1 at the 3′ end), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. For control reaction, all other components were added except single-stranded DNA target sequence. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm.
- different Cas12as showed distinct target defection effects.
- HkCas12a and the like cleaved the probe even without target single-stranded DNA being added.
- FnCas12a and the like cleaved the probe only with target single-stranded DNA being added, and were good Cas12a protein candidates.
- Target-T1 Double-stranded DNA (target-T1) was used as the target sequence to test the response values of different Cas12a proteins for detection thereof.
- T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M Cas12a, 0.01 ⁇ M target double-stranded DNA (target-T1, obtained from annealing of primer target-T1-F and primer target-T1-R), 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 7 , different Cas12as showed distinct target defection effects. Whereas LbCas12a and the like cleaved the probe only with target double-stranded DNA being added, and were good Cas12a protein candidates.
- Target-T1 DNA was used as target DNA, then subjected to gradient dilution into different concentrations to test the sensitivity of FnCas12a or LbCas12a response to it. To enhance the sensitivity, PCR amplification step was added.
- T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- PCR amplification (optional): Plasmid (pUC18-T1) that contained the target-T1 target, as the template, was subjected to gradient dilution and PCR reaction. The total volume of each reaction system was 20 ⁇ L, 0.25 ⁇ M of primers of M13F-47 and M13R-48 ware used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, the PCR purification products were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M FnCas12a or LbCas12a, 1 ⁇ L of PCR products (or target DNA directly diluted to different concentrations), 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 9 , target DNA at or above 0.1 nM was able to response when the test targets were directly added, and response was significant when the concentration was above 1 nM. However, combined with PCR technology, i.e., first PCR amplification of fragments of interest and then Cas12a cleavage reaction, the response sensitivity could be as low as 10 aM.
- Target-T1 DNA was used as the target and mutated in the PAM region and position 1-18, respectively.
- crRNAs of different lengths were tested for response values to the wild type and single-point mutated targets.
- T7-crRNA-F was annealed with synthetic oligonucleotides of T7-T1-24-R, T7-T1-15-R, T7-T1-16-R, T7-T1-17-R and T7-T1-18-R (Table 5), respectively, to prepare templates for transcription.
- 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h).
- the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- PCR amplification Plasmid (pUC18-T1) that contained the target-T1 target was used as the template. The total volume of each reaction system was 20 ⁇ L, 0.25 ⁇ M primers of M13R-48 and each mutant primer for Target-T1-F were used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M FnCas12a or LbCas12a, 1 ⁇ L of PCR products, 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- the fluorescence value of the mutated target sequence was decreased more remarkably.
- the fluorescence value of both the target sequences and the mutants was very weak. However, the strength thereof could be still high for other target sequences, which could be used for detection.
- crRNAs of 15 nt, 16 nt and 17 nt were the most suitable for detection of SNP.
- the E. coli gyrB gene was selected as the detection target to indirectly test the concentration of microorganisms such as E. coli in the water.
- E. coli MG1655 was used as the positive control to determine the content of microorganisms in the environmental water such as polluted water and running water.
- T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- PCR amplification The positive control sample was E. coil MG1655 which was cultured till the OD 600 reached about 0.5, then subjected to 10 times gradient dilution and used as the template. Samples were taken from environmental water, including running water and environmental mud water. The total volume of each reaction system was 20 ⁇ L, 0.25 ⁇ M primers of gyrB-F and gyrB-R were used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR amplification, the PCR products were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from step 1, 0.25 ⁇ M LbCas12a, 1 ⁇ L of PCR products, 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 13 , the fluorescence response values were gradually lowered with the decrease of the concentration of E. coli MG1655. Among these, microorganisms were obviously detected in samples 2, 4, 5 and 6.
- PCR amplification The total volume of reaction system was 20 ⁇ L, 0.25 ⁇ M primers were used (Table 4), 1 ng of human genome (HEK293T) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction.
- the PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 1 ⁇ M respective crRNA, 0.5 ⁇ M LbCas12a, 1 ⁇ L of PCR products, and 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 14 , only with the crRNA corresponding to respective target sequences, higher fluorescence response values were generated, and if one-point mutation occurred, the response value thereof would be largely reduced. The corresponding SNP genotype could be determined based on the fluorescence value, and these results were confirmed by sequencing results.
- TP53 gene was selected for testing gene.
- TP53 gene contains a nonsense mutation in human T24 cells, which results in the inactivation of this gene.
- Cells with gene at this site being normal (HEK293T), individual gene and mutated cell T24 were tested.
- T7-crRNA-F was annealed with synthetic oligonucleotides of T7-crRNA-34-TP53-T24-C-16 nt and T7-crRNA-34-TP53-T24-G-16 nt (Table 5) to prepare the template for transcription.
- 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- the crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h).
- the RNA was purified with RNA Clean & ConcentratorTM-5 (Zymo Research), quantitated with NanoDrop 2000C, diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator.
- PCR amplification The total volume of reaction system was 20 ⁇ L, 0.25 ⁇ M primers of 34-TP53-T24-F and 34-TP53-T24-R were used (Table 4), 1 ng of human genome (HEK293T, T24) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction.
- the PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 1 ⁇ M respective crRNA, 0.5 ⁇ M LbCas12a, 1 ⁇ L of PCR products, and 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- PCR amplification The total volume of reaction system was 20 ⁇ L, 0.25 ⁇ M primers were used (Table 4), 1 ng of human genome (HEK293T) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction.
- the PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction.
- Primarymers, such as 1-rs5082-F-T, 2-rs1467558-F-T and 3-rs2952768-R-C were directly introduced into respective mutated products of SNP).
- Cas12a reaction In a 20- ⁇ L reaction system was added with 1 ⁇ M respective crRNA, 0.5 ⁇ M LbCas12a, 1 ⁇ L of PCR products, and 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 16 , only with the crRNA corresponding to respective target sequences, higher fluorescence response values were generated, and if one-point mutation occurred, the response value would be largely reduced. The corresponding SNP genotype could be determined based on the fluorescence value, and the these results were confirmed by sequencing results.
- Premix was added into the 96-well plate to make a kit, then the genomic DNA of 21 volunteers was added to test the rs1014290 site, which is related to gout risk.
- T7-crRNA-F and synthetic oligonucleotides were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with RNA Clean & Concentrator TM-5 RNA (Zymo Research), quantitated with NanoDrop 2000C, and diluted to a concentration of 10 ⁇ M.
- PCR amplification The volunteers' genomic DNA was added into above premixed PCR 96-well plate for PCR reaction, and the PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s.
- Cas12a reaction 1 ⁇ L of PCR reaction liquid was added into the premixed 96-well plate for fluorescence detection and reaction was performed at 37° C. for 15 min and then stopped at 98° C. for 2 min.
- Fluorescence detection Detection was performed by a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in FIG. 17 , population with A: A genotype had higher gout risk, so, those except volunteer 5, 7 and 9 who had either A: G or G: G genotypes shall pay more attention to gout risk.
- E. coli gyrB gene was chosen as the detection target to indirectly test the presence and absence of microorganisms such as E. coli in water.
- T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ Taq DNA polymerase reaction buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, finally diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator for later use.
- LAMP amplification Sterilized water and liquid polluted with E. coli was taken as the negative control and sample to be detected, respectively.
- the total volume of each reaction system was 25 ⁇ L, 1.6 ⁇ M LAMP-FIP and LAMP-BIP primers, 0.2 ⁇ M LAMP-F3 and LAMP-B3 primers, and 0.4 ⁇ M LAMP-LoopF and LAMP-LoopB primers were used, and WarmStart® LAMP Kit (NEB) was used for LAMP reaction.
- LAMP reaction procedure was at 65° C. for 30 min. After LAMP was completed, reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from Step 1, 0.25 ⁇ M Cas12a, 1 ⁇ L of LAMP products, 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in FIG. 19 .
- T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-rs5082-T/T7-crRNA-rs5082-G/T7-crRNA-rs1467558-T/T7-crRNA-rs1467558-C (Table 5) were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ Taq DNA polymerase reaction buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C.
- LAMP amplification Human genomic HEK293T was used as the sample. The total volume of each reaction system was 25 ⁇ L, 1.6 ⁇ M LAMP-FIP and LAMP-BIP primers, 0.2 0/1 LAMP-F3 and LAMP-B3 primers, and 0.4 ⁇ M LAMP-LoopF and LAMP-LoopB primers were used, and WarmStart® LAMP Kit (NEB) was used for LAMP reaction. LAMP reaction procedure was at 65° C. for 30 min. After LAMP was completed, the reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from Step 1, 0.25 ⁇ M Cas12a, 1 ⁇ L of LAMP products, 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in FIG. 20 .
- E. coli gyrB gene was chosen as the detection target to indirectly test the presence and absence of microorganisms such as E. coli in water.
- T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB were annealed to prepare the template for transcription. Specifically, 4 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 50- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, finally diluted to a concentration of 10 ⁇ M and stored at ⁇ 80° C. in a refrigerator for later use.
- RPA amplification Sterilized water and liquid polluted with E. coli was taken as the negative control and sample to be detected, respectively.
- the total volume of each reaction system was 25 ⁇ L, 0.5 ⁇ M RPA-gyrB-F (or RPA-gyrB-F2) and RPA-gyrB-R2 were used as primer, and TwistAmp® Basic Kit (TwistDX) was used for RPA reaction.
- RPA reaction procedure was at 37° C. for 30 min. After RPA was completed, the reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- Cas12a reaction In a 20- ⁇ L reaction system was added with 0.5 ⁇ M crRNA purified from Step 1, 0.25 ⁇ M Cas12a, 1 ⁇ L of RPA products, 0.5 ⁇ M fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 ⁇ L of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min.
- Fluorescence detection 20 ⁇ L of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in FIG. 21 .
- the plasmid pUC18-guide RNA-T1 with pUC18 as the plasmid backbone was constructed by inserting T7 promoter and the template DNA sequence for transcribing guide RNA into pUC18 (note: the guide RNA transcribed from the template was targeted to the sequence named T1 in the research).
- the method is as follow: PUC18 plasmid was used as the template with pUC18-1-F and pUC18-1-R as primers for the first round of PCR amplification, and the PCR products were ligated using T4 DNA ligase before being transformed into DH10b.
- the correct clone was obtained by sequencing, which was named as pUC18-guide RNA-T1-pre.
- pUC18-guide RNA-T1-pre was then used as the template for the second round of PCR amplification with pUC18-2-F and pUC18-2-R as primers.
- the PCR products were ligated and transformed into DH10b, and finally, a correctly sequenced plasmid pUC18-guide RNA-T1 is obtained.
- guide RNA was synthetized, using T7 high-yield transcription kit (Thermo), with the plasmid PUC18-guide RNA-T1 as the template. The reaction was performed overnight at 37° C. (12-16 h).
- target DNA is single stranded
- target-T1-R the target DNA
- T1 20-bp target sequence recognized by guide RNA
- target-T1-F and target-T1-R complementary 66-bp oligonucleotides
- T1-F and target-T1-R complementary 66-bp oligonucleotides
- the two oligonucleotides were annealed to obtain target DNA.
- 1 ⁇ M of paired oligonucleotides were annealed in 1 ⁇ PCR buffer (Transgen Biotech) with a volume of 20- ⁇ L, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- guide RNA was diluted to an appropriate concentration (10 ⁇ M) and annealed in a PCR instrument, following the annealing procedure: denaturation at 75° C. for 5 min, and then cooling down from 75° C. to 20° C. (decrease by 1° C. per min).
- Step (2) In a 20- ⁇ L reaction system, a mixture of guide RNA and C2c1 (the concentration of both is 250 ⁇ M or 500 ⁇ M) incubated in Step (2), target DNA (final concentration of 50 nM), FAM-labelled oligonucleotides (target-DNMT1-3-R-FAM-5′) or fluorescence quenching probe (HEX-N12-BHQ1, final concentration of 500 nM), 2 ⁇ L of 10 ⁇ NEB Buffer 3.1 and 0.5 ⁇ L of RNA enzyme inhibitor (40 U/ ⁇ L) were added. After mixing well, they were allowed to react at 48° C. for 30 min. Afterwards, they were heated at 98° C. for 5 min in a PCR instrument for inactivation.
- target DNA final concentration of 50 nM
- FAM-labelled oligonucleotides target-DNMT1-3-R-FAM-5′
- fluorescence quenching probe HEX-N12-BHQ1, final concentration of 500 nM
- the target DNA concentration required for Cas12b to perform trans-cleavage activity could be determined, which is the sensitivity of Cas12b trans-cleavage reaction.
- the 20 bases of the target DNA targeting T1 in the guide RNA were substituted with the guide RNA targeting DNMT1-3 to obtain another plasmid pUC18-guide RNA-DNMT1-3 by PCR, with pUC18-guide RNA-T1 as the template as well as with the guide RNA-DNMT1-3-F and the guide RNA-DNMT1-3-R as primers.
- guide RNA was synthesized using the T7 high-yield transcription kit (Thermo), with the plasmid PUC18-guide RNA-DNMT1-3 as the template, the reaction was performed at 37° C. overnight (12-16 h).
- the first method was a reaction system directly added with the Cas12b without amplification, as follows:
- DNMT1-3(TTC PAM)-R the target DNA
- DNMT1-3 20-bp target sequence recognized by guide RNA
- DNMT1-3 TTC PAM-F and DNMT1-3 (TTC PAM)-R
- DNMT1-3 20-bp target sequence
- the two oligonucleotides were annealed to obtain short target DNA.
- the paired oligonucleotides (2 ⁇ M) were annealed in 1 ⁇ PCR buffer (Transgen Biotech) of the total volume 20 ⁇ L, followed by performing the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. in a thermocycler (decrease by 1° C. per min).
- the single stranded or double stranded target DNA was serially diluted to 2 ⁇ M, 0.2 ⁇ M, 0.02 ⁇ M, 0.002 ⁇ M and 0.0002 ⁇ M for later use.
- the second method is that a fragment with the target sequence (DNMT1-3) was inserted into a plasmid vector and amplified by LAMP reaction.
- the fragment with the target sequence (DNMT1-3) was inserted into the pEasy-Blunt Zero Cloning Vector using the pEasy-Blunt Zero Cloning Kit of Transgen company and verified by sequencing to obtain correct cloning.
- the above plasmids were used as the template for LAMP amplification reaction, and the templates were added with 0 nM, 1 nM, 0.1 nM (diluted to 10 ⁇ 11 nM at 10 fold gradient).
- the total volume of each reaction system was 25- ⁇ L
- the primers used is 1.6 ⁇ M LAMP-DNM-FIP and LAMP-DNM-BIP primers, 0.2 ⁇ M LAMP-DNM-F3 and LAMP-DNM-B3 primers, and 0.4 ⁇ M LAMP-DNM-LoopF and LAMP-DNM-LoopB
- the kit used in the LAMP reaction was WarmStart® LAMP Kit (NEB).
- LAMP reaction program was at 65° C. for 30 min. After LAMP was completed, quenching at 80° C. for 10 min, and then directly used for Cas12b reaction.
- Annealing of guide RNA guide RNA was diluted to an appropriate concentration (5 ⁇ M), and placed in a PCR instrument for annealing. The annealing procedure: denaturation at 75° C. for 5 min, and then cooling down from 75° C. to 20° C. (decrease by 1° C. per min).
- Step (2) in a 20- ⁇ L reaction system, a mixture of guide RNA and Cas12b (the concentration of both is 250 ⁇ M) incubated in Step (2), 1 ⁇ L of target DNA or 1 ⁇ L of LAMP products, fluorescence probe (HEX-N12-BHQ1) (final concentration 500 nM), as well as 2 ⁇ L of 10 ⁇ NEB buffer 3.1 and 0.5 ⁇ L of RNA enzyme inhibitor (40 U/ ⁇ L) were added. After mixing well, they were allowed to react at 48° C. for 30 min. Afterwards, they were heated at 98° C. for 5 min in a PCR instrument to quench.
- HEX-N12-BHQ1 fluorescence probe
- reaction liquid inactivated 20 ⁇ L was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm.
- the Cas12b could produce significant collateral ssDNA trans-cleavage activity for as low as 10 aM target DNA. As is shown in FIG. 24 .
- Single-stranded DNA cleavage by Cas12a was found to be programmable, i.e., the cleavage site is from the first base in the 3′ end of the target sequence paired with the crRNA guide sequence to near the 22nd base (from 21st to 23rd bases) of the target sequence counted in the 5′ end, as shown in FIGS. 1 A and 1 C .
- the dsDNA cleavage of Cas12a requires a PAM sequence, whereas ssDNA cleavage does not require a PAM sequence ( FIG. 1 A, 1 B and FIG. 2 ), which is similar to Cas9-mediated ssDNA cleavage.
- the Cas12a-mediated ssDNA cleavage activity is dependent on the stem-loop structure in crRNA, as shown in FIG. 1 A , while Cas9 still exhibits weak cleavage activity against ssDNA with only 20-nt complementary RNA sequences.
- the stem-loop structure of crRNA is important for stabilizing the structure of Cas12a, which is responsible for the necessity of stem-loop structure of crRNA for ssDNA cleavage of Cas12a. It is further tested whether the ssDNA cleavage site by Cas12a can passed through a shorter guide sequence crRNA, such that the cleavage is outside the recognition site.
- the ternary complex also cleaves ssDNA that does not have any complementary sequence to the crRNA in any other reaction system (i.e., collateral ssDNA), as shown in FIGS. 3 C and 3 D .
- This cleavage phenomenon is a trans cleavage, which is distinguished from a programmable cis cleavage. Trans cleavage was also observed when the target ssDNA was labelled at the 3′-end, but many cis-cleaved products were left, as shown in FIG.
- Trans cleavage activity of the Cas12a complex In the structure of the Cas12b (i.e. C2c1) complex with additional ssDNA, sequence-independent ssDNA is also located on the surface of the catalytic pocket, as shown in FIG. 6 C , which is similar to the collateral ssDNA substrate for Cas12a. Combining single amino acid mutation experiments, it is proposed that target DNA, non-target DNA and collateral ssDNA were all cleaved in a single RuvC pocket in Cas12a, as shown in FIGS. 6 D, 6 E and 6 F .
- the reason why the ternary Cas12a complex has collateral ssDNA trans cleavage activity but the monomeric or binary complex does not have collateral ssDNA trans cleavage activity can be explained by comparing monomeric, binary, and ternary complex structures.
- the monomeric Cas12a structure is disordered.
- the binary complex Cas12a/crRNA is a triangular structure, as shown in FIG. 6 G , while the ternary complex Cas12a/crRNA/target DNA is converted into a bilobal structure, thereby exposing the catalytic pocket to achieve trans cleavage of the collateral ssDNA (as shown in FIG. 6 H ).
- HOLMES one Hour Low-cost Multipurpose Efficient Simple assay
- the whole reaction system it can be divided into two large steps.
- One is the amplification of the template nucleic acid, and the other is the specific nucleic acid detection of the Cas12a protein.
- PCR is used for amplification of nucleic acids, but in practice, any amplification method can be combined with nucleic acid detection of the second step, such as isothermal amplification method RPA or the like.
- the initial nucleic acid is not limited to double-stranded DNA, and may be single-stranded DNA; even RNA can be detected by reverse transcription, and thus the method is applicable to various types of nucleic acid molecules.
- the nucleic acid detection stage three components are the key to the experiment, namely Cas12a, crRNA and the nucleic acid probe.
- the crRNA as a guiding role is more stable in the system after being engineered by artificial modification or the like.
- nucleic acid probes HEX and BHQ1 labelled short single stranded DNA is selected in the present invention, and any other detectable labeling method is theoretically applicable as long as producing a detectable difference after the nucleic acid probe is cleaved.
- the nucleic acid probe can also be designed to be fluorescent after binding to the compound to probe whether the probe is cut off.
- Plasmids pET28a-TEV pET28a with the thrombin (Carneiro, cleavage site changed to the Silva TEV protease cleavage et al. 2006) site pET28a-TEV-FnCas12a pET28a-TEV carrying (Li, Zhao FnCas12a et al. 2016) pET28a-TEV-AsCas12a pET28a-TEV carrying (Li, Zhao AsCas 12a et al.
- sequences involved in the present invention Name Sequence SEQ ID No.: AacCas12b sgRNA GTCTAGAGGACAGAATTTTTCAACGGGTGTG 183 sequence CCAATGGCCACTTTCCAGGTGGCAAAGCCCG TTGAGCTTCTCAAATCTGAGAAGTGGCACcctg atggtccatgtctgtt Guide sequence cctgatggtccatgtctgtt 184 targeting target DNMT-1-3 Single-stranded gtcacgccacttgacaggcgagtacagacatggaccatcagggaacatt 185 target sequence Double-stranded gtcacgccacttgacaggcgagtaacagacatggaccatcagggaacatt 186 target sequence: amino acid MAVKSIKVKLRLDDMPEIRAGLWKLHKEVNA 187 sequence of GVRYYTEWLSLLRQENLYRRSPNGDGEQECDK
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Pathology (AREA)
- Plant Pathology (AREA)
- Medicinal Chemistry (AREA)
- Hospice & Palliative Care (AREA)
- Oncology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The present invention provides use of a Case protein, and a method and a kit for detecting target nucleic acid molecules. The method for detecting target nucleic acid molecules comprises adding a guide RNA, a Cas12a, and a nucleic acid probe into a reaction system containing target nucleic acid molecules to be detected, and detecting it after the reaction is completed.
Description
- This application is continuation application of U.S. application Ser. No. 17/224,541, filed Apr. 7, 2021, which is a continuation of U.S. application Ser. No. 16/631,157, filed Jan. 14, 2020 which is a national stage filing under section 371 of International Application No. PCT/CN2018/82769, filed on Apr. 12, 2018, and published on Jan. 17, 2019 as WO 2019/011022, which claims priority to Chinese Application No. 201710573752.0, filed on Jul. 14, 2017. The entire contents of each of these priority applications are hereby incorporated herein by reference.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 6, 2020, is named 2013065-0286_SL.txt and is 56,958 bytes in size.
- The present invention belongs to the field of biotechnology, and in particular, the present invention relates to a method for the detection of target nucleic acid molecules.
- Specific detection method of nucleic acids has important values in applications such as pathogen detection, genetic disease detection and the like. For pathogen detections, because each pathogenic microorganism has its unique characteristic nucleic acid sequences, the detection of nucleic acid molecules for specific species can be developed, also known as nucleic acid diagnostics (NADs), plays an important role in the field of food safety, environmental microbial pollution detection, human pathogen infections and the like. In another aspect, the NAD methods can also detect single nucleotide polymorphisms (SNPs) in human beings or other species. Understanding the relationship between genetic variation and biological function at the genomic level may provide a new perspective for modern molecular biology, among which SNPs are closely related to biological function, evolution, disease and the like, thus the development of techniques for detection and analysis of SNPs is particularly important.
- So far, several NAD methods have been established, most of which are created for the detection of specific DNA molecules and some of which are for RNA molecules. Usually, DNA molecules are very stable and detection samples can be from a series of complex biological samples, while RNA molecules can be easily degraded and should be treated with care. In 1970s, restriction endonuclease digestion detection methods were developed, and then by the development of methods for detection of specific nucleic acid molecules such as Southern, Northern and dot hybridization. In 1985 when the PCR method became a routine experimental method, it led to exponential progress in molecular biology. The detection of specific nucleic acid molecules currently established usually requires two steps, the first step being target nucleic acid amplification and the second step being target nucleic acid detection. PCR technique is the first established and currently most commonly used amplification method. Based on the PCR method, fluorescence labelled probes are introduced to facilitate realtime detection of the amplification of target (named as Realtime PCR), which is a rapid and highly sensitive detection method and can be used for quantitative analysis. Besides of PCR amplification method, many alternative methods have been created, such as the ligase chain reaction, the branched DNA amplification, NASBA, SDA, transcription-mediated amplification, loop-mediated isothermal amplification (LAMP), rolling circle amplification (RCA), Recombinase Polymerase Amplification (RPA) and the like. The advantage of these alternative methods lies in the isothermal characteristic, that's to say that the reaction can be simply accomplished at one temperature, without the need for thermal cycling instruments for PCR. In addition to real-time PCR, which can directly complete amplification and detection, among nucleic acid detection methods, FISH hybridization technology (Fluorescence in situ hybridization), the most commonly used detection method, hybridizes in situ with complementary target sequences by labeling molecular probes. In addition, detection methods such as next-generation sequencing technologies and Oxford Nanopore sequencing technologies have also been developed, but these methods usually require expensive experimental equipment.
- The detection of SNPs first also needs to be amplified by PCR and other methods to obtain enough amounts of fragments containing SNP site regions for further detection. Common approaches include primer extension, hybridization, ligation and enzymatic cleavage. After completing the above methods, you need to use specific methods for detection, such as mass spectrometry detection, fluorescence detection, chemiluminescence detection, etc.
- Although many detection methods have been developed as described above for nucleic acid detection, in some cases, faster, simpler and cheaper detection is still an important development direction, such as rapid detection of pathogens in the wild, rapid detection of drug-sensitive SNPs, etc. In 2016, Collins et al. developed a rapid and inexpensive method for detecting Zika virus based on the characteristics of CRISPR-Cas9 that specifically recognizes and cleaves target sequences. In 2017, Zhang Feng et al. took advantage of the collateral effect of CRISPR-Cas13a to build a rapid nucleic acid detection method. “Collateral effect”, i.e., Cas13a binds to specific target RNA and then randomly cleaves other non-target RNAs (here, the RNA molecule is designed as an RNA fluorescence reporter system), combined with isothermal amplification technology RPA to achieve rapid target RNA detection; and Zhang Feng team called this detection method as SHERLOCK (Specific High Sensitivity Enzymatic Reporter UnLOCKing). The SHERLOCK method involves the binding of RNA templates, so if you need to detect DNA, DNA should be first transcribed to RNA for detection; in view of the instability of RNA, this method will undoubtedly increase the difficulty of operation.
- In 2015, Zhang Feng et al. discovered a new CRISPR-associated protein endonuclease Cas12a (formerly known as Cpf1), which is an RNA-guided specific DNA endonuclease like the commonly used Cas9 protein; but compared with Cas9, Cas12a has its own characteristics, such as the need for crRNA to guide the specific cleavage of double-stranded DNA and produce cohesive ends.
- The object of the present invention is to provide a method for detecting target nucleic acid molecules.
- Another object of the present invention is to provide a use of a Cas protein in a method for detecting target nucleic acid molecules.
- In a first aspect of the invention, provided is a kit, comprising a guide RNA, a Cas protein, a nucleic acid probe and a buffer.
- provided is a method for detecting target nucleic acid molecules, which comprises adding a guide RNA, a Cas protein, a nucleic acid probe and a buffer into the reaction system containing the target nucleic acid molecules to be detected, and then detecting the target nucleic acid molecules (especially by detection of the fluorescence intensity).
- Preferably, the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a.
- Preferably, the Cas protein is Cas12a.
- The Cas12a is preferably one of FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a or Lb4Cas12a.
- Preferably, the Cas12a is LbCas12a.
- Preferably, the guide RNA refers to an RNA that directs the Cas protein to specifically bind to the target DNA.
- In another preferred embodiment, the nucleic acid probe is a single-stranded DNA; the single-stranded DNA is preferably a fluorescently labelled single-stranded DNA; and the single-stranded DNA is preferably a fluorescent probe labelled with a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end.
- In another preferred embodiment, the detection method of the nucleic acid probe is preferably a fluorescence detection method; and the fluorescence detection method is preferably by using a microplate reader or a fluorescence spectrophotometer.
- Preferably, the target nucleic acid molecules to be detected in the reaction system of the target nucleic acid molecules to be detected are obtained after amplification.
- Preferably, the detection method of the present invention can detects pathogenic microorganisms, gene mutations or specific target DNA.
- In another preferred embodiment, the Cas protein comprises Cas12b (C2c1).
- In a second aspect of the invention, provided is a use of a Cas protein in a method for detecting target nucleic acid molecules, or for preparing a preparation for the detection of target nucleic acid molecules.
- In another preferred embodiment, when the target DNA, the guide RNA and the Cas protein form a ternary complex, the complex cleaves other single-stranded DNA molecules in the system.
- Preferably, the guide RNA refers to an RNA that directs the Cas protein to specifically bind to the target DNA.
- In a third aspect of the invention, provided is a kit comprising a guide RNA, a Cas protein and a nucleic acid probe.
- In another preferred embodiment, the kit further comprises a buffer.
- In a fourth aspect of the invention, provided is a detection system for detecting target nucleic acid molecules, comprising:
- (a) a Cas protein, which is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
- (b) a guide RNA, which directs the Cas protein to specifically bind to target nucleic acid molecules; and
- (c) a nucleic acid probe, which is a single-stranded DNA;
- Wherein the target nucleic acid molecule is a target DNA.
- In another preferred embodiment, the detection system further comprises (d) a buffer.
- In another preferred embodiment, the detection system further comprises target nucleic acid molecules to be detected.
- In another preferred embodiment, the concentration of the target nucleic acid molecules to be detected in the detection system is from 1 to 100 copies/μL or 1015 copies/μL, preferably from 1 to 10 copies/μL, more preferably from 1 to 5 copies/μL.
- In another preferred embodiment, in the detection system, the molar ratio of the nucleic acid probe to the target nucleic acid molecule is from 103:1 to 1014:1, preferably from 104:1 to 107:1.
- In another preferred embodiment, the detection site of the target nucleic acid molecule is located at positions 1-12 downstream of the PAM sequence of the guide RNA.
- In another preferred embodiment, the length of the guide RNA is 15-30 nt, preferably 15-18 nt.
- In another preferred embodiment, the target DNA comprises cDNA.
- In another preferred embodiment, the target DNA is selected from the group consisting of: single-stranded DNA, double-stranded DNA, or a combination thereof.
- In another preferred embodiment, the nucleic acid probe has a fluorescent group and a quenching group.
- In another preferred embodiment, the fluorescent group and the quenching group are each independently located at the 5′ end, the 3′ end, and the middle of the nucleic acid probe.
- In another preferred embodiment, the length of the nucleic acid probe is from 3 to 300 nt, preferably from 5 to 100 nt, more preferably from 6 to 50 nt, and most preferably from 8 to 20 nt.
- In another preferred embodiment, the target nucleic acid molecules comprise target nucleic acid molecules derived from a species selected from the group consisting of: a plant, an animal, an insect, a microorganism, a virus, or a combination thereof.
- In another preferred embodiment, the target DNA is a artificially synthesized or a naturally occurring DNA.
- In another preferred embodiment, the target DNA comprises a wild-type or a mutant DNA.
- In another preferred embodiment, the target DNA comprises DNA obtained by RNA reverse transcription or amplification, such as cDNA and the like.
- In another preferred embodiment, the Cas12a is selected from the group consisting of: FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a, Lb4Cas12a or a combination thereof; more preferably, the Cas12a is LbCas12a.
- In another preferred embodiment, the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (i.e., C2c1).
- In another preferred embodiment, the Cas12b protein is selected from the group consisting of: AacCas12b (Alicyclobacillus acidoterrestris), Aac2Cas12b (Alicyclobacillus acidiphilus), AkCas12b (Alicyclobacillus kakegawensis), AmCas12b (Alicyclobacillus macrosporangiidus), AhCas12b (Alicyclobacillus herbarius), and AcCas12b (Alicyclobacillus contaminans).
- In another preferred embodiment, the nucleic acid probe comprises a single-stranded DNA with a detectable label.
- In another preferred embodiment, the single-stranded DNA is a single-stranded DNA labelled with fluorescence and biotin.
- In another preferred embodiment, the single-stranded DNA is a single-stranded DNA labelled with fluorescence.
- In another preferred embodiment, the single-stranded DNA is a fluorescent probe labelled with a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end.
- In a fifth aspect of the invention, provided is a kit for detecting target nucleic acid molecules, comprising:
- i) a first container and a Cas protein located in the first container, wherein the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
- ii) optionally a second container and a guide RNA located in the second container, wherein the guide RNA directs the Cas protein to specifically bind to the target nucleic acid molecules;
- iii) a third container and a nucleic acid probe located in the third container;
- iv) optionally a fourth container and a buffer located in the fourth container;
- Wherein the target nucleic acid molecule is a target DNA.
- In another preferred embodiment, any two, three, or four (or all) of the first, second, third, and fourth container may be the same or different container.
- In another preferred embodiment, the nucleic acid probe has a fluorescent group and a quenching group.
- In a sixth aspect of the invention, provided is a method for detecting whether target nucleic acid molecules are present in a sample, charcterized by comprising the steps of:
- (a) providing a detection system for detecting target nucleic acid molecules according to the fourth aspect of the invention, and the detection system further contains a sample to be detected; and
- (b) detecting whether the nucleic acid probe in the detection system is cleaved by the Cas protein, wherein the cleavage is a trans-cleavage of the collateral single-stranded DNA;
- Wherein, if the nucleic acid probe is cleaved by the Cas protein, it indicates that the target nucleic acid molecule is present in the sample; and if the nucleic acid probe is not cleaved by the Cas protein, it indicates that the target nucleic acid molecule is not present in the sample.
- In another preferred embodiment, the sample to be detected comprises an unamplified sample and an amplified (or nucleic acid amplified) sample.
- In another preferred embodiment, the sample to be detected is a sample obtained by amplification.
- In another preferred embodiment, the nucleic acid amplification method is selected from the group consisting of: PCR amplification, LAMP amplification, RPA amplification, ligase chain reaction, branched DNA amplification, NASBA, SDA, transcription-mediated amplification, rolling circle amplification, HDA, SPIA, NEAR, TMA and SMAP2.
- In another preferred embodiment, the PCR comprises high temperature PCR, normal temperature PCR, and low temperature PCR.
- In another preferred embodiment, the method is for detecting whether there is an SNP, a point mutation, a deletion, and/or an insertion for nucleic acids at a target site.
- In another preferred embodiment, when the PAM sequence is absent at the upstream or downstream of the target site (in the range of from −20 nt to +20 nt, preferably in the range of from −15 nt to +15 nt, and more preferably in the range of from −10 nt to +10 nt), nucleic acid amplification was carried out using primers introduced with PAM.
- In another preferred embodiment, the primer introduced with PAM has a structure of formula I from 5′ to 3′:
-
P1-P2-P3 (I) - wherein,
- P1 is a 5′ segment sequence complementary or non-complementary to the sequence of the target nucleic acid molecule at the 5′ end;
- P2 is a PAM sequence; and
- P3 is a 3′ segment sequence complementary to the sequence of the target nucleic acid molecule at the 3′ end.
- In another preferred embodiment, the PAM primer specifically binds upstream or downstream of the target nucleic acid molecule.
- In another preferred embodiment, P1 has a length of 0 to 20 nt.
- In another preferred embodiment, P3 has a length of 5 to 20 nt.
- In another preferred embodiment, the PAM primer has a length of 18 to 50 nt, preferably 20 to 35 nt.
- In another preferred embodiment, the complementation comprises full complementation and partial complementation.
- In another preferred embodiment, at least one primer with a PAM sequence is used in the nucleic acid amplification.
- In another preferred embodiment, when the PAM sequence is present at the upstream or downstream of the target site (in the range of from −20 nt to +20 nt, preferably in the range of from −15 nt to +15 nt, and more preferably in the range of from −10 nt to +10 nt), primers with or without a PAM sequence can be used, and the amplified amplification product contains the PAM sequence.
- In another preferred embodiment, the detection in step (b) comprises a fluorescence detection method.
- In another preferred embodiment, a microplate reader or a fluorescence spectrophotometer is used in the fluorescence detection method.
- In a seventh aspect of the invention, provided is a use of a Cas protein for the preparation of a detection reagent or kit for detecting target nucleic acid molecules based on a collateral single-stranded DNA cleavage, wherein the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a.
- In another preferred embodiment, the Cas12a is selected from the group consisting of: FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a, Lb4Cas12a or a combination thereof; more preferably, the Cas12a is LbCas12a.
- In another preferred embodiment, the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (or C2c1).
- In another preferred embodiment, the Cas12b protein is selected from the group consisting of: AacCas12b.
- It should be understood that within the scope of the present invention, the various technical features of the present invention above and the various technical features specifically described hereinafter (as in the Examples) may be combined with each other to constitute a new or preferred technical solution. Due to space limitations, it is not repeated here.
-
FIG. 1A-G shows the cis-cleavage characteristics of the Cas12a cleaving target single-stranded DNA.FIGS. 1C and 1D discloses 3 and 3, respectively, in order of appearance.SEQ ID NOS -
FIG. 2A-B shows Cas12a cleaves target single-stranded DNA independent of PAM sequence required for cleaving double strands.FIG. 2B discloses 3, 11, 13, 12, 1, 3, 14, 11, 16, 13, 15, and 12, respectively, in order of appearance.SEQ ID NOS -
FIG. 3A-D shows the trans-cleavage characteristics of the Cas12a cleaving single-stranded DNA. -
FIG. 4A-D shows 10 different sources of Cas12a tested, all of which have cis- and trans-cleavage activity for single-stranded DNA. -
FIG. 5A-D shows through Cas12a single-point mutation experiment, the sites in Cas12a that may be related to the cis- and trans-cleavage activity of single-stranded DNA were identified. -
FIG. 6 shows the structures of Cas12a and Cas12b (i.e., C2c1) monomers and their complexes with guide RNA and target DNA. -
FIG. 7 shows different Cas12a uses specific double-stranded DNA substrates and single-stranded DNA (HEX-N12-BHQ1) as the fluorescent detection probe to obtain the fluorescence value. The negative control group does not add specific substrates. No specific substrate added was employed as the negative control group. -
FIG. 8 shows schematic of target DNA detection by the HOLMES method based on target DNA amplification and Cas12a trans-cleavage activity against collateral single-stranded DNA. -
FIG. 9A-B shows sensitivity test of target DNA by direct use of FnCas12a or LbCas12a, or in combination of the HOLMES method. -
FIG. 10A-B shows fluorescence detection value of the HOLMES method using crRNAs with different lengths of the guide sequence combined with FnCas12a or LbCas12a on target sequences with different single point mutations. -
FIG. 11A-B shows using FAM-labeled fluorescent probes, 10 Cas12a proteins were selected to test whether the FAM-labeled single-stranded DNA probe is trans-cleaved after adding the target single-stranded DNA. -
FIG. 12 shows using HEX-N12-BHQ1 as a probe, 10 Cas12a proteins were selected to test the fluorescence value after adding the target single-stranded DNA. -
FIG. 13A-B . (A) Single-stranded DNA fluorescent probes labeled with HEX and BHQ1 at both ends show HOLMES detection values using the gyrB gene fragment as the target sequence and different concentrations of pure cultured E. coli MG1655 as the positive control template. It is shown that as the concentration of E. coli MG1655 decreases, its fluorescence response value gradually decreases. (B) Detection values of environmental water samples in different locations. -
FIG. 14A-F shows schematic diagram of the HOLMES method for detecting SNPs, and the fluorescence detection values of 5 SNP sites. -
FIG. 15 shows the fluorescence detection values in key sites when using HOLMES method for detecting TP53 gene (a cancer-related gene). -
FIG. 16A-E shows the detection values of 5 SNP sites (gout related) by using HOLMES method. -
FIG. 17 shows the detection values of 1 SNP site (gout related) by using HOLMES method, with samples from 21 volunteers. -
FIG. 18 shows a scheme for primers design in one Example of the present invention, which could be used for HOLMES detection of SNP in any site. -
FIG. 19A-B shows the detection of E. coli with the combination of LAMP and HOLMES in the system. (A) The electrophoretogram of the E. coli gyrB gene amplified by LAMP. Two groups of primers (i.e. gyrB-1 and gyrB-2) were used to amplify the gyrB gene, which is the informative gene of E. coli. (B) Detection of the LAMP amplification products with HOLMES detection system. Negative control: The sample was sterilized water, and the gyrB gene was amplified or the result thereof was detected with gyrB-1 amplification primers. gyrB-1: The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the first group of gyrB gene amplification primers. gyrB-2: The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the second group of gyrB gene amplification primers. -
FIG. 20A-B shows the detection of the genotypes of human HEK293T cells through the combination detection of LAMP and HOLMES. (A) The electrophoretogram of SNP detection template corresponding to human HEK293T amplified by LAMP. Negative control: The sample was sterilized water, and the amplification result was detected with rs5082 amplification primers. rs5082: The sample was the total genomic DNA from human HEK293T cells, and the amplification result was detected with rs5082 amplification primers. rs1467558: The sample was the genomic DNA from human HEK293T cells, and the amplification result was detected with rs1467558 amplification primers. (B) Detection of the LAMP amplification product with HOLMES detection system. Two crRNAs, crRNA-G and crRNA-T were used for detection of the rs5082 site (Sequence Listing 5), respectively, and two crRNAs, crRNA-C and crRNA-T were used for detection of the rs1467558 site (Sequence Listing 5), respectively. -
FIG. 21A-B shows the detection of E. coli with the combination of RPA and HOLMES in the system. (A) Amplification of the E. coli gyrB gene with RPA. Two groups of primers (i.e. gyrB-1 and gyrB-2) were used to amplify the gyrB gene, which is the informative gene of E. coli. (B) Detection of the RPA amplification products with HOLMES detection system. Negative control: The sample was sterilized water, and the gyrB gene was amplified or the result thereof was detected with gyrB-1 amplification primers. gyrB-1: The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the first group of gyrB amplification primers. gyrB-2: The sample was the E. coli to be detected, and gyrB gene was amplified or the result thereof was detected with the second group of gyrB amplification primers. -
FIG. 22 shows the detection of the collateral ssDNA cleavage activity of Cas12b with ssDNA as target DNA. After the collateral cleavage reaction, the reactants were subject to denatured gel electrophoresis separation with 12% urea and detected with the fluorescence imaging system. The number in the brackets stood for the final concentration, in nM, of reactants. The 50 nM ssDNA of 66 nts was used as the target DNA, and 50nM 5′-end FAM-labelled ssDNA was used as the ssDNA probe. As shown in the figure, with the addition of Cas12b, guide RNA and target DNA, FAM-labelled ssDNA was cleaved into fragments, demonstrating that Cas12b had collateral ssDNA cleavage activity. -
FIG. 23 shows the detection of the collateral ssDNA cleavage activity of Cas12b with ssDNA or dsDNA as target DNA. After collateral cleavage reaction was completed, the reactants were detected with a fluorescence microplate reader. The amount of Cas12b and guide RNA was 500 nM. 50 nM ssDNA (66-nt) or dsDNA (66-nt) was used as the target DNA. 500 nM ssDNA probe containing fluorescence reporter and quencher group (HEX-N12-BHQ1) was used as the ssDNA probe. As shown in the figure, upon the addition of Cas12b and guide RNA, no matter ssDNA template or dsDNA template, the collateral ssDNA cleavage activity could be detected. -
FIG. 24 shows the collateral ssDNA trans-cleavage activity generated by Cas12b with the combination of LAMP amplification for low-concentration target DNA. - In order to make the aim, technical solution and advantages of the Examples of the present invention clearer, the technical solutions in the embodiments of the present invention will be clearly and completely described in conjunction with the drawings in the Examples of the present invention. Obviously, the Examples described herein are not all of the Examples of the present invention. All other Examples obtained by those skilled in the art based on the Examples of the present invention without creative efforts are within the scope of the present invention.
- By extensively and intensively studies, the present inventors have developed a technical solution for target nucleic acid detection, by studying the cleavage properties of Cas enzymes such as Cas12a and Cas12b enzymes. The experimental results show that the above technical solutions are successfully used to rapidly detect nucleic acids. For example, identification of whether the water contains a certain concentration of microorganisms such as Escherichia coli and rapid identification of SNP genotypes are accomplished. On this basis, the present invention has been completed.
- The terms
- The term “guide RNA” refers to an RNA that directs the Cas protein to specifically bind to a target DNA sequence.
- The term “crRNA” refers to CRISPR RNA, which is a short RNA that directs Cas12a to bind to a target DNA sequence.
- The term “CRISPR” refers to clustered regular interspaced short palindromic repeats, which are the immune systems of many prokaryotes.
- The term “Cas protein” refers to a CRISPR-associated protein which is a related protein in the CRISPR system.
- The term “Cas12a” (formerly “Cpf1”) refers to a crRNA-dependent endonuclease, which is an enzyme of type V-A in the CRISPR system classification.
- The terms “Cas12b”, and “C2c1” are used interchangeably and refer to a crRNA-dependent endonuclease, which is an enzyme of type V-B in the CRISPR system classification.
- The term “LAMP” is a loop-mediated isothermal amplification technique and is a thermostatic nucleic acid amplification technique suitable for gene diagnosis.
- The term “PAM” refers to a protospacer-adjacent motif, which is required for Cas12a cleavage. The PAM of FnCas12a is the sequence TTN, the PAM of LbCas12a is the sequence TTTN, and the PAM of AacCas12b is the sequence TTN.
- The present invention provides a method for detecting target nucleic acid molecules, which comprises adding a guide RNA, a Cas protein, a nucleic acid probe and a buffer into the reaction system containing the target nucleic acid molecules to be detected, and then detecting the fluorescence intensity thereof
- The Cas protein is Cas12a or Cas12b.
- The Cas12a is preferably one of FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a or Lb4Cas12a; the Cas12a is preferably LbCas12a.
- The Cas12b is preferably AacCas12b, Aac2Cas12b, AkCas12b, AmCas12b, AhCas12b, and AcCas12b.
- The guide RNA refers to an RNA that directs the Cas protein to specifically target a DNA sequence.
- The target nucleic acid molecules to be detected in the reaction system containing the target nucleic acid molecules to be detected are obtained after amplification.
- The detection method detects pathogenic microorganisms, gene mutations or specific target DNA.
- The present invention provides a use of a Cas protein in a method for detecting target nucleic acid molecules.
- When the target DNA, the guide RNA and the Cas protein form a ternary complex, the complex cleaves other single-stranded DNA molecules in the system.
- The guide RNA refers to an RNA that directs the Cas protein to specifically target a DNA sequence.
- The invention also provides a kit, comprising a guide RNA, a Cas protein and a nucleic acid probe. Furthermore, the kit of the invention may further comprise a buffer.
- The present invention provides a detection method for rapidly detecting target nucleic acid molecules with high specificity. Once the target DNA (single or double stranded), the crRNA, and the Cas12a protein form a ternary complex, the complex cleaves other single-stranded DNA molecules in the system. In the method, the target DNA (a DNA sequence to be detected) is targeted by the designed crRNA; and crRNA and Cas12a protein are added to the detection system. When the target DNA is present, Cas12a, the crRNA and the target DNA form a ternary complex, and the complex cleaves the single-stranded DNA with fluorescent signal label (the fluorescent group and the quenching group are respectively labelled to the two ends, and the fluorescent group can be luminescent after the DNA is cleaved) using its collateral cleavage activity, thereby emitting fluorescence. Therefore, by detecting the fluorescence, it is possible to know whether or not the target DNA molecule is contained in the system to be detected. The method of the present invention allows rapid detection of whether a sample contains a specific DNA sequence. By combining with PCR technology, the sensitivity of the detection method can be greatly improved. The nucleic acid probe in the present invention is preferably a fluorescent probe.
- HOLMES Condition Test:
- The invention provides the application of Cas12 enzyme based on Cas12a, Cas12b and the like in nucleic acid detection. The following describes Cas12a as an example.
- Selection of Cas12a: According to the study, Cas12a has the activity of trans cleavage, ie, once the target DNA, crRNA and Cas12a protein form a ternary complex, other single-stranded DNA (collateral single-stranded DNA) in the system will be cleaved. A specific DNA detection method was designed based on this principle. Firstly, the collateral DNA was designed as a fluorescent probe consisting of a random sequence with a length of 12 nt, and labelled with the fluorescent group HEX at the 5′-terminal end and labelled with the quenching group BHQ1 (HEX-N12-BHQ1) at the 3′-terminal end. When the system contains the target DNA fragment, a ternary complex of the target DNA, crRNA and Cas12a protein will be formed. At this time, the probe is cleaved, and the fluorescence emitted from the HEX fluorescent group can be detected by the fluorescence detector (excitation at 535 nM, and emission at 556 nM). Secondly, 10 different Cas12a were tested, and the target sequence was double-stranded DNA, as shown in
FIG. 7 . It can be seen that the complex composed of the target double-stranded DNA and each Cas12a protein can achieve trans cleavage activity. - HOLMES Response Sensitivity: Next, the sensitivities of FnCas12a and LbCas12a response to target DNA were tested. That is, the lowest concentration of target DNA that can respond was examined. As shown in
FIG. 9 , when the test target was directly added, the target DNA with concentration above 0.1 nM was able to respond, and the response was significant at a concentration above 1 nM. If the PCR technique is combined (i.e. HOLMES method), as shown inFIG. 8 , i.e. the target fragment is first amplified by PCR and then subjected to Cas12a cleavage reaction, the response sensitivity can be as low as 10 aM, as shown inFIG. 9 . - SNP test: Next, whether the HOLMES method can detect the SNP genotype was tested. T1 was used as the target sequence, and mutations were introduced in the PAM or single point mutation was introduced in the target sequence at position of 1-18. And the difference between the non-mutated sequence and the mutant sequences was compared for the crRNAs of different lengths.
- As shown in
FIG. 10 , when the target complementary sequence is a 24 nt crRNA (crRNA-24 nt), the single point mutations at position of 8-18 are not significantly different from the wild type. When there is any mutation in the PAM and there is any point mutation at position of 1-7, there is a significant drop on the fluorescence value. When the crRNA was truncated and the length of the paired target sequence was 18 nt, the fluorescence value of the target sequence mutated at position 8-16 nt was significantly lower than that of the target sequence with a length of 24 nt. When the length was shortened to 16 nt or 17 nt, the decrease of fluorescence value of the target sequence after mutation was more obvious. When the length was shortened to 15 nt, the fluorescence values of the target sequence and the mutation are weak for the target sequence, but still strong for other target sequences, which can be used for detection. Taken together, 15 nt, 16 nt and 17 nt crRNAs are most suitable for detection of SNPs. - In the present invention, Cas12a cleaves single-stranded DNA. A programmed cleavage mode wherein Cas12a cleaves single-stranded DNA independent of PAM sequence is called cis cleavage; and once a ternary complex Cas12a/crRNA/target DNA is formed, it shows the activity of trans-cleavage, that is, the activity of cleavage of any non-target single-stranded DNA in the system.
- Using the characteristics of Cas12a, a method for specifically detecting nucleic acid molecules has been developed, which is called HOLMES (one Hour Low-cost Multipurpose Efficient Simple assay). As the name of the technology, it is characterized as a fast (1 hour), low cost, multi-purpose, efficient, and simple method. The method can be used in the fields of rapid pathogen detection, SNP detection and the like.
- Nucleic acid detection based on collateral cleavage activity
- The invention also provides a method of nucleic acid detection based on the collateral cleavage activity of a Cas12 enzyme, including Cas12a or Cas12b.
- Preferably, the detection of the invention can be performed on SNPs, in particular by PCR amplification followed by detection.
- Referring to
FIG. 18 , the design of the primers is given. -
Case 1. When there is a PAM site near the SNP site, the synthesized crRNA based on the guide sequence designed according to the PAM site can be used for HOLMES detection. When the HOLMES method is used for detection, the background signal is relatively low; for the same guide sequence, the signal difference between different SNP templates is relatively large. -
Case 2. When there is no PAM site near the SNP site, or there is no suitable PAM site, the introduction of the PAM site can be performed according to the above experimental protocol. - A typical procedure comprises designing a primer near the SNP site, carrying a PAM site on the primer, and the 3′ end sequence at the PAM site needs to be paired with the template DNA. There is no special requirements for the primer at the other end, and it only needs to be paired with the template DNA and can be subjected to PCR amplification. As shown in
FIG. 18 , the PAM site was successfully introduced after PCR amplification. - Referring to
FIG. 10 , in the present invention, when designing for the introduction of a PAM, usually the SNP site is located at the position of the first 16 bases of from 5′ end of the crRNA guide sequence, preferably 1-14, more preferably 1-12, more preferably 1-11 or 1-10, and most preferably 1-8 or 1-7. - The main advantages of the invention are:
- (1) Fast: When the test conditions are ready, it takes only about 1 hour from getting the sample to getting the test result.
- (2) Low cost: There are no special materials or enzymes required in the experiment, and the amount of materials and reagents involved is small. It can be used for testing and analysis of trace amounts.
- (3) Efficient: The method of the present invention has extremely high sensitivity and can detect DNA at a concentration of 10 aM.
- (4) Multi-purpose: It can detect different nucleic acid samples, including DNA samples and RNA samples.
- (5) Simple: There are no special complicated steps. If the kit is ready and the program is set, only the steps of simply adding the sample and the like are needed.
- The invention is further illustrated below in conjunction with specific Examples. It should be understood that the Examples are provided to illustrate the present invention, but are not intended to limit the scope of the invention. The experimental methods in the following Examples which do not specify the specific conditions are usually in accordance with conventional conditions, such as conditions described in Sambrook et al., Molecular Cloning: Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or in accordance with the conditions recommended by the manufacturer. Unless otherwise stated, percentages and parts are by weight.
- The experimental materials involved in the present invention can be obtained commercially unless otherwise specified.
- Materials
- 1. The RNase inhibitor was purchased from TaKaRa. The high-fidelity DNA polymerase KOD FX was purchased from ToYoBo. The primers (oligonucleotides) were synthesized by Shanghai Sangon Biotech. The T7 RNA polymerase was purchased from Thermo. The RNA purification and concentration kit (RNA Clean & ConcentratorTM-5) was purchased from Zymo Research. Wizard® SV Gel and PCR Clean-Up System was purchased from Promega. The media (e.g. Tryptone, Yeast Extract, etc.) were purchased from OXOID.
- 2. Medium formula: liquid LB (1% Tryptone, 0.5% Yeast extract, 1% NaCl). When formulating solid LB, only 2% agar should be added to the liquid LB.
- Single-stranded DNA (target-T1-R) was used as the target sequence to test the response values of different Cas proteins for detection thereof.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R, as shown in table 5, were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen. Biotech.) with a volume of 50-μL, following the annealing program: initial denaturation at 95° C. for 5 min, then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1V per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, RNA is purified using RNA purification and concentration kits, quantitated with NanoDrop 2000C (Thermo Fisher Scientific), diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM Cas12a, 0.01 μM target single-stranded DNA (target-T1-R), 0.01 μM nucleic acid probe (N25-5′ FAM), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. For blank control reaction, all other components were added except single-stranded DNA target sequence. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 3. Fluorescence detection: Electrophoresis was carried out with urea-polyacrylamide gel electrophoresis (Urea-PAGE) and then detection was carried out with the fluorescence luminescence imager. As shown in
FIG. 11 , different Cas12as showed distinct target defection effects. For example, HkCas12a and the like cleaved the probe even without target single-stranded DNA being added. However, LbCas12a and the like cleaved the probe only with target single-stranded DNA being added, and were good Cas12a protein candidates. - Single-stranded DNA (target-T1-R) was used as the target sequence to test the response values of different Cas proteins for detection thereof
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R (Table 5) were annealed and used to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM Cas12a, 0.01 μM target single-stranded DNA (target-T1-R), 0.5 μM fluorescent probe (HEX-N12-BHQ1. i.e. 12 nt single-stranded DNA labelled with HEX at the 5′ end and BHQ1 at the 3′ end), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. For control reaction, all other components were added except single-stranded DNA target sequence. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 3. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 12 , different Cas12as showed distinct target defection effects. For example, HkCas12a and the like cleaved the probe even without target single-stranded DNA being added. However, FnCas12a and the like cleaved the probe only with target single-stranded DNA being added, and were good Cas12a protein candidates. - Double-stranded DNA (target-T1) was used as the target sequence to test the response values of different Cas12a proteins for detection thereof.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM Cas12a, 0.01 μM target double-stranded DNA (target-T1, obtained from annealing of primer target-T1-F and primer target-T1-R), 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 3. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 7 , different Cas12as showed distinct target defection effects. Whereas LbCas12a and the like cleaved the probe only with target double-stranded DNA being added, and were good Cas12a protein candidates. - Target-T1 DNA was used as target DNA, then subjected to gradient dilution into different concentrations to test the sensitivity of FnCas12a or LbCas12a response to it. To enhance the sensitivity, PCR amplification step was added.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-T1-24-R (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification (optional): Plasmid (pUC18-T1) that contained the target-T1 target, as the template, was subjected to gradient dilution and PCR reaction. The total volume of each reaction system was 20 μL, 0.25 μM of primers of M13F-47 and M13R-48 ware used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, the PCR purification products were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM FnCas12a or LbCas12a, 1 μL of PCR products (or target DNA directly diluted to different concentrations), 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 9 , target DNA at or above 0.1 nM was able to response when the test targets were directly added, and response was significant when the concentration was above 1 nM. However, combined with PCR technology, i.e., first PCR amplification of fragments of interest and then Cas12a cleavage reaction, the response sensitivity could be as low as 10 aM. - Target-T1 DNA was used as the target and mutated in the PAM region and position 1-18, respectively. Several crRNAs of different lengths were tested for response values to the wild type and single-point mutated targets.
- 1. Preparation of crRNA: First, T7-crRNA-F was annealed with synthetic oligonucleotides of T7-T1-24-R, T7-T1-15-R, T7-T1-16-R, T7-T1-17-R and T7-T1-18-R (Table 5), respectively, to prepare templates for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification: Plasmid (pUC18-T1) that contained the target-T1 target was used as the template. The total volume of each reaction system was 20 μL, 0.25 μM primers of M13R-48 and each mutant primer for Target-T1-F were used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM FnCas12a or LbCas12a, 1 μL of PCR products, 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 10 , when the target complementary sequence was 24 nt crRNA (crRNA-24 nt), no significant difference was observed between single-point mutated target with mutation at position 8-18 and the wild type, and after mutation within PAM and at position 1-7, the fluorescence value was obviously decreased. When crRNAs were truncated and the paired target sequence length was 18 nt, the fluorescence value of the mutation at position 8-16 nt was remarkably lower than that at 24 nt. At 16 nt or 17 nt, the fluorescence value of the mutated target sequence was decreased more remarkably. At 15 nt, the fluorescence value of both the target sequences and the mutants was very weak. However, the strength thereof could be still high for other target sequences, which could be used for detection. To sum up, crRNAs of 15 nt, 16 nt and 17 nt were the most suitable for detection of SNP. - The E. coli gyrB gene was selected as the detection target to indirectly test the concentration of microorganisms such as E. coli in the water. E. coli MG1655 was used as the positive control to determine the content of microorganisms in the environmental water such as polluted water and running water.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification: The positive control sample was E. coil MG1655 which was cultured till the OD600 reached about 0.5, then subjected to 10 times gradient dilution and used as the template. Samples were taken from environmental water, including running water and environmental mud water. The total volume of each reaction system was 20 μL, 0.25 μM primers of gyrB-F and gyrB-R were used (Table 4), and high-fidelity enzyme KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR amplification, the PCR products were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
step 1, 0.25 μM LbCas12a, 1 μL of PCR products, 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1, and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 13 , the fluorescence response values were gradually lowered with the decrease of the concentration of E. coli MG1655. Among these, microorganisms were obviously detected in 2, 4, 5 and 6.samples - Five sites of human SNP were selected for SNP testing, including rs5082, rs1467558, rs2952768, rs4363657 and rs601338, to test the feasibility of the HOLMES method. 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1×PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with RNA Clean & Concentrator™-5 (Zymo Research), quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification: The total volume of reaction system was 20 μL, 0.25 μM primers were used (Table 4), 1 ng of human genome (HEK293T) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction (Primers, such as 1-rs5082-F-T, 2-rs1467558-F-T and 3-rs2952768-R-C were directly introduced into respective mutated products of SNP).
- 3. Cas12a reaction: In a 20-μL reaction system was added with 1 μM respective crRNA, 0.5 μM LbCas12a, 1 μL of PCR products, and 0.5 μM fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 14 , only with the crRNA corresponding to respective target sequences, higher fluorescence response values were generated, and if one-point mutation occurred, the response value thereof would be largely reduced. The corresponding SNP genotype could be determined based on the fluorescence value, and these results were confirmed by sequencing results. - TP53 gene was selected for testing gene. TP53 gene contains a nonsense mutation in human T24 cells, which results in the inactivation of this gene. Cells with gene at this site being normal (HEK293T), individual gene and mutated cell T24 were tested.
- 1. Preparation of crRNA: First, T7-crRNA-F was annealed with synthetic oligonucleotides of T7-crRNA-34-TP53-T24-C-16 nt and T7-crRNA-34-TP53-T24-G-16 nt (Table 5) to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). The crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with RNA Clean & Concentrator™-5 (Zymo Research), quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification: The total volume of reaction system was 20 μL, 0.25 μM primers of 34-TP53-T24-F and 34-TP53-T24-R were used (Table 4), 1 ng of human genome (HEK293T, T24) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 1 μM respective crRNA, 0.5 μM LbCas12a, 1 μL of PCR products, and 0.5 μM fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 15 , when value of crRNA-C detected by using TP53 gene being normal at this site as the template was obviously higher than that of crRNA-G, crRNA-G of the mutated cell T24 was obviously increased. - Five sites of human SNP were selected for SNP testing, which are related to risk of gout, including rs1014290, rs6449213, rs737267, rs1260326 and rs642803, to test the HOLMES method.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with RNA Clean & Concentrator TM-5 (Zymo Research), quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator.
- 2. PCR amplification: The total volume of reaction system was 20 μL, 0.25 μM primers were used (Table 4), 1 ng of human genome (HEK293T) or directly scraped oral mucous epithelium was used as the template, and the high-fidelity polymerase KOD FX (ToYoBo) was used for PCR reaction. The PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s. After PCR was completed, they were directly used for Cas12a reaction. (Primers, such as 1-rs5082-F-T, 2-rs1467558-F-T and 3-rs2952768-R-C were directly introduced into respective mutated products of SNP).
- 3. Cas12a reaction: In a 20-μL reaction system was added with 1 μM respective crRNA, 0.5 μM LbCas12a, 1 μL of PCR products, and 0.5 μM fluorescent probe (HEX-N12-BHQ1). The reaction was carried out at 37° C. for 15 min, and then stopped at 98° C. for 2 min.
- 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into the 96-well plate and then detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 16 , only with the crRNA corresponding to respective target sequences, higher fluorescence response values were generated, and if one-point mutation occurred, the response value would be largely reduced. The corresponding SNP genotype could be determined based on the fluorescence value, and the these results were confirmed by sequencing results. - Premix was added into the 96-well plate to make a kit, then the genomic DNA of 21 volunteers was added to test the rs1014290 site, which is related to gout risk.
- 1. Preparation of kit: First, T7-crRNA-F and synthetic oligonucleotides (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). The RNA was purified with RNA Clean & Concentrator TM-5 RNA (Zymo Research), quantitated with NanoDrop 2000C, and diluted to a concentration of 10 μM.
- 2. Premix of PCR reagents in the 96-well plate: Reagents required for PCR were added into the 19-μL system, using primers of 41-rs1014290-F and 41-rs1014290-R.
- 3. Premix in the 96-well plate for fluorescence detection: 1 μM crRNA, 0.5 μM LbCas12a was added into the 19-μL system and 0.5 μM fluorescent probe (HEX-N12-BHQ1) was added into the 96-well plate.
- 4. PCR amplification: The volunteers' genomic DNA was added into above premixed PCR 96-well plate for PCR reaction, and the PCR reaction procedure was at 95° C. for 2 min, followed by 35 cycles of 98° C. for 10 s, 60° C. for 15 s and 68° C. for 10 s.
- 5. Cas12a reaction: 1 μL of PCR reaction liquid was added into the premixed 96-well plate for fluorescence detection and reaction was performed at 37° C. for 15 min and then stopped at 98° C. for 2 min.
- 6. Fluorescence detection: Detection was performed by a microplate reader with the excitation at 535 nm and emission at 556 nm. As shown in
FIG. 17 , population with A: A genotype had higher gout risk, so, those except 5, 7 and 9 who had either A: G or G: G genotypes shall pay more attention to gout risk.volunteer - E. coli gyrB gene was chosen as the detection target to indirectly test the presence and absence of microorganisms such as E. coli in water.
- 1. Preparation of crRNA: First, T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× Taq DNA polymerase reaction buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, finally diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator for later use.
- 2. LAMP amplification: Sterilized water and liquid polluted with E. coli was taken as the negative control and sample to be detected, respectively. The total volume of each reaction system was 25 μL, 1.6 μM LAMP-FIP and LAMP-BIP primers, 0.2 μM LAMP-F3 and LAMP-B3 primers, and 0.4 μM LAMP-LoopF and LAMP-LoopB primers were used, and WarmStart® LAMP Kit (NEB) was used for LAMP reaction. LAMP reaction procedure was at 65° C. for 30 min. After LAMP was completed, reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
Step 1, 0.25 μM Cas12a, 1 μL of LAMP products, 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in
FIG. 19 . - 1. Preparation of crRNA: T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-rs5082-T/T7-crRNA-rs5082-G/T7-crRNA-rs1467558-T/T7-crRNA-rs1467558-C (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× Taq DNA polymerase reaction buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthetized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, finally diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator for later use.
- 2. LAMP amplification: Human genomic HEK293T was used as the sample. The total volume of each reaction system was 25 μL, 1.6 μM LAMP-FIP and LAMP-BIP primers, 0.2 0/1 LAMP-F3 and LAMP-B3 primers, and 0.4 μM LAMP-LoopF and LAMP-LoopB primers were used, and WarmStart® LAMP Kit (NEB) was used for LAMP reaction. LAMP reaction procedure was at 65° C. for 30 min. After LAMP was completed, the reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
Step 1, 0.25 μM Cas12a, 1 μL of LAMP products, 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in
FIG. 20 . - E. coli gyrB gene was chosen as the detection target to indirectly test the presence and absence of microorganisms such as E. coli in water.
- 1. Preparation of crRNA: T7-crRNA-F and synthetic oligonucleotides of T7-crRNA-gyrB (Table 5) were annealed to prepare the template for transcription. Specifically, 4 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 50-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min). crRNA was synthesized using T7 high-yield transcription kit, and the reaction was performed at 37° C. overnight (about 16 h). Then, the RNA was purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, finally diluted to a concentration of 10 ∞M and stored at −80° C. in a refrigerator for later use.
- 2. RPA amplification: Sterilized water and liquid polluted with E. coli was taken as the negative control and sample to be detected, respectively. The total volume of each reaction system was 25 μL, 0.5 μM RPA-gyrB-F (or RPA-gyrB-F2) and RPA-gyrB-R2 were used as primer, and TwistAmp® Basic Kit (TwistDX) was used for RPA reaction. RPA reaction procedure was at 37° C. for 30 min. After RPA was completed, the reaction was quenched at 80° C. for 10 min, which were directly used for Cas12a reaction.
- 3. Cas12a reaction: In a 20-μL reaction system was added with 0.5 μM crRNA purified from
Step 1, 0.25 μM Cas12a, 1 μL of RPA products, 0.5 μM fluorescent probe (HEX-N12-BHQ1), NEB buffer 3.1 and 0.5 μL of RNA enzyme inhibitor. The reaction was carried out at 37° C. for 15 min. - 4. Fluorescence detection: 20 μL of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is shown in
FIG. 21 . - 1. Preparation of Guide RNA (sgRNA)
- First, the plasmid pUC18-guide RNA-T1 with pUC18 as the plasmid backbone was constructed by inserting T7 promoter and the template DNA sequence for transcribing guide RNA into pUC18 (note: the guide RNA transcribed from the template was targeted to the sequence named T1 in the research). The method is as follow: PUC18 plasmid was used as the template with pUC18-1-F and pUC18-1-R as primers for the first round of PCR amplification, and the PCR products were ligated using T4 DNA ligase before being transformed into DH10b. The correct clone was obtained by sequencing, which was named as pUC18-guide RNA-T1-pre. The pUC18-guide RNA-T1-pre was then used as the template for the second round of PCR amplification with pUC18-2-F and pUC18-2-R as primers. In a similar way, the PCR products were ligated and transformed into DH10b, and finally, a correctly sequenced plasmid pUC18-guide RNA-T1 is obtained.
- Then, guide RNA was synthetized, using T7 high-yield transcription kit (Thermo), with the plasmid PUC18-guide RNA-T1 as the template. The reaction was performed overnight at 37° C. (12-16 h).
- At last, DNase I was added into the transcription system (2 μL of
DNase 1 added per 50 μL of the transcription system) and the system was put in 37° C. water bath for 30 min to remove plasmid DNA. The RNA was then purified with an RNA purification and concentration kit, quantitated with NanoDrop 2000C, diluted to a concentration of 10 μM and stored at −80° C. in a refrigerator for later use. - 2. Preparation of Target DNA:
- (1) If the target DNA is single stranded, a 66-bp oligonucleotide was directly synthesized as the target DNA (target-T1-R), in which the 20-bp target sequence (T1) recognized by guide RNA is contained.
- (2) If the target DNA is double stranded, two complementary 66-bp oligonucleotides (i.e. target-T1-F and target-T1-R) were directly synthesized, in which the 20-bp target sequence (T1) recognized by guide RNA is contained. The two oligonucleotides were annealed to obtain target DNA. Specifically, 1 μM of paired oligonucleotides were annealed in 1× PCR buffer (Transgen Biotech) with a volume of 20-μL, following the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. using thermocycler (decrease by 1° C. per min).
- 3. Cas12b Reaction:
- (1) Annealing of guide RNA: guide RNA was diluted to an appropriate concentration (10 μM) and annealed in a PCR instrument, following the annealing procedure: denaturation at 75° C. for 5 min, and then cooling down from 75° C. to 20° C. (decrease by 1° C. per min).
- (2) Incubation of guide RNA and C2c1: the annealed guide RNA and the C2c1 of equal molar concentrations were mixed and placed at 30° C. for 20 -30 min.
- (3) Cas12b reaction: In a 20-μL reaction system, a mixture of guide RNA and C2c1 (the concentration of both is 250 μM or 500 μM) incubated in Step (2), target DNA (final concentration of 50 nM), FAM-labelled oligonucleotides (target-DNMT1-3-R-FAM-5′) or fluorescence quenching probe (HEX-N12-BHQ1, final concentration of 500 nM), 2 μL of 10× NEB Buffer 3.1 and 0.5 μL of RNA enzyme inhibitor (40 U/μL) were added. After mixing well, they were allowed to react at 48° C. for 30 min. Afterwards, they were heated at 98° C. for 5 min in a PCR instrument for inactivation.
- 4. Detection of Cas12b for Trans-Cleavage Activity by the Urea Denaturing Gel Electrophoresis Method:
- 20 μL of inactivated reaction liquid was electrophoretically separated by the urea denaturing gel electrophoresis method, followed by being imaged with the fluorescence imaging system ImageQuant LAS 4000 mini (GE Healthcare). The result is shown in
FIG. 22 . - 5. Detection of Cas12b for Trans-Cleavage Activity by a Fluorescence Microplate Reader:
- 20 μL of inactivated reaction liquid was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. The result is as shown in
FIG. 23 . - Based on the detection of the fluorescence intensity excited by the fluorescence probe (HEX-N12-BHQ1), the target DNA concentration required for Cas12b to perform trans-cleavage activity could be determined, which is the sensitivity of Cas12b trans-cleavage reaction.
- 1. Preparation of Guide RNA:
- First, the 20 bases of the target DNA targeting T1 in the guide RNA were substituted with the guide RNA targeting DNMT1-3 to obtain another plasmid pUC18-guide RNA-DNMT1-3 by PCR, with pUC18-guide RNA-T1 as the template as well as with the guide RNA-DNMT1-3-F and the guide RNA-DNMT1-3-R as primers.
- Second, guide RNA was synthesized using the T7 high-yield transcription kit (Thermo), with the plasmid PUC18-guide RNA-DNMT1-3 as the template, the reaction was performed at 37° C. overnight (12-16 h).
- At last, DNase I was added into the transcription system (2 μL of DNase I per 50 μL of the transcription system), and was put in a 37° C. water bath for 30 min to remove plasmid DNA, the RNA was then purified with an RNA purification and concentration kit, and then quantitated with NanoDrop 2000C, and stored at −80° C. in a refrigerator for later use.
- 2. Preparation of Target DNA
- For the target DNA, the first method was a reaction system directly added with the Cas12b without amplification, as follows:
- (1) if the target DNA is single stranded, a 50-bp oligonucleotide was directly synthesized as the target DNA (DNMT1-3(TTC PAM)-R), in which the 20-bp target sequence (DNMT1-3) recognized by guide RNA is contained.
- (2) if the target DNA is double stranded, two complementary 50-bp oligonucleotides (i.e. DNMT1-3 (TTC PAM)-F and DNMT1-3 (TTC PAM)-R)) were directly synthesized, in which the 20-bp target sequence (DNMT1-3) recognized by guide RNA is contained. The two oligonucleotides were annealed to obtain short target DNA. Specifically, the paired oligonucleotides (2 μM) were annealed in 1× PCR buffer (Transgen Biotech) of the
total volume 20 μL, followed by performing the annealing procedure: initial denaturation at 95° C. for 5 min, and then cooling down from 95° C. to 20° C. in a thermocycler (decrease by 1° C. per min). - (3) the single stranded or double stranded target DNA was serially diluted to 2 μM, 0.2 μM, 0.02 ∞M, 0.002 μM and 0.0002 μM for later use.
- The second method is that a fragment with the target sequence (DNMT1-3) was inserted into a plasmid vector and amplified by LAMP reaction.
- (1) The fragment with the target sequence (DNMT1-3) was inserted into the pEasy-Blunt Zero Cloning Vector using the pEasy-Blunt Zero Cloning Kit of Transgen company and verified by sequencing to obtain correct cloning.
- (2) LAMP Amplification Reaction
- The above plasmids were used as the template for LAMP amplification reaction, and the templates were added with 0 nM, 1 nM, 0.1 nM (diluted to 10−11 nM at 10 fold gradient). The total volume of each reaction system was 25-μL, the primers used is 1.6 μM LAMP-DNM-FIP and LAMP-DNM-BIP primers, 0.2 μM LAMP-DNM-F3 and LAMP-DNM-B3 primers, and 0.4 μM LAMP-DNM-LoopF and LAMP-DNM-LoopB, the kit used in the LAMP reaction was WarmStart® LAMP Kit (NEB). LAMP reaction program was at 65° C. for 30 min. After LAMP was completed, quenching at 80° C. for 10 min, and then directly used for Cas12b reaction.
- 3. Cas 12b Reaction
- (1) Annealing of guide RNA: guide RNA was diluted to an appropriate concentration (5 μM), and placed in a PCR instrument for annealing. The annealing procedure: denaturation at 75° C. for 5 min, and then cooling down from 75° C. to 20° C. (decrease by 1° C. per min).
- (2) Incubation of guide RNA and Cas12b: the annealed guide RNA and the Cas of equal molar concentration were mixed and placed at 30° C. for 20-30 min.
- (3) Cas 12b reaction: in a 20-μL reaction system, a mixture of guide RNA and Cas12b (the concentration of both is 250 μM) incubated in Step (2), 1 μL of target DNA or 1 μL of LAMP products, fluorescence probe (HEX-N12-BHQ1) (
final concentration 500 nM), as well as 2 μL of 10× NEB buffer 3.1 and 0.5 μL of RNA enzyme inhibitor (40 U/μL) were added. After mixing well, they were allowed to react at 48° C. for 30 min. Afterwards, they were heated at 98° C. for 5 min in a PCR instrument to quench. - 4. Detection of Cas 12b Trans-Cleavage Activity by a Fluorescence Microplate Reader:
- 20 μL of reaction liquid inactivated was added into a 96-well plate and detected with a microplate reader with the excitation at 535 nm and emission at 556 nm. Upon combining with LAMP amplication, the Cas12b could produce significant collateral ssDNA trans-cleavage activity for as low as 10 aM target DNA. As is shown in
FIG. 24 . - The cis cleavage property of Cas12a to cleave target ssDNA:
- First, in order to test the ssDNA cleavage property of Cas12a, several crRNAs (Table 1) targeting the short ssDNA (Dfei-3) were designed with 5(6)-carboxyfluorescein (FAM) labelled at the 3′ end. After cleavage of
FnCas 12a, the reaction product was analyzed by denatured urea polyacrylamide gel electrophoresis (urea PAGE). Single-stranded DNA cleavage by Cas12a was found to be programmable, i.e., the cleavage site is from the first base in the 3′ end of the target sequence paired with the crRNA guide sequence to near the 22nd base (from 21st to 23rd bases) of the target sequence counted in the 5′ end, as shown inFIGS. 1A and 1C . The dsDNA cleavage of Cas12a requires a PAM sequence, whereas ssDNA cleavage does not require a PAM sequence (FIG. 1A, 1B andFIG. 2 ), which is similar to Cas9-mediated ssDNA cleavage. However, the Cas12a-mediated ssDNA cleavage activity is dependent on the stem-loop structure in crRNA, as shown inFIG. 1A , while Cas9 still exhibits weak cleavage activity against ssDNA with only 20-nt complementary RNA sequences. The stem-loop structure of crRNA is important for stabilizing the structure of Cas12a, which is responsible for the necessity of stem-loop structure of crRNA for ssDNA cleavage of Cas12a. It is further tested whether the ssDNA cleavage site by Cas12a can passed through a shorter guide sequence crRNA, such that the cleavage is outside the recognition site. When the length of the guide sequence is 16 nt, 18 nt or 20 nt, all of these crRNAs resulted in cleavage by Cpf1 near the 22nd base, as shown inFIGS. 1B and 1D , meaning that the cleavage site is 4 nt, 2 nt or 0 nt outside the recognition site. Next, the cleavage efficiency of Cas12a for different substrates was tested using dsDNA and ssDNA substrates, respectively, as shown inFIG. 1F . Similar to the case of Cas9 cleavage, ssDNA cleavage is slower than dsDNA cleavage, as shown inFIG. 1E to 1G . These results indicate that the mechanism of Cas12a's ssDNA recognition and cleavage may be different from dsDNA, which is a less efficient PAM-independent recognition cleavage mode; the PAM sequence accelerates target dsDNA recognition and/or cleavage by Cas12a. - The trans cleavage property of Cas12a to cleave ssDNA:
- When the target ssDNA is labelled at the 3′ end, Cas12a cleaves around the 22nd base, as shown in
FIG. 1 . However, when the labelling was at the 5′ end, no cleavage product band of the predicted size was observed, but a short (<6 nt) FAM-labelled product was produced, as shown inFIG. 3B . Through detailed experiments, once the ternary complex Cas12a/crRNA/target ssDNA is formed, the 5′-end labelled target ssDNA (DNMT1-3) (Table 1) is cleaved and a short FAM-labelled product is produced, as shown inFIG. 3C . In addition, the ternary complex also cleaves ssDNA that does not have any complementary sequence to the crRNA in any other reaction system (i.e., collateral ssDNA), as shown inFIGS. 3C and 3D . This cleavage phenomenon is a trans cleavage, which is distinguished from a programmable cis cleavage. Trans cleavage was also observed when the target ssDNA was labelled at the 3′-end, but many cis-cleaved products were left, as shown inFIG. 3B , which may be due to the formation of complex Cas12a/crRNA/target ssDNA, which protected the labelled 3′-end of the target ssDNA from being exposed in the active nuclease site of the ternary complex, and these cleavage processes can be shown inFIG. 3A . - In addition to FnCas12a tested above, nine Cas12as from other species source were also tested (Table 2 and
FIG. 4A ). Except for Lb4Cas12a, all Cas12a have high endonuclease activity on plasmid DNA (as shown inFIG. 4B ), and all Cas12a ternary complexes show both cis and trans cleavage activity on ssDNA (as shown inFIGS. 4C and 4D ). This suggests that cis and trans activity of Cas12a against ssDNA is a common phenomenon. - Key sites and mechanisms of the cis and trans cleavage of ssDNA by Cas12a
- To determine key amino acid residues in Cas12a for cis and trans activity on ssDNA, several candidate residues of Cas12a were mutated for the activity testing. First, three single amino acid mutants of FnCas12a (H843A, K852A and K869A) were purified and tested, the residues of which are related to the RNase activity. The results of the ssDNA trans-activity studies showed that wild-type FnCas12a and three mutants showed no significant difference in cis and trans cleavage activity against ssDNA, as shown in
FIGS. 5A and 5C . - Next, when the endonuclease activity site in FnCas12a is mutated, i.e., the RuvC domain (D917A, E1006A or D1255A) and the Nuc domain (R1218A) site, the ssDNA cis and trans-cleavage activity of these mutant Cas12a were affected as shown in
FIGS. 5B and 5D . These results indicate that the key sites of Cas12a responsible for target dsDNA cleavage are closely related to the cis and trans cleavage activities of ssDNA. - A recent structural study of Cas12b (i.e. C2c1), including with extended target DNA or extended non-target DNA complexes, revealed that both strands were located within the RuvC pocket, as shown in
FIGS. 6A and 6B . By comparing the endonuclease catalyzed residues of Cas (i.e. C2c1) and Cas12a, it is found that these sites most likely to play a similar role in the cleavage and function of Cas12b (i.e. C2c1)and Cas12a. The results of the in vitro single amino acid mutation experiment show that it is consistent with the above hypothesis, that is, Cas12a is likely to cleave both strands by only one RuvC catalytic pocket. - Trans cleavage activity of the Cas12a complex: In the structure of the Cas12b (i.e. C2c1) complex with additional ssDNA, sequence-independent ssDNA is also located on the surface of the catalytic pocket, as shown in
FIG. 6C , which is similar to the collateral ssDNA substrate for Cas12a. Combining single amino acid mutation experiments, it is proposed that target DNA, non-target DNA and collateral ssDNA were all cleaved in a single RuvC pocket in Cas12a, as shown inFIGS. 6D, 6E and 6F . The reason why the ternary Cas12a complex has collateral ssDNA trans cleavage activity but the monomeric or binary complex does not have collateral ssDNA trans cleavage activity can be explained by comparing monomeric, binary, and ternary complex structures. The monomeric Cas12a structure is disordered. The binary complex Cas12a/crRNA is a triangular structure, as shown inFIG. 6G , while the ternary complex Cas12a/crRNA/target DNA is converted into a bilobal structure, thereby exposing the catalytic pocket to achieve trans cleavage of the collateral ssDNA (as shown inFIG. 6H ). - Establishment of Nucleic Acid Probing Methods
- Using the characteristics of Cas12a, a method for specifically detecting nucleic acid molecules has been developed, which is called HOLMES (one Hour Low-cost Multipurpose Efficient Simple assay). As the name of the technology, it is characterized as a one hour, low cost, multi-purpose, efficient, and simple test method.
- In the whole reaction system, it can be divided into two large steps. One is the amplification of the template nucleic acid, and the other is the specific nucleic acid detection of the Cas12a protein. Here, PCR is used for amplification of nucleic acids, but in practice, any amplification method can be combined with nucleic acid detection of the second step, such as isothermal amplification method RPA or the like. The initial nucleic acid is not limited to double-stranded DNA, and may be single-stranded DNA; even RNA can be detected by reverse transcription, and thus the method is applicable to various types of nucleic acid molecules. For the nucleic acid detection stage, three components are the key to the experiment, namely Cas12a, crRNA and the nucleic acid probe. In addition to the 10 Cas12a mentioned in the examples (these 10 proteins are randomly selected), other Cas12a proteins are equally suitable for this method. In addition, other types of Cas proteins (such as C2c1 protein) are also suitable for the scope of the present invention. According to experimental results, Alicyclobacillus acidoterrestris Cas12b (i.e. C2c1) also has a collateral single-stranded DNA trans cleavage activity similar to Cas12a, its complex with crRNA/target DNA can also cleave collateral single-stranded DNA.
- The crRNA as a guiding role is more stable in the system after being engineered by artificial modification or the like. In the selection of nucleic acid probes, HEX and BHQ1 labelled short single stranded DNA is selected in the present invention, and any other detectable labeling method is theoretically applicable as long as producing a detectable difference after the nucleic acid probe is cleaved. Alternatively, the nucleic acid probe can also be designed to be fluorescent after binding to the compound to probe whether the probe is cut off.
- In addition, it should be understood that, after reading the above teachings of the present invention, those skilled in the art may make various modifications and changes to the present invention, these equivalent forms also fall within the scope defined by the claims appended hereto.
-
TABLE 1 Cas12a property experiment related cleavage substrate sequence Oligo name Sequence (5′-3′) SEQ ID No.: target-DNMT1-3-F aatgtttcctgatggtccatgtctgttactcgcctgtcaagtggcgt 1 gac target-DNMT1-3-R gtcacgccacttgacaggcgagtaacagacatggaccatcagg 2 aaacatt target-DNMT1-3-R- gtcacgccacttgacaggcgagtaacagacatggaccatcagg 3 FAM-3′ aaacatt-FAM target-DNMT1-3-R- FAM- 4 FAM-5′ gtcacgccacttgacaggcgagtaacagacatggaccatcagg aaacatt target-T1-F tttctgtttgttatcgcaactttctactgaattcaagctttactctagaa 5 agaggagaaaggatcc target-T1-R ggatcctttctcctctttctagagtaaagcttgaattcagtagaaagt 6 tgcgataacaaacagaaa target-T1-F-FAM FAM- 7 tttctgtttgttatcgcaactttctactgaattcaagctttactctagaa agaggagaaaggatcc target-T1-R-FAM ggatcctttctcctctttctagagtaaagcttgaattcagtagaaagt 8 tgcgataacaaacagaaa-FAM target-T1-FAM-3′-F tttctgtttgttatcgcaactttctactgaattcaagctttactctagaa 9 agaggagaaaggatcc-FAM target-T1-FAM-5′-R FAM- 10 ggatcctttctcctctttctagagtaaagcttgaattcagtagaaagt tgcgataacaaacagaaa target-DNMT1-3-R- gtcacgccacttgacaggcgagtaacagacatggaccatcagg 11 TTT-FAM-3′ TTTcatt-FAM target-DNMT1-3-R- gtcacgccacttgacaggcgagtaacagacatggaccatcagg 12 CCC-FAM-3′ CCCcatt-FAM target-DNMT1-3-R- gtcacgccacttgacaggcgagtaacagacatggaccatcagg 13 GGG-FAM-3′ GGGcatt-FAM target-DNMT1-3-F- aatgAAAcctgatggtccatgtctgttactcgcctgtcaagtgg 14 AAA cgtgac target-DNMT1-3-F- aatgGGGcctgatggtccatgtctgttactcgcctgtcaagtgg 15 GGG cgtgac target-DNMT1-3-F- aatgCCCcctgatggtccatgtctgttactcgcctgtcaagtgg 16 CCC cgtgac target-T1-1-R acaaacagaaa 17 target-T1-6-R cgataacaaacagaaa 18 target-T1-12-R aagttgcgataacaaacagaaa 19 target-T1-18-R agtagaaagttgcgataacaaacagaaa 20 target-T1-24-R gaattcagtagaaagttgcgataacaaacagaaa 21 target-T1-24-only-R gaattcagtagaaagttgcgataa 22 target-T1-18-only-R agtagaaagttgcgataa 23 target-T1-12-only-R aagttgcgataa 24 target-T1-6-only-R cgataa 25 N25-5′FAM FAM- 26 NNNNNNNNNNNNNNNNNNNNNNNNN N25-3′FAM NNNNNNNNNNNNNNNNNNNNNNNNN- 27 FAM -
TABLE 2 Names and GI numbers of Cas12a protein and Cas12b (i.e. C2c1) protein Name GI number Species FnCas12a 489130501 Francisella tularensis AsCas12a 545612232 Acidaminococcus sp. BV3L6 LbCas12a 917059416 Lachnospiraceae bacterium ND2006 Lb5Cas12a 652820612 Lachnospiraceae bacterium NC2008 HkCas12a 491540987 Helcococcus kunzii ATCC 51366 OsCas12a 909652572 Oribacterium sp. NK2B42 TsCas12a 972924080 Thiomicrospira sp. XS5 BbCas12a 987324269 Bacteroidales bacterium KA00251 BoCas12a 496509559 Bacteroidetes oral taxon 274 str. F0058 Lb4Cas12a 769130406 Lachnospiraceae bacterium MC2017 C2c1 1076761101 Alicyclobacillus acidoterrestris -
TABLE 3 Plasmid information Plasmids or Strains Relevant properties or genotypes Sources Plasmids pET28a-TEV pET28a with the thrombin (Carneiro, cleavage site changed to the Silva TEV protease cleavage et al. 2006) site pET28a-TEV-FnCas12a pET28a-TEV carrying (Li, Zhao FnCas12a et al. 2016) pET28a-TEV-AsCas12a pET28a-TEV carrying (Li, Zhao AsCas 12a et al. 2016) pET28a-TEV-LbCas12a pET28a-TEV carrying (Lei, Li LbCas12a et al. 2017) pET28a-TEV-Lb5Cas12a pET28a-TEV carrying the present Lb5Cas12a invention pET28a-TEV-HkCas12a pET28a-TEV carrying the present HkCas12a invention pET28a-TEV-OsCas12a pET28a-TEV carrying the present OsCas12a invention pET28a-TEV-TsCas12a pET28a-TEV carrying the present TsCas12a invention pET28a-TEV-BbCas12a pET28a-TEV carrying the present BbCas12a invention pET28a-TEV-BoCas12a pET28a-TEV carrying the present BoCas12a invention pET28a-TEV-Lb4Cas12a pET28a-TEV carrying the present Lb4Cas12a invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present K869A FnCas12a-K869A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present K852A FnCas12a-K852A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present H843A FnCas12a-H843A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present R1218A FnCas12a-R1218A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present E1006A FnCas12a-E1006A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present D917A FnCas12a-D917A invention pET28a-TEV-FnCas12a- pET28a-TEV carrying the present D1255A FnCas12a-D1255A invention pET28a-TEV-C2c1 pET28a-TEV carrying C2c1 the present invention -
TABLE 4 Primers used in the HOLMES method test Oligo name Sequence (5′-3′) SEQ ID No.: target-T1-R ggatcctttctcctctttctagagtaaagcttgaattcagtagaaagttg 28 cgataacaaacagaaa M13F-47 cacaattccacacaacatacgagccgga 29 M13R-48 tgtagccgtagttaggccaccacttca 30 Target-T1-F agttttgttatcgcaactttctactgaattc 31 Target-T1-F-1A agttttgAtatcgcaactttctactgaattc 32 Target-T1-F-2A agttttgtAatcgcaactttctactgaattc 33 Target-T1-F-3T agttttgttTtcgcaactttctactgaattc 34 Target-T1-F-4A agttttgttaAcgcaactttctactgaattc 35 Target-T1-F-5G agttttgttatGgcaactttctactgaattc 36 Target-T1-F-6C agttttgttatcCcaactttctactgaattc 37 Target-T1-F-7G agttttgttatcgGaactttctactgaattc 38 Target-T1-F-8T agttttgttatcgcTactttctactgaattc 39 Target-T1-F-9T agttttgttatcgcaTctttctactgaattc 40 Target-T1-F-10G agttttgttatcgcaaGtttctactgaattc 41 Target-T1-AAAN-F aaaagttatcgcaactttctactgaattc 42 Target-T1-F-11A agttttgttatcgcaacAttctactgaattcggtcatag 43 Target-T1-F-12A agttttgttatcgcaactAtctactgaattcggtcatag 44 Target-T1-F-13A agttttgttatcgcaacttActactgaattcggtcatag 45 Target-T1-F-14G agttttgttatcgcaactttGtactgaattcggtcatag 46 Target-T1-F-15A agttttgttatcgcaactttcAactgaattcggtcatag 47 Target-T1-F-16T agttttgttatcgcaactttctTctgaattcggtcatag 48 Target-T1-F-17G agttttgttatcgcaactttctaGtgaattcggtcatag 49 Target-T1-F-18A agttttgttatcgcaactttctacAgaattcggtcatag 50 Target-T1-PAM1A-F agtttAgttatcgcaactttctactgaattc 51 Target-T1-PAM2A-F agttAtgttatcgcaactttctactgaattc 52 Target-T1-PAM3A-F agtAttgttatcgcaactttctactgaattc 53 gyrB-F AGTTGTCGTTCCTCAACTCCGGCGTTTC 54 gyrB-R TCGACGCCAATACCGTCTTTTTCAGTGG 55 1-5082-F CTGCCTTTGCTTCTACCTTTGCCTGT 56 1-5082-F-T TTGCTTCTACCTTTGCCTGTTCTGG 57 1-5082-R TTTTCTGGCTGGGGATGGCCGATGG 58 2-rs1467558-F AGCAATAACACTAATATTGATTCCTTCAG 59 ATATGGACTCCTTTCATAGTA 2-rs1467558-F-T TTGATTCCTTCAGATATGGACTCCTTTCAT 60 AGTATAACG 2-rs1467558-R TGAGCATCGTTATTCTTACGCGTTGTCATT 61 GAAAGAG 3-rs2952768-F AGCCTGGGCAACGAGTGAAACTCTG 62 3-rs2952768-R ACAGGAGGGACAAAGGCCTAAGTGTCC 63 3-rs2952768-R-C CATCATAGGATTGGGAAAAGGACATTTCA 64 GTCATTCAG 4-rs4363657-F AGAGTCCTTCTTTCTCAATTTTTCAGAATA 65 ATTTAGTACTTTGGGTAC 4-rs4363657-R CAGTACTGAAAAAACCTGCCTATCAATAA 66 AAGCCCTAGAC 5-rs601338-F GCTTCACCGGCTACCTTTGCTCCT 67 5-rs601338-R TTCACCTGCAGGCCCCGCAGG 68 34-TP53-T24-F CCTGACTTTCAACTCTGTCTCCTTCCTCTT 69 TTTACAGTA 34-TP53-T24-R TGCTGTGACTGCTTGTAGATGGCCATGG 70 41-rs1014290-F AGTTTCCAGACCTCAGTGCACAAGATACT 71 TTTCTAC 41-rs1014290-F-G ACCTCAGTGCACAAGATACTTTTCTACGT 72 CATCCAC 41-rs101420-R AGCTCCAGTGGATGGAAGATCTTTGAGAT 73 CCAG 42-rs6449213-F AGTCAAAGAGATTCATGCCTGGGACTTTA 74 ATCACATTTAT 42-rs6449213-F-C ATGCCTGGGACTTTAATCACATTTATCGG 75 AAGG 42-rs6449213-R CAAATCTGTCTCCACCTCTCAGCTCACCTT 76 G 43-rs737267-F TTCTTGAACCCAAACTCACCTGGCATTTA 77 AACTG 43-rs737267-F-A AAACTCACCTGGCATTTAAACTGACTCTG 78 TAAG 43-rs737267-F-T AAACTCACCTGGCATTTAAACTGTCTCTG 79 TAAG 43-rs737267-R TGCCGAGGCTGAGTTCAGCTACTCTCC 80 44-rs1260326-F ACACAGCACCGTGGGTCAGACCTTGC 81 44-rs1260326-F-C TGGGTCAGACTTTGCCGGTGAGAGTC 82 44-rs1260326-F-T TGGGTCAGACTTTGCTGGTGAGAGTC 83 44-rs1260326-R AGCAGTGGCCATGTGATGCTGATGATG 84 45-rs642803-F CCCCGGCTCTGTTGGCTTTGAGAATTG 85 45-rs642803-F-C CTCTGTTGGCTTTGAGAATTGCCTGTCTGT 86 GTC 45-rs642803-F-T CTCTGTTGGCTTTGAGAATTGTCTGTCTGT 87 GTC 45-rs642803-R ACCGATACCTGGCAGCCCTTGGATG 88 HEX-N12-BHQ1 HEX-NNNNNNNNNNNN-BHQ1 89 -
TABLE 5 Template sequences for transcription of crRNA Oligo name Sequence (5′-3′) SEQ ID No.: T7-crRNA-F GAAATTAATACGACTCACTATAGGG 90 T7-T1-24-R gaattcagtagaaagttgcgataaATCTACAACAGTAGAAA 91 TTCCCTATAGTGAGTCGTATTAATTTC T7-T1-15-R agaaagttgcgataaATCTACAACAGTAGAAATTCCCT 92 ATAGTGAGTCGTATTAATTTC T7-T1-16-R tagaaagttgcgataaATCTACAACAGTAGAAATTCCCT 93 ATAGTGAGTCGTATTAATTTC T7-T1-17-R gtagaaagttgcgataaATCTACAACAGTAGAAATTCCC 94 TATAGTGAGTCGTATTAATTTC T7-T1-18-R agtagaaagttgcgataaATCTACAACAGTAGAAATTCC 95 CTATAGTGAGTCGTATTAATTTC T7-crRNA- GAGTAACAGACATGGACCATCAGATCTACAAC 96 DNMT-23 nt-R AGTAGAAATTCCCTATAGTGAGTCGTATTAATT TC T7-crRNA- gacatggaccatcaggaaacattATCTACAACAGTAGAAAT 97 DNMT-(-8)-R TCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- aggcgagtaacagacatggaccaATCTACAACAGTAGAAA 98 DNMT-(+4)-R TTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- tgacaggcgagtaacagacatggATCTACAACAGTAGAAA 99 DNMT-(+8)-R TTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- agacatggaccatcagATCTACAACAGTAGAAATTCCC 100 DNMT-16 nt-R TATAGTGAGTCGTATTAATTTC T7-crRNA- acagacatggaccatcagATCTACAACAGTAGAAATTCC 101 DNMT-18 nt-R CTATAGTGAGTCGTATTAATTTC T7-crRNA- taacagacatggaccatcagATCTACAACAGTAGAAATTC 102 DNMT-20 nt-R CCTATAGTGAGTCGTATTAATTTC T7-DNMT-(-8)- gacatggaccatcaggaaacattCCCTATAGTGAGTCGTAT 103 no loop-R TAATTTC T7-DNMT- aggcgagtaacagacatggaccaCCCTATAGTGAGTCGTA 104 (+4)-no loop-R TTAATTTC T7-DNMT- tgacaggcgagtaacagacatggCCCTATAGTGAGTCGTAT 105 (+8)-no loop-R TAATTTC T7-crRNA- CCTCTTCCCAGAACAGGATCTACAACAGTAGAA 106 rs5082-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- CCTCTTCCCAGCACAGGATCTACAACAGTAGAA 107 rs5082-G ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- CTGAAGCGTTATACTATATCTACAACAGTAGAA 108 rs1467558-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- CTGAAGCGTTGTACTATATCTACAACAGTAGAA 109 rs1467558-C ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- TTTTATCTGAATGATTATCTACAACAGTAGAAAT 110 rs2952768-T- TCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA- TTTTATCTGAATGACTATCTACAACAGTAGAAAT 111 rs2952768-C- TCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA- AAAAAAGAGTGAGTACCATCTACAACAGTAGAA 112 rs4363657-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- AAAAAAGAGTGGGTACCATCTACAACAGTAGAA 113 rs4363657-C ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- GGTAGAAGGTCCAGGAGATCTACAACAGTAGAA 114 rs601338-G ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA- GGTAGAAGGTCTAGGAGATCTACAACAGTAGAA 115 rs601338-A ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-34- GGGCAGGGGAGTACTGATCTACAACAGTAGAAA 116 TP53-T24-C- TTCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA-34- GGGCAGGGGACTACTGATCTACAACAGTAGAAA 117 TP53-T24-G- TTCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA-41- TCAGTGGATGATGTAATCTACAACAGTAGAAAT 118 rs1014290-A- TCCCTATAGTGAGTCGTATTAATTTC 15 nt T7-crRNA-41- TCAGTGGATGACGTAATCTACAACAGTAGAAAT 119 rs1014290-G- TCCCTATAGTGAGTCGTATTAATTTC 15 nt T7-crRNA-42- GGAAATTCTCCTTCCGAATCTACAACAGTAGAA 120 rs6449213-C ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-42- GGAAATTCTCCTTCCAAATCTACAACAGTAGAA 121 rs6449213-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-43- TCTTACAGAGTCAGTTATCTACAACAGTAGAAAT 122 rs737267-A- TCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA-43- TCTTACAGAGCCAGTTATCTACAACAGTAGAAA 123 rs737267-G- TTCCCTATAGTGAGTCGTATTAATTTC 16 nt T7-crRNA-43- GTCTTACAGAGACAGTTATCTACAACAGTAGAA 124 rs737267-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-44- CTGGACTCTCACCGGATCTACAACAGTAGAAAT 125 rs1260326-C- TCCCTATAGTGAGTCGTATTAATTTC 15 nt T7-crRNA-44- CTGGACTCTCACCAGATCTACAACAGTAGAAAT 126 rs1260326-T- TCCCTATAGTGAGTCGTATTAATTTC 15 nt T7-crRNA-45- CACAGACAGGCAATTCTATCTACAACAGTAGAA 127 rs642803-C ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-45- CACAGACAGACAATTCTATCTACAACAGTAGAA 128 rs642803-T ATTCCCTATAGTGAGTCGTATTAATTTC T7-crRNA-gyrB TCGCGCTTGTCGCGCAGACGAATGATCTACAAC 129 AGTAGAAATTCCCTATAGTGAGTCGTATTAATTT C - Primers used in the detection of DNA LAMP amplification in combination with Cas12a:
-
TABLE 6 Primers for amplifying gyrB-1 name sequence SEQ ID No.: LAMP-gyrB-1-F3 CATGGTGCGTTTCTGGCC 130 LAMP-gyrB-1-B3 CGGCGTTTTGTTCTTGTTCA 131 LAMP-gyrB-1-FIP ACAACTCACGCAGACGTTTCGCAAC 132 CTTCACCAATGTGACCG LAMP-gyrB-1-BIP GTTCCTCAACTCCGGCGTTTCCGAT 133 GCCGCCTTCATAGTGG LAMP-gyrB-1-LoopF CAGAATTTCATATTCGAACT 134 LAMP-gyrB-1-LoopB GACGGCAAAGAAGACCACTT 135 -
TABLE 7 Primers for amplifying gyrB-2 name sequence SEQ ID No.: LAMP-gyrB-2-F3 CGACGGCAAAGAAGACCA 136 LAMP-gyrB-2-B3 AGCCTGCCAGGTGAGTAC 137 LAMP-gyrB-2-FIP CGGGTGGATCGGCGTTTTGTTCACT 138 ATGAAGGCGGCATCA LAMP-gyrB-2-BIP GTATTGGCGTCGAAGTGGCGTTCGC 139 TGCGGAATGTTGTTG LAMP-gyrB-2-LoopF TTGTTCAGATATTCAACGAACG 140 LAMP-gyrB-2-LoopB GTGGAACGATGGCTTCCAGG 141 -
TABLE 8 Primers for amplifying the rs 1467558 site name sequence SEQ ID No.: LAMP-rs1467558-F3 CAGCTGTAGACCATAAGCC 142 LAMP-rs1467558-B3 GTGGCTGAGCATCGTTAT 143 LAMP-rs1467558-FIP ACTATGAAAGGAGTCCATATCTGAA 144 GGAATTCAGGTAGTGGTTTGGGA LAMP-rs1467558-BIP GCTTCAGCCTACTGCAAATCCTACG 145 CGTTGTCATTGAAAG LAMP-rs1467558- TCAATATTAGTGTTATTGCTTG 146 LoopF LAMP-rs1467558- TGGTGGAAGATTTGGACAGGAC 147 LoopB -
TABLE 9 Primers for amplifying the rs5082 site name sequence SEQ ID No.: LAMP-rs5082-F3 GCTGGAAAGGTCAAGGGAC 148 LAMP-rs5082-B3 GGGGTTTGTTGCACAGTCC 149 LAMP-rs5082- FIP CAAAGGTAGAAGCAAAGGCAGGAG 150 GTTTGCCCAAGGTCACACAG LAMP-rs5082-BIP CTGGGAAGAGGGAGGGCTCAGTGT 151 TGCCACACTTTCACTGG LAMP-rs5082-LoopF GTGAGCGGGTGGGGTGCT 152 LAMP-rs5082-LoopB TCTAAGTCTTCCAGCACGGGATC 153 -
TABLE 10 Primers used in the detection of RPA amplification in combination with Cas12 SEQ name sequence ID No.: RPA-gyrB- ATATGAAATTCTGGCGAAACGTCTGCG 154 1-F TGAGTTG RPA-gyrB- AAACGTCTGCGTGAGTTGTCGTTCCTC 155 2-F AACTCC RPA-gyrB- ACTTCGACGCCAATACCGTCTTTTTCA 156 R GTGGAG -
TABLE 11 Primers used in determination Cas12b for trans cleavage activity: Oligo name Sequence (5′-3′) SEQ ID No.: pUC18-1-F ATCTGAGAAGTGGCACTTATCGCAACTTTCTA 157 CTGAGGTCATAGCTGTTTCCTGTGTGA pUC18-1-R GTCCTCTAGACCCCTATAGTGAGTCGTATTAA 158 TTTCATGATTACGAATTCGAGCTCGGT pUC18-2-F CCACTTTCCAGGTGGCAAAGCCCGTTGAGCTT 159 CTCAAATCTGAGAAGTGGCACTTATC pUC18-2-R TGGAAAGTGGCCATTGGCACACCCGTTGAAA 160 AATTCTGTCCTCTAGACCCCTATAGTGA T7-crRNA-F GAAATTAATACGACTCACTATAGGG 161 ZL-sgRNA-T1-R TCAGTAGAAAGTTGCGATAAGTGC 162 ZLsgRNA- AACAGACATGGACCATCAGGGTG 163 DNMT1-3-R target-T1-F TTTCTGTTTGTTATCGCAACTTTCTACTGAATT 164 CAAGCTTTACTCTAGAAAGAGGAGAAAGGAT CC target-T1-R GGATCCTTTCTCCTCTTTCTAGAGTAAAGCTT 165 GAATTCAGTAGAAAGTTGCGATAACAAACAG AAA target-DNMT1-3- GTCACGCCACTTGACAGGCGAGTAACAGACA 166 R-FAM-5′ TGGACCATCAGGAAACATT target-T1-R GGATCCTTTCTCCTCTTTCTAGAGTAAAGCTT 167 GAATTCAGTAGAAAGTTGCGATAACAAACAG AAA target-T1-F TTTCTGTTTGTTATCGCAACTTTCTACTGAATT 168 CAAGCTTTACTCTAGAAAGAGGAGAAAGGAT CC -
TABLE 12 Primers used in the sensitivity test of the trans reaction of Cas12b: Oligo name Sequence (5′-3′) SEQ ID No.: sgRNA-DNMT1-3-F CCTGATGGTCCATGTCTGTTGGTCATAG 169 CTGTTTCCTGTGTG sgRNA-DNMT1-3-R TGGACCATCAGGGTGCCACTTCTCAGAT 170 TTGAGAAG T7-crRNA-F GAAATTAATACGACTCACTATAGGG 171 ZLsgRNA-DNMT1-3-R AACAGACATGGACCATCAGGGTG 172 DNMT1-3(TTC PAM)-F AATGTTCCCTGATGGTCCATGTCTGTTA 173 CTCGCCTGTCAAGTGGCGTGAC DNMT1-3(TTC PAM)-R GTCACGCCACTTGACAGGCGAGTAACA 174 GACATGGACCATCAGGGAACATT LAMP-DNM-F3 gtgaacgttcccttagcact 175 LAMP-DNM-B3 gggagggcagaactagtcc 176 LAMP-DNM-FIP cgccacttgacaggcgagtaactgccacttattgggtcagc 177 LAMP-DNM-BIP gcgtgttccccagagtgacttagcagcttcctcctcctt 178 LAMP-DNM-LoopF aggaaacattaacgtactgatg 179 LAMP-DNM-LoopB ttecttttatttcccttcagc 180 DNMT1-3(TTC PAM)-R GTCACGCCACTTGACAGGCGAGTAACA 181 GACATGGACCATCAGGGAACATT DNMT1-3(TTC PAM)-F AATGTTCCCTGATGGTCCATGTCTGTTA 182 CTCGCCTGTCAAGTGGCGTGAC -
TABLE 13 Other sequences involved in the present invention Name Sequence SEQ ID No.: AacCas12b sgRNA GTCTAGAGGACAGAATTTTTCAACGGGTGTG 183 sequence CCAATGGCCACTTTCCAGGTGGCAAAGCCCG TTGAGCTTCTCAAATCTGAGAAGTGGCACcctg atggtccatgtctgtt Guide sequence cctgatggtccatgtctgtt 184 targeting target DNMT-1-3 Single-stranded gtcacgccacttgacaggcgagtaacagacatggaccatcagggaacatt 185 target sequence Double-stranded gtcacgccacttgacaggcgagtaacagacatggaccatcagggaacatt 186 target sequence: amino acid MAVKSIKVKLRLDDMPEIRAGLWKLHKEVNA 187 sequence of GVRYYTEWLSLLRQENLYRRSPNGDGEQECDK AacCas12b protein TAEECKAELLERLRARQVENGHRGPAGSDDEL LQLARQLYELLVPQAIGAKGDAQQIARKFLSPL ADKDAVGGLGIAKAGNKPRWVRMREAGEPG WEEEKEKAETRKSADRTADVLRALADFGLKPL MRVYTDSEMSSVEWKPLRKGQAVRTWDRDMF QQAIERMMSWESWNQRVGQEYAKLVEQKNRF EQKNFVGQEHLVHLVNQLQQDMKEASPGLESK EQTAHYVTGRALRGSDKVFEKWGKLAPDAPFD LYDAEIKNVQRRNTRRFGSHDLFAKLAEPEYQ ALWREDASFLTRYAVYNSILRKLNHAKMFATF TLPDATAHPIWTRFDKLGGNLHQYTFLFNEFGE RRHAIRFHKLLKVENGVAREVDDVTVPISMSEQ LDNLLPRDPNEPIALYFRDYGAEQHFTGEFGGA KIQCRRDQLAHMHRRRGARDVYLNVSVRVQS QSEARGERRPPYAAVFRLVGDNHRAFVHFDKL SDYLAEHPDDGKLGSEGLLSGLRVMSVDLGLR TSASISVFRVARKDELKPNSKGRVPFFFPIKGND NLVAVHERSQLLKLPGETESKDLRAIREERQRT LRQLRTQLAYLRLLVRCGSEDVGRRERSWAKL IEQPVDAANHMTPDWREAFENELQKLKSLHGI CSDKEWMDAVYESVRRVWRHMGKQVRDWR KDVRSGERPKIRGYAKDVVGGNSIEQIEYLERQ YKFLKSWSFFGKVSGQVIRAEKGSRFAITLREHI DHAKEDRLKKLADRIIMEALGYVYALDERGKG KWVAKYPPCQLILLEELSEYQFNNDRPPSENNQ LMQWSHRGVFQELINQAQVHDLLVGTMYAAF SSRFDARTGAPGIRCRRVPARCTQEHNPEPFPW WLNKFVVEHTLDACPLRADDLIPTGEGEIFVSPF SAEEGDFHQIHADLNAAQNLQQRLWSDFDISQI RLRCDWGEVDGELVLIPRLTGKRTADSYSNKV FYTNTGVTYYERERGKKRRKVFAQEKLSEEEA ELLVEADEAREKSVVLMRDPSGIINRGNWTRQ KEFWSMVNQRIEGYLVKQIRSRVPLQDSACENT GDI* - All publications mentioned in the present invention are incorporated by reference as if each individual publication was cited as a reference in the present application. It should be understood that, after reading the above teachings of the present invention, those skilled in the art can make various modifications and changes to the present invention. These equivalent forms are also within the scope defined by the claims appended hereto.
Claims (35)
1. A method for detecting target nucleic acid molecules, characterized by adding a guide RNA, a Cas protein, a nucleic acid probe and a buffer into the system containing the target nucleic acid molecules to be detected, and then detecting the nucleic acid probe.
2. The method for detecting target nucleic acid molecules of claim 1 , characterized in that the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
the Cas12a is preferably one of FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a or Lb4Cas12a; the Cas12a is preferably LbCas12a.
3. The method for detecting target nucleic acid molecules of claim 1 , characterized in that the guide RNA refers to an RNA that directs the Cas protein to specifically bind to the target DNA.
4. The method for detecting target nucleic acid molecules of claim 1 , characterized in that the nucleic acid probe is a single-stranded DNA; the single-stranded DNA is preferably a fluorescently labelled single-stranded DNA; and the single-stranded DNA is preferably a fluorescent probe labelled with a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end; preferably,
the detection method of the nucleic acid probe is preferably a fluorescence detection method; and the fluorescence detection method is preferably detection method using a microplate reader or a fluorescence spectrophotometer.
5. The method for detecting target nucleic acid molecules of any one of claims 1 to 4 , characterized in that the target nucleic acid molecules to be detected in the reaction system of the target nucleic acid molecules to be detected are obtained by amplification.
6. The method for detecting target nucleic acid molecules of claim 5 , characterized in that the detection method can detect pathogenic microorganisms, gene mutations or specific target DNA.
7. The method of claim 1 , characterized in that the Cas protein comprises Cas12b (i.e., C2c1).
8. A use of a Cas protein in a method for detecting target nucleic acid molecules.
9. The use of claim 8 , characterized in that when the target DNA, the guide RNA and the Cas protein form a ternary complex, the complex cleaves other single-stranded DNA molecules in the system; preferably, the guide RNA refers to RNA that directs the Cas protein to specifically bind to the target DNA.
10. A kit for detecting target nucleic acid molecules, characterized in that the kit comprises a guide RNA, a Cas protein, and a nucleic acid probe.
11. A detection system for detecting target nucleic acid molecules, characterized in that the system comprises:
(a) a Cas protein, which is Cas12a or a Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a;
(b) a guide RNA, which directs the Cas protein to specifically bind to target nucleic acid molecules; and
(c) a nucleic acid probe, which is a single-stranded DNA;
wherein the target nucleic acid molecule is a target DNA.
12. The detection system of claim 11 , characterized in that the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (i.e., C2c1).
13. The detection system of claim 11 , characterized in that the nucleic acid probe comprises a single-stranded DNA with a detectable label.
14. A kit for detecting target nucleic acid molecules, characterized in that the kit comprises:
i) a first container and a Cas protein located in the first container, the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-strand DNA cleavage activity of Cas12a;
ii) optionally a second container and a guide RNA located in the second container, the guide RNA directs the Cas protein to specifically bind to the target nucleic acid molecules;
iii) a third container and a nucleic acid probe located in the third container; and
iv) optionally a fourth container and a buffer located in the fourth container;
wherein the target nucleic acid molecule is a target DNA.
15. A method for detecting the presence or absence of target nucleic acid molecules in a sample, characterized by comprising the steps of:
(a) providing a detection system for detecting target nucleic acid molecules according to claim 11 , and the detection system further contains a sample to be detected; and
(b) detecting whether the nucleic acid probe in the detection system is cleaved by the Cas protein, the cleavage is a trans-cleavage of the collateral single-stranded DNA;
wherein, if the nucleic acid probe is cleaved by the Cas protein, it indicates that the target nucleic acid molecule is present in the sample; and if the nucleic acid probe is not cleaved by the Cas protein, it indicates that the target nucleic acid molecule is not present in the sample.
16. The method of claim 15 , characterized in that the nucleic acid amplification method is selected from the group consisting of: PCR amplification, LAMP amplification, RPA amplification, ligase chain reaction, branched DNA amplification, NASBA, SDA, transcription-mediated amplification, rolling circle amplification, HDA, SPIA, NEAR, TMA and SMAP2.
17. The method of claim 15 , characterized in that, when the PAM sequence is absent at the upstream or downstream of the target site (in the range of from −20 nt to +20 nt, preferably in the range of from −15 nt to +15 nt, more preferably in the range of from −10 nt to +10 nt), nucleic acid amplification was carried out using primers introduced with PAM.
18. The method of claim 17 , characterized in that the primer introduced with PAM has a structure of formula I from 5′ to 3′:
P1-P2-P3 (I)
P1-P2-P3 (I)
wherein,
P1 is a 5′ segment sequence complementary or non-complementary to the sequence of the target nucleic acid molecule at the 5′ end;
P2 is a PAM sequence; and
P3 is a 3′ segment sequence complementary to the sequence of the target nucleic acid molecule at the 3′ end.
19. The method of claim 15 , characterized in that, when the PAM sequence is present at the upstream or downstream of the target site (in the range of from −20 nt to +20 nt, preferably in the range of from −15 nt to +15 nt, more preferably in the range of from −10 nt to +10 nt), primers with or without a PAM sequence can be used, and the amplified amplification product contains the PAM sequence.
20. A use of a Cas protein, characterized by being used for the preparation of a detection reagent or kit for detecting target nucleic acid molecules based on a collateral single-stranded DNA cleavage, wherein the Cas protein is Cas12a or a Cas protein having an activity similar to the collateral single-strand DNA cleavage activity of Cas12a.
21. The use of claim 20 , characterized in that the Cas protein having an activity similar to the collateral single-stranded DNA cleavage activity of Cas12a is selected from the group consisting of: Cas12b (or C2c1).
22. A method for detecting target nucleic acid molecules comprising steps of:
(a) providing a mixture including:
a Cas12 protein having collateral cleavage activity;
a guide RNA operative with the Cas12 protein;
a detectably labeled nucleic acid probe susceptible to the collateral cleavage activity;
a buffer; and
a system in which target nucleic acid molecules are to be detected; and
(b) detecting cleavage of the nucleic acid probe.
23. The method of claim 22 , wherein the guide RNA specifically binds to the target nucleic acid molecule(s).
24. The method of claim 22 , wherein the Cas12 protein is selected from the group consisting of: FnCas12a, AsCas12a, LbCas12a, Lb5Cas12a, HkCas12a, OsCas12a, TsCas12a, BbCas12a, BoCas12a, Lb4Cas12a; LbCas12a and Cas12b (i.e., C2c1).
25. The method of claim 22 , wherein the target nucleic acid molecules to be detected have been amplified.
26. The method of claim 25 , wherein the target nucleic acid molecules have been amplified by a method selected from the group consisting of: PCR amplification, LAMP amplification, RPA amplification, ligase chain reaction, branched DNA amplification, NASBA, SDA, transcription-mediated amplification, rolling circle amplification, HDA, SPIA, NEAR, TMA and SMAP2.
27. The method of claim 25 , wherein the target nucleic acid molecules have been amplified using primers comprising a PAM sequence.
28. The method of claim 27 , wherein the amplification product comprises a PAM sequence upstream or downstream of the guide RNA's target site.
29. The method of claim 28 , wherein the PAM site is −20 nt to +20 nt upstream or downstream of the target site.
30. The method of claim 22 , wherein the nucleic acid is detectably labeled with a fluorescent label.
31. The method of claim 30 , wherein the fluorescent label comprises a fluorescent group HEX at the 5′ end and a quenching group BHQ1 at the 3′ end.
32. The method of claim 22 , wherein detecting cleavage of the nucleic acid probe comprises detecting fluorescence.
33. The method of claim 30 , wherein the step of detecting fluorescence comprises using a microplate reader or a fluorescence spectrophotometer.
34. A combination comprising: a Cas12 protein having collateral cleavage activity;
a guide RNA operative with the Cas12 protein and directed to a sequence in a target nucleic acid;
a detectably labeled nucleic acid probe; and
a buffer.
35. The combination of claim 34 , further comprising a sample in which the target nucleic acid is to be detected.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/085,121 US20230131421A1 (en) | 2017-07-14 | 2022-12-20 | Application of cas protein, method for detecting target nucleic acid molecule and kit |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2017105737520 | 2017-07-14 | ||
| CN201710573752.0A CN107488710B (en) | 2017-07-14 | 2017-07-14 | Application of Cas protein, and detection method and kit of target nucleic acid molecule |
| PCT/CN2018/082769 WO2019011022A1 (en) | 2017-07-14 | 2018-04-12 | Application of cas protein, method for detecting target nucleic acid molecule and kit |
| US202016631157A | 2020-01-14 | 2020-01-14 | |
| US17/224,541 US11584955B2 (en) | 2017-07-14 | 2021-04-07 | Application of Cas protein, method for detecting target nucleic acid molecule and kit |
| US18/085,121 US20230131421A1 (en) | 2017-07-14 | 2022-12-20 | Application of cas protein, method for detecting target nucleic acid molecule and kit |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/224,541 Continuation US11584955B2 (en) | 2017-07-14 | 2021-04-07 | Application of Cas protein, method for detecting target nucleic acid molecule and kit |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20230131421A1 true US20230131421A1 (en) | 2023-04-27 |
Family
ID=60643750
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/631,157 Active 2041-11-10 US12180539B2 (en) | 2017-07-14 | 2018-04-12 | Application of CAS protein, method for detecting target nucleic acid molecule and kit |
| US18/085,121 Pending US20230131421A1 (en) | 2017-07-14 | 2022-12-20 | Application of cas protein, method for detecting target nucleic acid molecule and kit |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/631,157 Active 2041-11-10 US12180539B2 (en) | 2017-07-14 | 2018-04-12 | Application of CAS protein, method for detecting target nucleic acid molecule and kit |
Country Status (17)
| Country | Link |
|---|---|
| US (2) | US12180539B2 (en) |
| EP (1) | EP3653722A4 (en) |
| JP (2) | JP2020530779A (en) |
| KR (1) | KR102822761B1 (en) |
| CN (4) | CN112501254B (en) |
| AU (1) | AU2018299445B2 (en) |
| BR (1) | BR112020000809A2 (en) |
| CA (1) | CA3069788A1 (en) |
| EA (1) | EA202090290A1 (en) |
| IL (1) | IL272005A (en) |
| MA (1) | MA49579A (en) |
| MX (1) | MX2020000481A (en) |
| MY (1) | MY209429A (en) |
| PH (1) | PH12020500103A1 (en) |
| SG (1) | SG11202000336RA (en) |
| WO (1) | WO2019011022A1 (en) |
| ZA (1) | ZA202000682B (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12180539B2 (en) | 2017-07-14 | 2024-12-31 | Shanghai Tolo Biotechnology Company Limited | Application of CAS protein, method for detecting target nucleic acid molecule and kit |
Families Citing this family (114)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11584955B2 (en) | 2017-07-14 | 2023-02-21 | Shanghai Tolo Biotechnology Company Limited | Application of Cas protein, method for detecting target nucleic acid molecule and kit |
| US10253365B1 (en) | 2017-11-22 | 2019-04-09 | The Regents Of The University Of California | Type V CRISPR/Cas effector proteins for cleaving ssDNAs and detecting target DNAs |
| CN108220400A (en) * | 2018-01-02 | 2018-06-29 | 武汉启丰生物技术有限公司 | A kind of quick detection of nucleic acids sizing technique based on CRISPR-Cas10 nucleic acid-protein compounds |
| JP6933768B2 (en) | 2018-03-15 | 2021-09-08 | 栄研化学株式会社 | Oligonucleotide probe for single nucleotide polymorphism detection and cis-trans type discrimination method |
| CN108796036B (en) * | 2018-04-03 | 2021-11-19 | 交弘生物科技(上海)有限公司 | Nucleic acid detection method based on prokaryotic Argonaute protein and application thereof |
| CN108588182A (en) * | 2018-04-13 | 2018-09-28 | 中国科学院深圳先进技术研究院 | Isothermal duplication and detection technique based on the substitution of CRISPR- chains |
| CN112941155B (en) * | 2018-05-14 | 2023-07-14 | 北京艾克伦医疗科技有限公司 | DNA primer pair with stem-loop structure and application thereof |
| CN110551800B (en) | 2018-06-03 | 2022-08-19 | 上海吐露港生物科技有限公司 | Application of high-temperature-resistant Cas protein, and detection method and kit of target nucleic acid molecule |
| JP2021528091A (en) * | 2018-06-26 | 2021-10-21 | ザ・ブロード・インスティテュート・インコーポレイテッド | Compositions, Systems, and Methods for Amplification Based on CRISPR Double Nickase |
| EP3830301B1 (en) | 2018-08-01 | 2024-05-22 | Mammoth Biosciences, Inc. | Programmable nuclease compositions and methods of use thereof |
| EP3833751A4 (en) * | 2018-08-09 | 2022-04-27 | G+Flas Life Sciences | COMPOSITIONS AND METHODS FOR GENOME ENGINEERING WITH CAS12A PROTEINS |
| EP3844303A4 (en) * | 2018-08-27 | 2022-06-01 | The Regents of The University of California | REPORTER NUCLEIC ACIDS FOR TYPE V CRISPR-MEDIATED DETECTION |
| CN109055499B (en) * | 2018-08-30 | 2021-01-19 | 杭州杰毅生物技术有限公司 | Isothermal nucleic acid detection method and kit based on CRISPR-Cas |
| WO2020056924A1 (en) * | 2018-09-20 | 2020-03-26 | 中国科学院动物研究所 | Method for detecting nucleic acid |
| CN111117984A (en) * | 2018-11-01 | 2020-05-08 | 浙江大学 | CRISPR system, method and device for visual and specific detection of nucleic acid targets |
| CN111154913B (en) * | 2018-11-08 | 2023-04-18 | 中山大学 | Primers and crRNA for EB virus DNA detection and application thereof |
| CN109251963B (en) * | 2018-11-12 | 2022-11-18 | 复旦大学 | Method and kit for detecting mycoplasma pollution in cell culture solution at constant temperature |
| CN109666662A (en) * | 2018-12-12 | 2019-04-23 | 广州普世利华科技有限公司 | Application of the novel ScCas12a in terms of detection of nucleic acids |
| EP3931313A2 (en) | 2019-01-04 | 2022-01-05 | Mammoth Biosciences, Inc. | Programmable nuclease improvements and compositions and methods for nucleic acid amplification and detection |
| CN109628564B (en) * | 2019-02-25 | 2022-02-01 | 北京市理化分析测试中心 | Primer set for detecting SNP polymorphism and method for detecting SNP polymorphism by using primer set |
| CN109929949B (en) * | 2019-03-14 | 2019-12-31 | 广州医科大学附属肿瘤医院 | Detection method and application of EBV based on CRISPR-Cas12a and G quadruplex-heme |
| CN110117818A (en) * | 2019-04-16 | 2019-08-13 | 天津大学 | Detect the CRISPR high flux biochip of single gene mutation |
| CN110029194A (en) * | 2019-04-24 | 2019-07-19 | 安邦(厦门)生物科技有限公司 | Continuous fluorescence based on CRISPR-Cas gene editing technology monitors detection method and device |
| CN111855990B (en) * | 2019-04-29 | 2023-06-27 | 华南师范大学 | CRISPR/Cas system-based universal colorimetric nucleic acid detection method, kit and application |
| CN110257556B (en) * | 2019-04-30 | 2023-04-18 | 广州普世利华科技有限公司 | Nucleic acid detection kit for pathogenic pathogen of sexually transmitted diseases |
| CN110195102A (en) * | 2019-04-30 | 2019-09-03 | 广州普世利华科技有限公司 | A kind of beta Thalassemia methods of genotyping |
| CN110157821B (en) * | 2019-05-06 | 2020-08-28 | 浙江大学 | Kit for detecting human staphylococcus |
| CN111944879B (en) * | 2019-05-16 | 2024-05-14 | 华南师范大学 | Gene detection method based on CRISPR technology for non-disease diagnosis purpose |
| CN110358848A (en) * | 2019-06-24 | 2019-10-22 | 浙江大学 | A kind of kit for enterococcus faecium detection |
| CN110241238B (en) * | 2019-06-24 | 2020-03-03 | 浙江大学 | A kit for detection of Streptococcus pyogenes |
| CN110317890A (en) * | 2019-06-24 | 2019-10-11 | 浙江大学 | A kind of kit for enterococcus faecalis detection |
| CN110331219A (en) * | 2019-06-24 | 2019-10-15 | 浙江大学 | A kind of kit for pseudomonas aeruginosa detection |
| CN112301101B (en) * | 2019-07-24 | 2024-07-19 | 上海吐露港生物科技有限公司 | CRISPR multi-target detection method and kit thereof |
| US20220364159A1 (en) * | 2019-07-26 | 2022-11-17 | Mammoth Biosciences, Inc. | Compositions for detection of dna and methods of use thereof |
| CN112301102B (en) * | 2019-07-31 | 2024-06-25 | 华南师范大学 | High-specificity loop-mediated isothermal amplification method and application thereof |
| CN110819652A (en) * | 2019-08-21 | 2020-02-21 | 山东金城生物药业有限公司 | Dual-function system for simultaneous gene knockout and gene expression inhibition of corynebacterium glutamicum and application |
| CN110894557A (en) * | 2019-09-20 | 2020-03-20 | 武汉大学 | CRISPR-based crRNA and kit for detection of African swine fever virus |
| CN110551812B (en) * | 2019-09-26 | 2020-08-18 | 暨南大学 | CRISPR-Cas system for diagnosing spinal muscular atrophy and application thereof |
| CN110982878B (en) * | 2019-11-29 | 2023-06-13 | 华南师范大学 | Method for detecting microRNA by CRISPR/Cas13a combined electrochemical luminescence system and application |
| CN111007240A (en) * | 2019-12-02 | 2020-04-14 | 中国医学科学院北京协和医院 | Homogeneous enzyme immunoassay system based on CRISPR technology and method and application thereof |
| CN110878343B (en) * | 2019-12-03 | 2023-04-07 | 国家卫生健康委科学技术研究所 | Cpf1 kit for rapidly detecting genetic deafness pathogenic gene SLC26A4 mutation and detection method thereof |
| CN112941153B (en) * | 2019-12-11 | 2022-09-09 | 清华大学 | DNA detection method |
| CN112986551B (en) * | 2019-12-11 | 2022-09-27 | 北京聚树生物科技有限公司 | Method and kit for detecting concentration of target molecules in mixed system |
| CN110894530B (en) * | 2019-12-25 | 2020-12-08 | 武汉博杰生物医学科技有限公司 | Detection kit and detection method for gene mutation of colon cancer-related molecular marker |
| CN111304294A (en) * | 2020-01-17 | 2020-06-19 | 中国医学科学院北京协和医院 | Rapid detection system and method for PCDA vesicle-binding CRISPR |
| IL295011A (en) | 2020-01-27 | 2022-09-01 | Sherlock Biosciences Inc | Improved detection tests |
| WO2021155775A1 (en) * | 2020-02-03 | 2021-08-12 | 苏州克睿基因生物科技有限公司 | Method and kit for dectecting target nucleic acid |
| AU2021219847A1 (en) * | 2020-02-12 | 2022-10-13 | Massachusetts Institute Of Technology | Field deployable CRISPR-Cas diagnostics and methods of use thereof |
| CN111197098B (en) * | 2020-02-20 | 2023-08-22 | 首都医科大学附属北京胸科医院 | A method for detecting Mycobacterium tuberculosis from sputum |
| CN113337638A (en) * | 2020-03-03 | 2021-09-03 | 上海吐露港生物科技有限公司 | Method and kit for detecting novel coronavirus (SARS-CoV-2) |
| CN111455046A (en) * | 2020-03-13 | 2020-07-28 | 深圳市罗湖区人民医院 | Nucleic acid detection method for mutation of ADGRG6 enhancer and kit thereof |
| CN111440793B (en) * | 2020-03-20 | 2021-11-05 | 武汉博杰生物医学科技有限公司 | Novel coronavirus nucleic acid detection kit |
| US11639523B2 (en) * | 2020-03-23 | 2023-05-02 | The Broad Institute, Inc. | Type V CRISPR-Cas systems and use thereof |
| CN111560469A (en) * | 2020-03-30 | 2020-08-21 | 广州和盛医疗科技有限公司 | Primer group for detecting new coronavirus gene, CRISPR (clustered regularly interspaced short palindromic repeats) sequence combination and application of primer group |
| CN111257297B (en) * | 2020-03-31 | 2023-06-16 | 海南大学 | RNA detection method based on Cas14a enzyme |
| CN111363763B (en) * | 2020-03-31 | 2023-03-14 | 海南大学 | Method for activating Cas14a enzyme collateral cleavage effect by RNA |
| CN111549177A (en) * | 2020-04-27 | 2020-08-18 | 广州再生医学与健康广东省实验室 | gRNA and kit for detecting SARS-CoV-2 |
| CN111719015A (en) * | 2020-05-21 | 2020-09-29 | 昆明医科大学第一附属医院 | A detection kit for human immunodeficiency virus HIV-1 |
| WO2021252836A1 (en) | 2020-06-12 | 2021-12-16 | Sherlock Biosciences | Crispr-based sars-cov-2 detection |
| CN111733287B (en) * | 2020-06-22 | 2022-10-11 | 天津大学 | Kit for detecting pathogenic nucleic acid of fever with thrombocytopenia syndrome |
| CN111733216B (en) * | 2020-06-22 | 2023-03-28 | 山东舜丰生物科技有限公司 | Method for improving detection efficiency of target nucleic acid |
| CN111662968A (en) * | 2020-06-23 | 2020-09-15 | 南方科技大学 | Detection method of PAM-sequence-free DNA based on CRISPR and application thereof |
| CN112795624B (en) * | 2020-07-17 | 2021-11-19 | 山东舜丰生物科技有限公司 | Method for detecting target nucleic acid using nucleic acid detector containing abasic spacer |
| CN111909987A (en) * | 2020-07-31 | 2020-11-10 | 浙江科途医学科技有限公司 | Reagent composition, kit and detection system for KIF5B-RET fusion gene detection |
| CN113801917B (en) * | 2020-08-28 | 2022-11-22 | 山东舜丰生物科技有限公司 | Method for detecting multiple nucleic acids based on CRISPR technology |
| CN113293198B (en) * | 2020-09-18 | 2022-12-02 | 山东舜丰生物科技有限公司 | Method for performing multiple detection on target nucleic acid based on CRISPR technology |
| CN112251494B (en) * | 2020-10-09 | 2022-09-02 | 湖南大学 | Nucleic acid detection method based on CRISPR-Cas autocatalytic amplification network and application thereof |
| CN116391023A (en) * | 2020-10-13 | 2023-07-04 | 佳能株式会社 | Nucleic acid detection device and method for detecting nucleic acid |
| CN112301162B (en) * | 2020-10-22 | 2023-09-22 | 清华-伯克利深圳学院筹备办公室 | Viral nucleic acid detection method for simultaneous detection of DNA viruses and RNA viruses |
| JP7749315B2 (en) * | 2020-11-27 | 2025-10-06 | キヤノン株式会社 | Method and kit for detecting target nucleic acid |
| CN112695073A (en) * | 2020-12-30 | 2021-04-23 | 上海理工大学 | CRISPR/Cas12a one-step nucleic acid detection method |
| CN112831544B (en) * | 2020-12-31 | 2024-06-14 | 华南农业大学 | Biological detection method and biological detection device based on CRISPR/Cas12a system |
| CN115335536B (en) * | 2021-01-08 | 2024-09-20 | 武汉大学 | Compositions and methods for on-the-fly nucleic acid detection |
| CA3210883A1 (en) | 2021-02-09 | 2022-08-18 | Sherlock Biosciences, Inc. | Nucleic acid amplification using promoter primers |
| CN113061650B (en) * | 2021-02-19 | 2024-07-16 | 中国科学院深圳先进技术研究院 | System and method for detecting pathogen nucleic acid in real time |
| CN113046477A (en) * | 2021-02-26 | 2021-06-29 | 广州医科大学附属第一医院(广州呼吸中心) | Specific crRNA for identifying D614G mutation site, system, kit and application |
| NO347409B1 (en) * | 2021-04-11 | 2023-10-23 | Glomsroed Mikkel Ante | PROCEDURE FOR THE DETECTION OF MICROORGANISMS OR GENE DEFECTS |
| CN114807431A (en) * | 2021-04-15 | 2022-07-29 | 华中农业大学 | An improved nucleic acid visualization detection technology mediated by CRISPR system and its application |
| CN113324956B (en) * | 2021-04-22 | 2023-06-09 | 上海市肿瘤研究所 | A modular detection platform based on the coupling of CRISPR technology and framework nucleic acid, its construction method and its application |
| CN112852980B (en) * | 2021-04-23 | 2021-11-26 | 上海海关动植物与食品检验检疫技术中心 | Detection method for detecting nucleic acid of Atlantic salmon based on CRISPR fluorescence method and detection kit thereof |
| CN113444817A (en) * | 2021-05-12 | 2021-09-28 | 中国人民解放军军事科学院军事医学研究院 | Bacillus anthracis detection method based on CRISPR-Cas12a system |
| CN113403424B (en) * | 2021-05-28 | 2024-01-09 | 华南理工大学 | Method and kit for rapidly detecting novel coronaviruses and mutant strains based on CRISPR/Cas12a technology |
| CN113337489A (en) * | 2021-06-07 | 2021-09-03 | 广州美格生物科技有限公司 | Novel chimera TsCas12a protein and preparation technology |
| CN113373264B (en) * | 2021-06-10 | 2022-04-12 | 安徽医科大学 | A novel coronavirus dual-target rapid detection method and kit based on CRISPR/Cas system |
| CN113355397A (en) * | 2021-06-24 | 2021-09-07 | 深圳市第二人民医院(深圳市转化医学研究院) | Field effect transistor chip, kit for detecting nucleic acid and method for detecting nucleic acid content |
| CN113980957A (en) * | 2021-07-02 | 2022-01-28 | 苏州系统医学研究所 | CRISPR/Cas12a-based single-stranded DNA probe and method for detecting target nucleic acid |
| CN113388691B (en) * | 2021-07-23 | 2022-08-30 | 中国疾病预防控制中心传染病预防控制所 | Nucleic acid detection method based on PCR amplification and CRISPR-Cas12a and application |
| CN113686934B (en) * | 2021-08-13 | 2024-08-16 | 广东海洋大学 | CRISPR/Cas12a-RCA electrochemical sensor detection system and application thereof |
| CN115247206B (en) * | 2021-10-21 | 2024-12-20 | 河北大学 | Method for detecting nucleic acid markers based on ligase chain reaction and gene editing technology |
| WO2023087290A1 (en) * | 2021-11-20 | 2023-05-25 | Agricultural Genomics Institute At Shenzhen, Chinese Academy Of Agricultural Sciences | Methods for nucleic acid detection |
| CN113999921B (en) * | 2021-11-23 | 2023-06-27 | 中国医学科学院输血研究所 | Method and kit for rapidly and visually detecting shigella flexneri |
| CN114134218B (en) * | 2021-12-02 | 2022-10-28 | 中国疾病预防控制中心传染病预防控制所 | Fluorescent detection method based on CRISPR-Cas12a |
| CN114292843B (en) * | 2021-12-03 | 2023-07-21 | 中国科学院精密测量科学与技术创新研究院 | CRISPR/Cas12a detection system of gene stimulant and application thereof |
| CN114807316B (en) * | 2022-03-11 | 2023-02-03 | 北京科技大学 | RNA quantitative detection method without nucleic acid amplification visualization |
| CN114592043A (en) * | 2022-03-23 | 2022-06-07 | 北京盛因生物科技有限公司 | Isothermal nucleic acid detection enzyme composition, kit, application and detection method thereof |
| CN114634972B (en) * | 2022-05-19 | 2022-08-26 | 舜丰生物科技(海南)有限公司 | Method for detecting nucleic acid by using Cas enzyme |
| CN115261497A (en) * | 2022-06-27 | 2022-11-01 | 深圳市罗湖区人民医院 | A nucleic acid detection kit for Salmonella parC S80I mutation and its application |
| CN120400099A (en) * | 2022-07-01 | 2025-08-01 | 中国科学院基础医学与肿瘤研究所(筹) | An ultrasensitive target nucleic acid enrichment and detection method based on programmable nuclease |
| CN119790163A (en) | 2022-07-01 | 2025-04-08 | 夏洛克生物科学公司 | Ambient temperature nucleic acid amplification and detection |
| CN115838831A (en) * | 2022-08-29 | 2023-03-24 | 深圳市海微生物科技有限公司 | Application of FnCas12a mutant in nucleic acid detection and nucleic acid detection method |
| CN115948526A (en) * | 2022-11-30 | 2023-04-11 | 华中科技大学 | Substrate DNA for CRISPR-Cas12a system, application thereof and universal gene mutation detection method |
| CN118275664A (en) | 2022-12-30 | 2024-07-02 | 上海吐露港生物科技有限公司 | Non-nucleic acid target detection method and application based on split Cas protein |
| CN116218960A (en) * | 2022-12-30 | 2023-06-06 | 上海市农业科学院 | Simple visual rapid nucleic acid detection method and application thereof |
| CN116179511B (en) * | 2023-03-10 | 2023-12-22 | 之江实验室 | Application of Cpf1 protein in preparation of kit for nucleic acid detection |
| CN116297376B (en) * | 2023-04-25 | 2023-08-29 | 中国科学院过程工程研究所 | Photoelectric dual-mode biological probe and application thereof |
| CN116574848A (en) * | 2023-06-20 | 2023-08-11 | 中国农业科学院兰州兽医研究所 | A primer and detection method for detecting porcine circovirus type 2 based on LAMP-CRISPR Cas12a |
| CN116656784B (en) * | 2023-07-26 | 2023-10-20 | 南京鸿明生物科技有限公司 | Titer measurement method of amplification-free adeno-associated virus genome |
| CN117210437B (en) * | 2023-08-29 | 2025-05-06 | 华中农业大学 | Enzyme identification of two gene editing tools and application of enzyme identification in nucleic acid detection |
| CN117511941A (en) * | 2023-10-27 | 2024-02-06 | 中国医学科学院病原生物学研究所 | CrRNA for detecting candida otophylla, combination and application thereof, and method for rapidly detecting candida otophylla |
| US20250223659A1 (en) | 2024-01-08 | 2025-07-10 | Roche Molecular Systems, Inc. | Methods and uses of crispr cascade reactions for crispr diagnostics |
| CN117821630B (en) * | 2024-02-20 | 2025-03-07 | 江苏省家禽科学研究所 | Nucleic acid detection kit and method for detecting Salmonella enteritidis |
| CN118726609B (en) * | 2024-08-06 | 2025-03-18 | 南方医科大学 | A primer set for identifying Chinese pangolins and its application |
| CN118895376A (en) * | 2024-10-08 | 2024-11-05 | 温州医科大学附属第一医院 | CRISPR-Cas12 detection method and application of drug-resistant mutations in Mycobacterium tuberculosis with natural PAM deletion |
| CN119120726A (en) * | 2024-10-09 | 2024-12-13 | 中国农业科学院农业基因组研究所 | A SNP typing kit based on dual Cas enzymes and a single-tube typing method |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101935697B (en) * | 2010-04-16 | 2015-11-25 | 中生方政生物技术有限公司 | The method detected for nucleotide sequence and test kit |
| WO2012024642A1 (en) | 2010-08-20 | 2012-02-23 | Life Technologies Corporation | Quantitative real-time pcr assay using fret dual-labeled primers |
| EP4397760A3 (en) * | 2012-10-23 | 2024-10-09 | Toolgen Incorporated | Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof |
| JP6473419B2 (en) * | 2012-12-13 | 2019-02-20 | ダウ アグロサイエンシィズ エルエルシー | DNA detection method for site-specific nuclease activity |
| EP3129488B1 (en) | 2014-04-10 | 2019-06-12 | The Regents of The University of California | Methods and compositions for using argonaute to modify a single stranded target nucleic acid |
| US10190106B2 (en) | 2014-12-22 | 2019-01-29 | Univesity Of Massachusetts | Cas9-DNA targeting unit chimeras |
| HUE063813T2 (en) | 2015-01-28 | 2024-02-28 | Caribou Biosciences Inc | CRISPR hybrid DNA/RNA polynucleotides and application methods |
| US11180792B2 (en) * | 2015-01-28 | 2021-11-23 | The Regents Of The University Of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| US20160362667A1 (en) | 2015-06-10 | 2016-12-15 | Caribou Biosciences, Inc. | CRISPR-Cas Compositions and Methods |
| US9790490B2 (en) * | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| WO2017053762A1 (en) * | 2015-09-24 | 2017-03-30 | Sigma-Aldrich Co. Llc | Methods and reagents for molecular proximity detection using rna-guided nucleic acid binding proteins |
| EP3362104A4 (en) * | 2015-10-16 | 2019-03-27 | Temple University - Of The Commonwealth System of Higher Education | METHODS AND COMPOSITIONS USING CPF1 FOR RNA-GUIDED GENETIC EDITION |
| AU2016342038B2 (en) * | 2015-10-22 | 2022-09-08 | Massachusetts Institute Of Technology | Type VI-B CRISPR enzymes and systems |
| US20170130238A1 (en) | 2015-11-03 | 2017-05-11 | Synthetic Genomics, Inc. | Device and methods for biolistic transformation |
| WO2017083368A1 (en) | 2015-11-12 | 2017-05-18 | Pfizer Inc. | Tissue-specific genome engineering using crispr-cas9 |
| KR102093570B1 (en) | 2015-12-04 | 2020-03-25 | 카리부 바이오사이언시스 인코포레이티드 | Engineered nucleic acid targeting nucleic acid |
| EP3402885A4 (en) | 2016-01-11 | 2019-07-03 | The Board of Trustees of the Leland Stanford Junior University | CHIMERIC PROTEINS AND METHODS OF REGULATING GENE EXPRESSION |
| CN112501254B (en) * | 2017-07-14 | 2024-07-19 | 上海吐露港生物科技有限公司 | Application of Cas protein, detection method of target nucleic acid molecule and kit |
| US11584955B2 (en) | 2017-07-14 | 2023-02-21 | Shanghai Tolo Biotechnology Company Limited | Application of Cas protein, method for detecting target nucleic acid molecule and kit |
| US11633732B2 (en) | 2017-10-04 | 2023-04-25 | The Broad Institute, Inc. | CRISPR effector system based diagnostics |
| US10253365B1 (en) * | 2017-11-22 | 2019-04-09 | The Regents Of The University Of California | Type V CRISPR/Cas effector proteins for cleaving ssDNAs and detecting target DNAs |
| WO2020056924A1 (en) | 2018-09-20 | 2020-03-26 | 中国科学院动物研究所 | Method for detecting nucleic acid |
| US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
-
2017
- 2017-07-14 CN CN202011092324.4A patent/CN112501254B/en active Active
- 2017-07-14 CN CN201710573752.0A patent/CN107488710B/en active Active
-
2018
- 2018-04-12 EA EA202090290A patent/EA202090290A1/en unknown
- 2018-04-12 CN CN202410308071.1A patent/CN118207297A/en active Pending
- 2018-04-12 US US16/631,157 patent/US12180539B2/en active Active
- 2018-04-12 MX MX2020000481A patent/MX2020000481A/en unknown
- 2018-04-12 EP EP18832456.0A patent/EP3653722A4/en active Pending
- 2018-04-12 WO PCT/CN2018/082769 patent/WO2019011022A1/en not_active Ceased
- 2018-04-12 AU AU2018299445A patent/AU2018299445B2/en active Active
- 2018-04-12 BR BR112020000809-5A patent/BR112020000809A2/en unknown
- 2018-04-12 CA CA3069788A patent/CA3069788A1/en active Pending
- 2018-04-12 SG SG11202000336RA patent/SG11202000336RA/en unknown
- 2018-04-12 MY MYPI2020000224A patent/MY209429A/en unknown
- 2018-04-12 KR KR1020207003220A patent/KR102822761B1/en active Active
- 2018-04-12 JP JP2020523474A patent/JP2020530779A/en active Pending
- 2018-04-12 CN CN201880046701.5A patent/CN111094588B/en active Active
- 2018-04-12 MA MA049579A patent/MA49579A/en unknown
-
2020
- 2020-01-13 IL IL272005A patent/IL272005A/en unknown
- 2020-01-14 PH PH12020500103A patent/PH12020500103A1/en unknown
- 2020-01-31 ZA ZA2020/00682A patent/ZA202000682B/en unknown
-
2022
- 2022-12-20 US US18/085,121 patent/US20230131421A1/en active Pending
-
2023
- 2023-04-13 JP JP2023065743A patent/JP2023080282A/en active Pending
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12180539B2 (en) | 2017-07-14 | 2024-12-31 | Shanghai Tolo Biotechnology Company Limited | Application of CAS protein, method for detecting target nucleic acid molecule and kit |
Also Published As
| Publication number | Publication date |
|---|---|
| ZA202000682B (en) | 2021-01-27 |
| JP2020530779A (en) | 2020-10-29 |
| US20230002811A1 (en) | 2023-01-05 |
| CA3069788A1 (en) | 2019-01-17 |
| NZ760987A (en) | 2024-03-22 |
| PH12020500103A1 (en) | 2020-10-19 |
| CN111094588A (en) | 2020-05-01 |
| KR102822761B1 (en) | 2025-06-19 |
| CN112501254A (en) | 2021-03-16 |
| IL272005A (en) | 2020-02-27 |
| KR20200035956A (en) | 2020-04-06 |
| SG11202000336RA (en) | 2020-02-27 |
| WO2019011022A1 (en) | 2019-01-17 |
| JP2023080282A (en) | 2023-06-08 |
| CN111094588B (en) | 2024-04-05 |
| CN112501254B (en) | 2024-07-19 |
| MY209429A (en) | 2025-07-08 |
| EP3653722A1 (en) | 2020-05-20 |
| EP3653722A4 (en) | 2021-04-21 |
| AU2018299445A1 (en) | 2020-02-06 |
| CN107488710B (en) | 2020-09-22 |
| CN118207297A (en) | 2024-06-18 |
| MA49579A (en) | 2020-05-20 |
| BR112020000809A2 (en) | 2020-09-08 |
| AU2018299445B2 (en) | 2024-05-30 |
| EA202090290A1 (en) | 2020-07-14 |
| MX2020000481A (en) | 2020-09-10 |
| CN107488710A (en) | 2017-12-19 |
| US12180539B2 (en) | 2024-12-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230131421A1 (en) | Application of cas protein, method for detecting target nucleic acid molecule and kit | |
| US11584955B2 (en) | Application of Cas protein, method for detecting target nucleic acid molecule and kit | |
| CN110551800B (en) | Application of high-temperature-resistant Cas protein, and detection method and kit of target nucleic acid molecule | |
| CN107849603B (en) | Amplification of primers with limited nucleotide composition | |
| AU2016281718B2 (en) | Selective degradation of wild-type DNA and enrichment of mutant alleles using nuclease | |
| US20220267847A1 (en) | Crispr multi-target detection method and test kit therefor | |
| US20220372558A1 (en) | Method and Kit of Detecting the Absence of Micro-Organisms | |
| KR20110106922A (en) | Single Cell Nucleic Acid Analysis | |
| EP2929048A1 (en) | Restriction enzyme-free target enrichment | |
| WO2006098428A1 (en) | Method of lessening nonspecific amplification from primer dimer | |
| US10597710B2 (en) | Ligase activity | |
| JP2023521263A (en) | Method for asymmetric amplification of multiple target nucleic acids | |
| JP2007319096A (en) | Nucleic acid amplification method using nicking activity of endonuclease | |
| CN113337638A (en) | Method and kit for detecting novel coronavirus (SARS-CoV-2) | |
| EA042681B1 (en) | APPLICATION OF CAS PROTEIN, METHOD FOR DETECTING TARGET NUCLEIC ACID MOLECULE AND KIT | |
| HK40029609A (en) | Application of cas protein, method for detecting target nucleic acid molecule and kit | |
| CN118620997B (en) | Cas 13-based method, kit and application for detecting RNA (ribonucleic acid) by non-nucleic acid amplification | |
| WO2023092178A1 (en) | Improved isothermal amplification | |
| KR20250078890A (en) | Ambient temperature nucleic acid amplification and detection | |
| HK40064470A (en) | Amplification with primers of limited nucleotide composition | |
| Hou et al. | A Method for HLA Genotyping Using the Specific Cleavage of DNA-rN1-DNA/DNA with RNase HII from Chlamydia pneumoniae |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: SHANGHAI TOLO BIOTECHNOLOGY COMPANY LIMITED, CHINA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WANG, JIN;CHENG, QIUXIANG;LI, SHIYUAN;AND OTHERS;SIGNING DATES FROM 20210429 TO 20210510;REEL/FRAME:062168/0318 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |