US20210332101A1 - Compositions and methods for t cell engineering - Google Patents

Compositions and methods for t cell engineering Download PDF

Info

Publication number
US20210332101A1
US20210332101A1 US17/246,394 US202117246394A US2021332101A1 US 20210332101 A1 US20210332101 A1 US 20210332101A1 US 202117246394 A US202117246394 A US 202117246394A US 2021332101 A1 US2021332101 A1 US 2021332101A1
Authority
US
United States
Prior art keywords
cell
immune cell
cells
engineered immune
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US17/246,394
Other languages
English (en)
Inventor
Xinxin Wang
Tao Jin
Chunhui Yang
Zhongdong SHI
Liping Liu
Jing Sun
Shuyi QIU
Wei Cao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Suzhou Gracell Biotechnologies Co Ltd
Original Assignee
Suzhou Gracell Biotechnologies Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Suzhou Gracell Biotechnologies Co Ltd filed Critical Suzhou Gracell Biotechnologies Co Ltd
Assigned to SUZHOU GRACELL BIOTECHNOLOGIES CO., LTD. reassignment SUZHOU GRACELL BIOTECHNOLOGIES CO., LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD.
Assigned to GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD. reassignment GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: WANG, XINXIN, CAO, WEI, SUN, JING, JIN, TAO, LIU, LIPING, QIU, Shuyi, YANG, CHUNHUI, SHI, Zhongdong
Publication of US20210332101A1 publication Critical patent/US20210332101A1/en
Priority to US17/821,664 priority Critical patent/US12454564B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/28Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/48Reproductive organs
    • A61K35/54Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
    • A61K35/545Embryonic stem cells; Pluripotent stem cells; Induced pluripotent stem cells; Uncharacterised stem cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4204Epidermal growth factor receptors [EGFR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4215Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4217Receptors for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4231Cytokines
    • A61K40/4234Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/50Cellular immunotherapy characterised by the use of allogeneic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70507CD2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/804Blood cells [leukemia, lymphoma]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23On/off switch
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/29Multispecific CARs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2307Interleukin-7 (IL-7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50Cell markers; Cell surface determinants
    • C12N2501/515CD3, T-cell receptor complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2503/00Use of cells in diagnostics
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • CARs chimeric antigen receptors
  • compositions and methods for genetically modifying immune cells for allogeneic cell therapy.
  • methods of modifying immune cells e.g., T cells
  • methods of modifying immune cells while circumventing the time and expense of making patient-specific T cell products.
  • the present disclosure provides an engineered immune cell, comprising: a chimeric polypeptide comprising (i) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, and (ii) an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the chimeric polypeptide with a cell death activator, wherein the enhancer moiety is linked to the inducible cell death moiety, and one or more chimeric polypeptide receptors (CPRs) comprising a binding moiety, wherein the binding moiety comprises (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject and (ii) a second antigen binding domain capable of binding to a disease-associated antigen, wherein an individual CPR of the one or more CPRs comprises (i) the first antigen binding domain, (ii) the second antigen binding domain, or (iii) both the first antigen
  • the one or more CPRs are one or more chimeric antigen receptor (CARs) or engineered T cell receptors (TCRs).
  • the first antigen binding domain binds to an immune cell antigen.
  • a gene encoding an endogenous surface marker of the engineered immune cell is inactivated (e.g., silenced or knocked out), wherein the endogenous surface marker is capable of binding to the first antigen binding domain when expressed.
  • an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated.
  • a function of the endogenous TCR of the engineered immune cell is inhibited by an inhibitor.
  • a gene encoding a subunit of the endogenous TCR is inactivated such that the endogenous TCR is inactivated.
  • the gene encoding the subunit is TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the chimeric polypeptide does not comprise any self-cleaving peptide flanked by the enhancer moiety and the inducible cell death moiety.
  • the enhancer moiety is configured to constitutively enhance the one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell.
  • the one or more intracellular signaling pathways are one or more cytokine signaling pathways.
  • the enhancer moiety is self-activating through self-oligomerizing. In some embodiments, the enhancer moiety is self-activating through self-dimerizing.
  • the chimeric polypeptide is a secreted protein. In some embodiments, the chimeric polypeptide is an intracellular protein. In some embodiments, the chimeric polypeptide is a transmembrane protein. In some embodiments, the enhancer moiety or the inducible cell death moiety is contained in an ectodomain of the transmembrane protein.
  • the enhancer moiety or the inducible cell death moiety is contained in an endodomain of the transmembrane protein. In some embodiments, (i) the enhancer moiety is contained in an endodomain of the transmembrane protein and (ii) the inducible cell death moiety are contained in an ectodomain of the transmembrane protein. In some embodiments, (i) the enhancer moiety is contained in an ectodomain of the transmembrane protein, and (ii) the inducible cell death moiety is contained in an endodomain of the transmembrane protein. In some embodiments, the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the enhancer moiety functions as a trans-activating factor or a cis-activating factor.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ⁇ CD20, mTMPK, ⁇ CD19, RQR8, Her2t, CD30, BCMA and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and the cell death activator is AP1903.
  • the cell death activator comprises a nucleic acid, a polynucleotide, an amino acid, a polypeptide, lipid, a carbohydrate, a small molecule, an enzyme, a ribosome, a proteasome, a variant thereof, or any combination thereof.
  • the individual CPR of the one or more CPRs comprises both the first antigen binding domain and the second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain is linked via a linker.
  • the linker does not comprise a self-cleaving peptide.
  • the first antigen binding domain or the second antigen binding is a scFv.
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH1-VL1-VH2; (ii) VH2-VL1-VH1-VL2; (iii) VL1-VH2-VL2-VH1; (iv) VH1-VL2-VH2-VL1; (v) VL2-VL1-VH1-VH2; (vi) VH2-VH1-VL1-VL2; (vii) VL1-VL2-VH2-VH1; or (viii) VH1-VH2-VL2-VL1; wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and VL2 is light chain variable domain of the second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH2-VL1-VH1; (ii) VL2-VH2-VH1-VL1; (iii) VL1-VH1-VL2-VH2; (iv) VL1-VH1-VH2-VL2; (v) VH2-VL2-VL1-VH1; (vi) VH2-VL2-VH1-VL1; (vii) VH1-VL1-VL2-VH2; or (viii) VH1-VL1-VH2-VL2, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and VL2 is light chain variable domain of the second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain bind to the immune cell antigen and the disease-associated antigen.
  • the individual CPR of the one or more CPRs comprises only the first antigen binding domain and an additional individual CPR of the one or more CPRs comprises only the second antigen binding domain.
  • the immune cell antigen is a surface protein or a secreted protein of an immune cell.
  • the immune cell is an NK cell, a T cell, a monocyte, an innate lymphocyte, a macrophage or a granulocyte.
  • the immune cell is obtained from peripheral blood, cord blood, or is derived from a stem cell.
  • the immune cell antigen is selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the disease-associated antigen is a tumor-associated antigen.
  • the tumor-associated antigen is CD19, CD2, CD3, CD4, CD5, CD7, CD8, CD19, CD20, CD22, CD25, CD28, CD30, CD33, CD38, CD40, CD44V6, CD47, CD52, CD56, CD57, CD58, CD79b, CD80, CD86, CD81, CD123, CD133, CD137, CD151, CD171, CD276, CLL1, B7H4, BCMA, VEGFR-2, EGFR, GPC3, PMSA, CEACAM6, c-Met, EGFRvIII, ErbB2/HER2, ErbB3, HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, Flt3, CEA, CA125, CTLA-4, GITR, BT
  • the first antigen binding domain binds to an immune cell antigen selected from the group consisting of CD2, CD3, CD5, CD7 and CD137, and the second antigen binding domain binds to CD19. In some embodiments, the first antigen binding domain binds to CD3, and the second antigen binding domain binds to CD19. In some embodiments, the first antigen binding domain binds to CD7, and the second antigen binding domain binds to CD19. In some embodiments, the first antigen binding domain binds to CD137, and the second antigen binding domain binds to CD19. In some embodiments, expression of one or more endogenous human leukocyte antigen (HLA) genes of the engineered immune cell remains intact.
  • HLA human leukocyte antigen
  • expression of endogenous HLA-I and/or HLA-II genes of the engineered immune cell remains intact. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell remains intact. In some embodiments, expression of one or more endogenous HLA genes of the engineered immune cell is upregulated. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell is upregulated. In some embodiments, expression of an endogenous HLA-I, an endogenous HLA-II, or both of the engineered immune cell is inhibited.
  • a gene encoding endogenous HLA-I, endogenous HLA-II, or both is inactivated.
  • HLA-E or HLA-G of the engineered immune cell is overexpressed.
  • CD24, CD47, FASL and/or PD-1 of the engineered immune cell is overexpressed.
  • the engineered immune cell is a T cell, an NKT cell or an NK cell.
  • the engineered immune cell is derived from a stem cell.
  • the stem cell is a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC).
  • the engineered immune cell is an autologous cell or an allogeneic cell.
  • the engineered immune cell is obtained from a subject having a condition. In some embodiments, the engineered immune cell is obtained from a healthy donor.
  • an engineered immune cell comprising: (a) one or more chimeric antigen receptors (CARs) comprising a binding moiety, wherein the binding moiety comprises a first antigen binding domain capable of binding to an immune cell antigen and a second antigen binding domain capable of binding to a disease-associated antigen, and wherein each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain; and (b) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, wherein an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated, and wherein the engineered immune cell exhibits (i) enhanced degree of persistence by remaining viable in vitro for at least about 20 days while in presence of cells that are heterologous to the engineered immune cell, (ii) enhanced degree of expansion by at least about 10-fold within 15 days, or (iii) enhanced cytotoxicity against a target cell comprising the immune cell antigen or the disease
  • CARs chimeric
  • the engineered immune cell is characterized by exhibiting two or more of (i), (ii), and (iii). In some embodiments, (i), (ii), and/or (iii) is measured in absence of any exogenous enhancer moiety.
  • the immune cell antigen is selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD160, CD161 CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CS1, TCR ⁇ , TCR ⁇ , and SLAMF7.
  • the immune cell antigen is CD7.
  • the enhancer moiety is configured to constitutively enhance the one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell. In some embodiments, the one or more intracellular signaling pathways are one or more cytokine signaling pathways. In some embodiments, the enhancer moiety is self-activating through self-oligomerizing. In some embodiments, the enhancer moiety is self-activating through self-dimerizing. In some embodiments, the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • a gene encoding a subunit of the endogenous TCR is inactivated such that the endogenous TCR is inactivated.
  • the gene encoding the subunit is TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the engineered immune cell further comprises an inducible cell death moiety, which inducible cell death moiety effects suicide of the engineered immune cell upon contact with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK
  • the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9
  • the cell death activator is AP1903.
  • the cell death activator comprises a nucleic acid, a polynucleotide, an amino acid, a polypeptide, lipid, a carbohydrate, a small molecule, an enzyme, a ribosome, a proteasome, a variant thereof, or any combination thereof.
  • expression of one or more endogenous human leukocyte antigen (HLA) genes of the engineered immune cell remains intact. In some embodiments, expression of endogenous HLA-I and/or HLA-II genes of the engineered immune cell remains intact. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell remains intact. In some embodiments, expression of one or more endogenous HLA genes of the engineered immune cell is upregulated. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell is upregulated.
  • expression of an endogenous HLA-I, an endogenous HLA-II, or both of the engineered immune cell is inhibited.
  • a gene encoding endogenous HLA-I, endogenous HLA-II, or both is inactivated.
  • HLA-E or HLA-G of the engineered immune cell is overexpressed.
  • CD24, CD47, FASL and/or PD-1 of the engineered immune cell is overexpressed.
  • the disease-associated antigen is a tumor-associated antigen.
  • the first antigen binding domain or the second antigen binding domain is a scFv.
  • a gene encoding an endogenous surface marker of the engineered immune cell is inactivated, wherein the endogenous surface marker is capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker is CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the engineered immune cell is a T cell, an NKT cell or an NK cell. In some embodiments, the engineered immune cell is derived from a stem cell. In some embodiments, the stem cell is a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC). In some embodiments, the engineered immune cell is an autologous cell or an allogeneic cell. In some embodiments, the engineered immune cell is obtained from a subject having a condition. In some embodiments, the engineered immune cell is obtained from a healthy donor.
  • HSC hematopoietic stem cell
  • iPSC induced pluripotent stem cell
  • the present disclosure provides a pharmaceutical composition for treating a disease, comprising the engineered immune cell described herein, and a pharmaceutically acceptable carrier.
  • the present disclosure provides a method of treating or diagnosing a disease in a subject, comprising administering the pharmaceutical composition to the subject.
  • the engineered immune cell in the pharmaceutical composition is derived from an allogeneic immune cell.
  • the engineered immune cell derived from the allogeneic immune cell does not induce graft versus host disease (GvHD) in the subject.
  • the engineered immune cell in the pharmaceutical composition is derived from an autologous immune cell.
  • an endogenous TCR of the engineered immune cell in the pharmaceutical composition is functionally inactive.
  • the engineered immune cell reduces GvHD in the subject compared to an additional immune cell having a functionally active TCR.
  • the disease is a cancer.
  • the cancer is lymphoma or leukemia.
  • the present disclosure provides a cell, comprising: a functionally inactive T cell receptor (TCR), and one or more chimeric antigen receptors (CARs), wherein each individual CAR of the one or more CARs comprises a binding moiety, which binding moiety comprises (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject and (ii) a second antigen binding domain that binds to a disease-associated antigen, and wherein each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain.
  • TCR functionally inactive T cell receptor
  • CARs chimeric antigen receptors
  • the first antigen binding domain and the second antigen binding domain is linked by a linker.
  • the linker does not comprise a self-cleaving peptide.
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH1-VL1-VH2; (ii) VH2-VL1-VH1-VL2; (iii) VL1-VH2-VL2-VH1; (iv) VH1-VL2-VH2-VL1; (v) VL2-VL1-VH1-VH2; (vi) VH2-VH1-VL1-VL2; (vii) VL1-VL2-VH2-VH1; or (viii) VH1-VH2-VL2-VL1, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH2-VL1-VH1; (ii) VL2-VH2-VH1-VL1; (iii) VL1-VH1-VL2-VH2; (iv) VL1-VH1-VH2-VL2; (v) VH2-VL2-VL1-VH1; (vi) VH2-VL2-VH1-VL1; (vii) VH1-VL1-VL2-VH2; or (viii) VH1-VL1-VH2-VL2, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and VL2 is light chain variable domain of the second antigen binding domain.
  • a gene encoding a subunit of an endogenous TCR of the cell is inactivated, thereby generating the functionally inactive TCR.
  • the gene encoding the subunit is TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the first antigen binding domain binds to an immune cell antigen.
  • the immune cell antigen is a surface protein or a secreted protein of an immune cell.
  • the immune cell is an NK cell, a T cell, a monocyte, a macrophage, or a granulocyte.
  • the immune cell antigen is CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the disease-associated antigen is a tumor-associated antigen.
  • the tumor-associated antigen is CD19, CD2, CD3, CD4, CD5, CD7, CD8, CD19, CD20, CD22, CD25, CD28, CD30, CD33, CD38, CD40, CD44V6, CD47, CD52, CD56, CD57, CD58, CD79b, CD80, CD86, CD81, CD123, CD133, CD137, CD151, CD171, CD276, CLL1, B7H4, BCMA, VEGFR-2, EGFR, GPC3, PMSA, CEACAM6, c-Met, EGFRvIII, ErbB2/HER2, ErbB3, HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, Flt3, CEA, CA125, CTLA-4, GITR, BT
  • the first antigen binding domain binds to an immune cell antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7, and the second antigen binding domain binds to CD19.
  • an immune cell antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30,
  • the first antigen binding domain binds to CD3, and the second antigen binding domain binds to CD19. In some embodiments, the first antigen binding domain binds to CD7, and the second antigen binding domain binds to CD19. In some embodiments, the first antigen binding domain binds to CD137, and the second antigen binding domain binds to CD19.
  • the cell further comprises an enhancer moiety, which enhancer moiety enhances one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively enhance the one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell.
  • the one or more intracellular signaling pathways are one or more cytokine signaling pathways.
  • the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the cell further comprises an inducible cell death moiety capable of effecting death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and the cell death activator is AP1903.
  • the present disclosure provides a nucleic acid molecule comprising a first sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises a binding moiety, which binding moiety comprises (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject linked to (ii) a second antigen binding domain capable of binding to a disease-associated antigen, and wherein each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain.
  • CAR chimeric antigen receptor
  • the first antigen binding domain binds to an antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • an antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56,
  • the second antigen binding domain binds to CD19, CD2, CD3, CD4, CD5, CD7, CD8, CD19, CD20, CD22, CD25, CD28, CD30, CD33, CD38, CD40, CD44V6, CD47, CD52, CD56, CD57, CD58, CD79b, CD80, CD86, CD81, CD123, CD133, CD137, CD151, CD171, CD276, CLL1, B7H4, BCMA, VEGFR-2, EGFR, GPC3, PMSA, CEACAM6, c-Met, EGFRvIII, ErbB2/HER2, ErbB3, HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, Flt3, CEA, CA125, CTLA-4, GITR, BTLA, TGFBR1, TGFBR2, TGFBR1, IL6
  • the nucleic acid molecule further comprises a second sequence encoding an enhancer moiety, which enhancer moiety enhances one or more activities of the CAR when expressed in a cell.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the nucleic acid molecule further comprises a second sequence encoding an inducible cell death moiety, which inducible cell death moiety, when expressed in a cell, effects death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ⁇ CD20, mTMPK, ⁇ CD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the nucleic acid molecule further comprises a third sequence flanked by the first sequence and the second sequence, wherein the third sequence encodes a cleavable linker.
  • the cleavable linker is a self-cleaving peptide.
  • the nucleic acid molecule further comprises a regulatory sequence regulating expression of the first sequence and/or the second sequence.
  • the present disclosure provides a kit comprising a nucleic acid molecule described herein.
  • the present disclosure provides a method of generating an engineered cell, comprising (a) delivering the nucleic acid molecule described herein into a cell; and (b) expressing the nucleic acid molecule in the cell, thereby generating the engineered cell.
  • the present disclosure provides an engineered immune cell, comprising: an enhancer moiety capable of enhancing one or more activities of the engineered immune cell; a chimeric antigen receptor (CAR) comprising an antigen binding domain that specifically binds CD7, wherein the CAR further comprises a transmembrane domain and an intracellular signaling domain; wherein an endogenous CD7 in the engineered immune cell is inactivated.
  • an enhancer moiety capable of enhancing one or more activities of the engineered immune cell
  • a chimeric antigen receptor (CAR) comprising an antigen binding domain that specifically binds CD7, wherein the CAR further comprises a transmembrane domain and an intracellular signaling domain; wherein an endogenous CD7 in the engineered immune cell is inactivated.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, PD-1, PD-L1, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, and TGFR beta, receptors for the same, and a combination thereof.
  • an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated.
  • the engineered immune cell further comprises a polypeptide that comprises an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the polypeptide with a cell death activator.
  • the enhancer moiety is part of the polypeptide.
  • the enhancer moiety is not a part of the CAR. In some embodiments, the enhancer moiety is a part of the CAR. In some embodiments, the engineered immune cell is a T cell, an NKT cell or an NK cell. In some embodiments, the engineered immune cell is derived from a stem cell. In some embodiments, the stem cell is a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC). In some embodiments, the engineered immune cell is an autologous cell or an allogeneic cell. In some embodiments, the engineered immune cell is obtained from a subject having a condition. In some embodiments, the engineered immune cell is obtained from a healthy donor.
  • HSC hematopoietic stem cell
  • iPSC induced pluripotent stem cell
  • the present disclosure provides a method of generating the engineered immune cell described herein, comprising (a) delivering one or more nucleic acid molecules encoding (i) the enhancer moiety and (ii) the CAR in to an immune cell; and (b) expressing the one or more nucleic acid molecules in the immune cell, thereby generating the engineered immune cell.
  • a single nucleic acid molecule encodes (i) the enhancer moiety and (ii) the CAR.
  • the single nucleic acid molecule comprises a self-cleaving peptide flanked by (i) the enhancer moiety and (ii) the CAR.
  • the single nucleic acid molecule does not comprise any self-cleaving peptide flanked by (i) the enhancer moiety and (ii) the CAR.
  • (i) a first nucleic acid molecule encodes the enhancer moiety and (ii) a second nucleic acid molecule encodes the CAR.
  • the present disclosure provides a method of treating or diagnosing a condition in a subject, comprising administering the engineered immune cell described herein to the subject.
  • the engineered immune cell is derived from an autologous immune cell of the subject.
  • the engineered immune cell is derived from an allogeneic immune cell.
  • the condition is cancer (e.g., T cell and/or NK cell malignancies).
  • the present disclosure provides an engineered immune cell, comprising: a single chimeric antigen receptor (CAR) comprising (i) a first antigen binding domain that specifically binds CD7 and (ii) a second antigen binding domain capable of binding to a disease-associated antigen, the CAR further comprises a transmembrane domain and an intracellular signaling domain, wherein a gene encoding endogenous CD7 is inactivated in the engineered immune cell.
  • the engineered immune further comprises an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, PD-1, PD-L1, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, and TGFR beta, receptors for the same, and a combination thereof.
  • an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated.
  • the engineered immune cell further comprises a polypeptide that comprises an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the polypeptide with a cell death activator.
  • the enhancer moiety is part of the polypeptide.
  • the engineered immune cell is a T cell, an NKT cell or an NK cell. In some embodiments, the engineered immune cell is derived from a stem cell. In some embodiments, the stem cell is a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC). In some embodiments, the engineered immune cell is an autologous cell or an allogeneic cell. In some embodiments, the engineered immune cell is obtained from a subject having a condition. In some embodiments, the engineered immune cell is obtained from a healthy donor.
  • HSC hematopoietic stem cell
  • iPSC induced pluripotent stem cell
  • the present disclosure provides a method of generating the engineered immune cell, comprising (a) delivering one or more nucleic acid molecules encoding the single CAR into an immune cell; and (b) expressing the one or more nucleic acid molecules in the immune cell, thereby generating the engineered immune cell.
  • a single nucleic acid molecule encodes the single CAR.
  • the present disclosure provides a method of treating or diagnosing a condition in a subject, comprising administering the engineered immune cell to the subject.
  • the engineered immune cell is derived from an autologous immune cell of the subject.
  • the engineered immune cell is derived from an allogeneic immune cell.
  • the condition is cancer (e.g., T cell and/or NK cell malignancies).
  • the present disclosure provides a method of delivering an allogeneic cell therapy comprising: administering to a subject in need thereof a population of engineered immune cells, an individual engineered immune cell of the population comprises: (a) one or more chimeric antigen receptors (CARs) comprising a binding moiety, wherein the binding moiety comprises a first antigen binding domain capable of binding to an immune cell antigen and a second antigen binding domain capable of binding to a disease-associated antigen, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject; (b) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, wherein an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated, and wherein the engineered immune cell exhibits (i) enhanced degree of persistence by remaining viable in vitro for at least about 20 days while in presence of cells that are heterologous to the engineered immune cell, (ii) enhanced degree of expansion by
  • the administering of the population of the engineered immune cells alone without the use of an additional proliferation agent yields (i) enhanced degree of persistence by remaining viable in vitro for at least about 20 days while in presence of immune cells that are heterologous to the engineered immune cell, (ii) enhanced degree of expansion by at least about 10-fold within 15 days, or (iii) enhanced cytotoxicity against a target cell comprising the immune cell antigen or the disease-associated antigen.
  • each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain, wherein the first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject.
  • an endogenous CD7 of the individual engineered immune cell is inactivated.
  • the immune cell antigen is CD7.
  • the enhancer moiety is configured to constitutively enhance the one or more activities of the individual engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell. In some embodiments, the one or more intracellular signaling pathways are one or more cytokine signaling pathways. In some embodiments, the enhancer moiety is self-activating through self-oligomerizing. In some embodiments, the enhancer moiety is self-activating through self-dimerizing. In some embodiments, the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • a gene encoding a subunit of the endogenous TCR is inactivated such that the endogenous TCR is inactivated.
  • the gene encoding the subunit is TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the individual engineered immune cell further comprises an inducible cell death moiety, which inducible cell death moiety effects suicide of the engineered immune cell upon contact with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK
  • the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9
  • the cell death activator is AP1903.
  • the cell death activator comprises a nucleic acid, a polynucleotide, an amino acid, a polypeptide, lipid, a carbohydrate, a small molecule, an enzyme, a ribosome, a proteasome, a variant thereof, or any combination thereof.
  • expression of one or more endogenous human leukocyte antigen (HLA) genes of the individual engineered immune cell remains intact. In some embodiments, expression of endogenous HLA-I and/or HLA-II genes of the individual engineered immune cell remains intact. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the individual engineered immune cell remains intact. In some embodiments, expression of one or more endogenous HLA genes of the individual engineered immune cell is upregulated. In some embodiments, expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the individual engineered immune cell is upregulated.
  • expression of an endogenous HLA-I, an endogenous HLA-II, or both of the individual engineered immune cell is inhibited.
  • a gene encoding endogenous HLA-I, endogenous HLA-II, or both is inactivated.
  • HLA-E or HLA-G of the engineered immune cell is overexpressed.
  • CD24, CD47, FASL and/or PD-1 of the engineered immune cell is overexpressed.
  • the disease-associated antigen is a tumor-associated antigen.
  • the first antigen binding domain or the second antigen binding domain is a scFv.
  • the individual engineered immune cell is a T cell, an NKT cell or an NK cell.
  • the individual engineered immune cell is derived from a stem cell.
  • the stem cell is a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC).
  • the individual engineered immune cell is an allogeneic cell.
  • the individual engineered immune cell is obtained from a healthy donor.
  • the present disclosure provides a cell comprising: (a) one or more chimeric antigen receptors (CARs) comprising a binding moiety, wherein the binding moiety comprises an antigen binding domain capable of binding to an immune cell antigen, and wherein each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain; and (b) an enhancer moiety capable of enhancing one or more activities of the cell, wherein an endogenous T cell receptor (TCR) of the cell is inactivated.
  • CARs chimeric antigen receptors
  • the enhancer moiety enhances one or more activities of the cell. In some embodiments, the enhancer moiety is configured to constitutively enhance the one or more activities of the cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the cell. In some embodiments, the one or more intracellular signaling pathways are one or more cytokine signaling pathways. In some embodiments, the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the method further comprises an inducible cell death moiety capable of effecting death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and the cell death activator is AP1903.
  • a gene encoding an endogenous surface marker of the cell is inactivated, wherein the endogenous surface marker is capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker is CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the present disclosure provides a method for treating a lymphoid malignancy, comprising administering to a patient in need thereof a population of engineered immune cells, wherein an individual engineered immune cell of the population comprises: (a) one or more chimeric antigen receptors (CARs) comprising a binding moiety, wherein the binding moiety comprises an antigen binding domain capable of binding to an immune cell antigen, and wherein each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain; and (b) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, wherein an endogenous T cell receptor (TCR) of the engineered immune cell is inactivated, wherein (i) the number of affected cells in peripheral blood or the number of affected cells in bone marrow is reduced by at least 50% within 3 weeks after a last dosing of the engineered immune cells, and (ii) the number of any one or more of autologous T cell, granulocyte,
  • the enhancer moiety enhances one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively enhance the one or more activities of the engineered immune cell. In some embodiments, the enhancer moiety is configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell. In some embodiments, the one or more intracellular signaling pathways are one or more cytokine signaling pathways. In some embodiments, the enhancer moiety is a cytokine or a cytokine receptor.
  • the enhancer moiety is selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the engineered immune cell further comprises an inducible cell death moiety capable of effecting death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety is selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and the cell death activator is AP1903.
  • a gene encoding an endogenous surface marker of the cell is inactivated, wherein the endogenous surface marker is capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker is CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the number of any one or more of autologous T cell, granulocyte, and NK cell in peripheral blood starts to increase before the number of affected cells in peripheral blood or the number of affected cells in bone marrow is reduced by at least 50%. In some embodiments, the number of any one or more of autologous T cell, granulocyte, and NK cell in peripheral blood starts to increase after the number of affected cells in peripheral blood or the number of affected cells in bone marrow is reduced by at least 50%.
  • FIG. 1 illustrates an example structure of EGFRt-CD3-CD19 CAR.
  • FIG. 2 illustrates an example preparation process of EGFRt-CD3-CD19 universal CAR-T.
  • FIG. 3 illustrates expression of Parallel CAR (FMC63-OKT3) and the tEGFR switch.
  • FIG. 4 illustrates expression of Parallel and Loop CARs.
  • FIGS. 5A-C illustrate experimental data comparing the UCHT1 vs OKT3.
  • FIGS. 6A-C illustrate the anti-cancer function of parallel-UCHT1.
  • FIGS. 7A and 7B illustrate experimental data comparing the anti-cancer function of parallel CAR vs Loop CAR.
  • FIGS. 8A and 8B illustrate that TCR KO CD19 CAR-T cell showed a proliferation defect in subcutaneous tumor model.
  • 5e5 Raji-luciferase cells were grafted into NOG mice by subcutaneous injection.
  • 1e6 WT TCR KO CD19 CAR-T cells were infused (IV) into Raji grafted mice.
  • Tumor burden was assessed by caliper measurements of the actual tumor sizes.
  • subcutaneous model generates solid tumors and has much higher requirements on CAR-T cell proliferation for controlling the tumors than intravenous model.
  • TCR KO CAR-T cells showed a proliferation defects compared to WT CAR-T cells, consistent with their tumor control effects.
  • FIGS. 9A-C illustrate proliferation and killing efficacy of CAR-T cells with different enhancers after multiple rounds of stimulation by cancer cells.
  • FIGS. 10A and 10B illustrate the proliferation of CAR-T cells with different enhancers after multiple rounds of stimulation by cancer cells.
  • FIG. 11 illustrates In vivo comparison of enhancers in TCR KO CD19 CAR-T cells.
  • 5e5 Raji-luciferase cells were grafted into NOG mice by intravenous (IV) injection.
  • WT, TCR KO CD19 CAR-T cells with/without enhancers were infused (IV) into Raji grafted mice. Tumor burden was assessed by bioluminescence intensity (BLI).
  • FIG. 12 illustrates in vivo comparison of enhancers in TCR KO CD19 CAR-T cells.
  • FIG. 13 illustrates an example tissue distribution of CD7 mRNA.
  • FIG. 14 illustrates an example tissue distribution of CD2 mRNA.
  • FIG. 15 illustrates an example preparation of CD7 CAR-T.
  • FIG. 16 illustrates an experimental data of CD7 gRNA screening.
  • FIG. 17 illustrates example structures of CAR7, CAR7-mb15 and CAR7-C7R.
  • FIG. 18 illustrates experimental data of CAR expression of CAR7, CAR7-mb15, CAR7-C7R and control CAR19, expression of IL15Ra and CD34, and the knockout efficiency of CD7 and CD3.
  • FIG. 19 illustrates experimental data of the activation of STAT5 in UCAR-T cells. Adding IL-2 activated the STAT5 of CAR7 T cells and remove of IL-2 significantly decreased pSTAT5 level. In CAR7-C7R, the level of pSTAT5 was at high level with or without exogenous IL-2.
  • FIG. 20 illustrates experimental data of the killing effect of UCAR-T cells on CCRF-CEM-luc cell line.
  • FIG. 21 illustrates experimental data of the killing effect of UCAR-T cells on alloreactive T (allo-T) cells.
  • FIG. 22 illustrates the killing effect of UCAR-T cells on NK92 cell line in 24 hours.
  • FIG. 23A illustrates experimental data of in vitro expansion of several UCAR-T cells, where the UCAR-T cells expressing enhancers survived longer.
  • FIG. 23B illustrates experimental data of comparison of their killing effects on CCRF-CEM tumor cells after removing IL-2.
  • FIG. 24A illustrates experimental data of in vitro expansion of several UCAR-T cells.
  • FIG. 24B illustrates experimental data of comparison of their killing effects on CCRF-CEM tumor cells after removing IL-2 and co-culturing with CCRF-CEM for multiple rounds, where the UCAR-T cells expressing enhancers showed stronger expansion under the stimulation of tumor antigens.
  • FIG. 25 illustrates experimental data of expansion of UCAR-T cells expressing enhancers in immuno-deficient mice carrying CCRF-CEM tumor.
  • FIG. 26 illustrates experimental data of the killing effect of UCAR-T cells expressing enhancers on CCRF-CEM tumor in mice.
  • FIG. 27 illustrates in vivo comparison of enhancers in TCR KO CD7 CAR-T cells.
  • FIGS. 28A and 28B illustrate in vivo comparison of enhancers in TCR KO CD7 CAR-T cells.
  • FIG. 29 illustrates an example structure of RQR8-CD19CAR-MBIL15, RQR8-CD19CAR-MBIL15-IL7, RQR8-CD19CAR-C7R and RQR8-CD19CAR-MBIL7.
  • FIG. 30 illustrates a design of E3: constitutive active IL7R ⁇ based enhancer+safety switch.
  • FIG. 31 illustrates expression of CAR and the enhancer.
  • FIGS. 32A and 32B illustrate test of CAR-T function.
  • FIGS. 33A and 33B illustrate test of enhancer function.
  • FIGS. 34A-C illustrate test of enhancer function.
  • FIGS. 35A-C illustrate test of safety switch by ADCC.
  • FIGS. 36A and 36B illustrate test of safety switch by ADCC after repeat stimulations.
  • FIG. 37 illustrates examples of the design of CD7-CD19 dual CARs.
  • L719 represents Loop-CAR
  • LHLH VLVH-VLVH
  • HLHL VHVL-VHVL
  • T197 and T719 are Tandem-CARs
  • EAAAK is the linker (SEQ ID NO: 92) between two LH.
  • SP signaling peptide
  • H hinge
  • TM transmembrane domain.
  • FIGS. 38A and 38B illustrate an experimental data of the expression of CD7 single CARs constructed with scFvs of different antibodies and the knockout efficiencies of CD7/CD3 (TRAC) ( FIG. 38A ), as well as the killing effects of CARs on CD7+ cells ( FIG. 38B ).
  • LH represents VLVH
  • HL represents VHVL.
  • FIG. 39 illustrates experimental data of the expressions of Loop-CARs and Tandem-CARs.
  • CAR7 and CAR19 are single CAR controls, and Mock T is negative control.
  • FIG. 40 illustrates experimental data of the knockout efficiencies of CD7 and CD3 (TRAC) and clearances of CD7+ cells by CARs.
  • FIG. 41 illustrates experimental data of the clearance of HeLa-CD19+ cells by Loop-CARs and Tandem CARs.
  • FIGS. 42A and 42B illustrate experimental data of the complete killing of NK by CD7 single CAR and CD7-CD19 dual CARs.
  • FIG. 42A shows the experimental data of the clearance efficiencies of in vitro expanded peripheral blood NK by different CARs.
  • FIG. 42B illustrates experimental data of the in vitro expanded NK comprises ⁇ 80% CD7+ cells; after killing by L719-LHLH and T197-LHLH, the remaining NK cells are CD7-cells.
  • FIG. 43 illustrates experimental data of the rapid killing of allogeneic T cells by CD7 single CAR and CD7-CD19 dual CARs.
  • FIG. 44 illustrates experimental data of the in vivo functions of dual CARs. Loop CARs and Tandem CARs both showed potent killing effects on Raji tumor cells.
  • FIGS. 45A and 45B illustrate experimental data comparing two Tandem CARs.
  • FIG. 45A shows experimental data using L719: L719-LHLH as a standard control for screening, and CAR7, CAR19 and Mock T as other controls.
  • FIG. 45B shows experimental data of the clearance of the remaining CD7+ cells by different CARs after CD7 knockout.
  • FIG. 46 illustrates experimental data of the two Tandem CARs showing similar clearance effects on HeLa-CD19+ cells as L719.
  • FIGS. 47A and 47 B illustrate experimental data of the two Tandem CARs showing similar clearance effects on allogeneic T cells ( FIG. 47A ) and NK cells ( FIG. 47B ) as L719.
  • FIG. 48 illustrates experimental data of the in vivo functional screening of dual CARs. Both Loop and Tandem dual CARs showed potent killing effects on CCRF-CEM tumor cells in vivo.
  • FIG. 49 illustrates the structure of rapaC, L719-C7R, and L719-E3.
  • FIGS. 50A-J illustrate experimental data of the effects of cytokine signaling on the functions of dual CARs.
  • FIG. 50A illustrates experimental data of the expressions of L719 and L719-C7R dual CARs.
  • FIG. 50B illustrates experimental data of the killing effects of dual CARs on HeLa-CD7+ cells.
  • FIG. 50C illustrates experimental data of the killing effects of dual CARs on HeLa-CD19+ cells.
  • FIG. 50D illustrates experimental data of the expressions of enhancer and CD7 in L718 dual CAR-T cells.
  • FIG. 50E illustrates experimental data of cytotoxicity of L719 dual CAR-T cells.
  • FIG. 50F illustrates experimental data of cytotoxicity of L719 dual CAR-T cells.
  • FIG. 50A illustrates experimental data of the expressions of L719 and L719-C7R dual CARs.
  • FIG. 50B illustrates experimental data of the killing effects of dual CARs on HeLa-CD7+
  • FIG. 50G illustrates experimental data of the expressions of phosphorylated STAT5 and the enhancer in L719 dual CAR-T cells.
  • FIG. 50H illustrates experimental data of L719 dual CAR-T cell proliferation.
  • FIG. 50I illustrates experimental data of the killing effects of dual CARs on HeLa-CD19+ cells.
  • FIG. 50J illustrates experimental data of the killing effects of dual CARs on HeLa-CD7+ cells.
  • FIG. 51 illustrates an example tissue distribution of CD137 mRNA.
  • FIG. 52 illustrates an example structural diagram of CD137-CD19 AAC/CAR.
  • FIG. 53 illustrates an example preparing process of CD137-CD19 universal CAR-T.
  • FIGS. 54A-C illustrate experimental data showing defects in cell expansion of TCR knockout autologous CAR-T cells.
  • FIG. 54A illustrates FACS data showing fraction of TCR+ cells pre- and post-infusion.
  • FIG. 54B illustrates bar-graph of the FACS data in FIG. 54A .
  • FIG. 54C illustrates comparison of expansion differences of CAR-T cells with or without TCRs.
  • FIGS. 55A and 55B illustrate experimental data showing effects of C7R on TCR knockout (KO) CD7 CAR-T cells (e.g., a CAR-T cell having a CAR targeting CD7, also referred to as UCART7 cells or CAR7 cells) expansion and persistence.
  • FIG. 55A illustrates TCR KO CD7 CAR-T expansion data with or without enhancer C7R.
  • FIG. 55B illustrates proliferation data of TCR KO CD7 CAR-T cells with or without enhancer.
  • FIGS. 56A-E illustrate experimental data showing STAT5 phosphorylation, cell persistence and cytotoxicity of TCR KO CD7 CAR-T cells expressing enhancer C7R or E3 (EGFRt+IL7Ra).
  • FIG. 56A illustrates experimental data of fraction of CAR-T cells expressing enhancer.
  • FIG. 56B illustrates cytotoxicity of TCR KO CD7 CAR-T cells.
  • FIG. 56C illustrates proliferation data of CAR-T cells in the absence of IL2.
  • FIG. 56D illustrates experimental data of fractions of CAR-T cells expressing enhancer and having phosphorylated STAT5.
  • FIG. 56E illustrates a bar graph of mean fluorescent index (MFI) of phosphorylated STAT5 of FIG. 56D .
  • MFI mean fluorescent index
  • FIGS. 57A and 57B illustrate experimental data showing expansion and persistence of UCAR-T GC197 cells (e.g., multi-specific CAR-T cells having CARs targeting both CD19 and CD7).
  • FIG. 57A illustrates proliferation data of UCAR-T GC197 cells expressing enhancer C7R from two different donors in the presence of cancer antigen stimulation.
  • FIG. 57B illustrates proliferation data of UCAR-T GC197 cells expressing enhancer C7R in the absence of IL2 or antigen stimulation.
  • FIGS. 58A-C illustrate experimental data showing expansion and persistence of UCAR-T GC197 cells.
  • FIG. 58A illustrates experimental data showing fractions of CAR-T cells expressing CD7 and the enhancer C7R or E3 (EGFRt+IL7Ra).
  • FIG. 58B illustrates proliferation data of UCAR-T GC197 cells expressing enhancer C7R or E3 (EGFRt+IL7Ra).
  • FIG. 58C illustrates proliferation data of UCAR-T GC197 cells expressing enhancer C7R or E3 (EGFRt+IL7R ⁇ ) in the presence of cancer antigen stimulation.
  • FIGS. 59A and 59B illustrate experimental data of K562-CAR19 profiling and natural killer (NK) cell killing assay.
  • FIG. 59A illustrates experimental data of fractions of K562 cells expressing CAR (e.g., CAR19 or CAR targeting CD19) and enhancer CD47 or E4 (CD47+IL7R ⁇ ).
  • FIG. 59B illustrates experimental data of cytotoxicity of NK cells toward K562-CAR19 expressing the enhancer CD47 or E4 (CD47+IL7R ⁇ ).
  • FIGS. 60A and 60B illustrate experimental data showing STAT5 phosphorylation and cell persistence of UCART19 cells (e.g., CAR-T cells having CARs targeting CD19, also referred to as CD19 CAR-T cells or CAR19 cells).
  • FIG. 60A illustrates experimental data of fractions of TCR KO CAR19 cells having phosphorylated STAT5 and CAR19.
  • FIG. 60B illustrates proliferation data of TCR KO CD19 CAR expressing enhancer C7R, CD47 or E4 (CD47+IL7R ⁇ ).
  • FIGS. 61A and 62B illustrate safety switch function of E2 and E3 in L719 cells.
  • FIG. 61A illustrates safety switch function of E3 in L719-E3 cells.
  • FIG. 61B illustrates safety switch function of E2 in L719-E2 cells.
  • FIGS. 62A and 62B illustrate safety switch function of E3 tested in CAR7-E3 and L719-E3 by Complement dependent cytotoxicity assay (CDC assay).
  • FIG. 62A illustrates safety switch function of E3 tested in CAR7-E3 cells.
  • FIG. 62B illustrates safety switch function of E3 tested in L719-E3 cells.
  • FIGS. 63A and 63B illustrate expression of IL2 and IFN ⁇ in TCR/CD7 double knockout CAR7 cells with no cytokine signaling enhancement, or with mbIL15, C7R, or E3 expression.
  • FIG. 63A illustrates expression of IL2 in TCR/CD7 double knockout CAR7 cells with no cytokine signaling enhancement, or with mbIL15, C7R, or E3 expression.
  • FIG. 63B illustrates IFN ⁇ in TCR/CD7 double knockout CAR7 cells with no cytokine signaling enhancement, or with mbIL15, C7R, or E3 expression.
  • FIG. 64 illustrates expression of IL2 and IFN ⁇ in TCR/CD7 double knockout CD19/CD7 dual CAR-L719 cells with no cytokine signaling enhancement, or with C7R, or E3 expression.
  • FIG. 65 illustrates CD2 gRNA screening.
  • FIGS. 66A-C illustrate the in vivo GvHD study comparing CD19 CAR-T vs TCR KO CD19 CAR-T cells.
  • FIG. 66A illustrates the in vivo GvHD study of CD19 CAR-T.
  • FIG. 66B illustrates the in vivo GvHD study of TCR KO CD19 CAR-T cells.
  • FIG. 66C illustrates the in vivo GvHD study comparing CD19 CAR-T vs TCR KO CD19 CAR-T cells.
  • FIGS. 67A-E illustrate the clinical data of CAR7-C7R for treating T-acute lymphoblastic leukemia (T-ALL) patients.
  • FIG. 67A shows the kinetics of T-ALL elimination in the peripheral blood.
  • FIG. 67B shows the CAR7-C7Rcell concentration in the peripheral blood.
  • FIG. 67C shows CAR7-C7R DNA copy/ug DNA of peripheral blood cells.
  • FIG. 67D shows the granulocyte and lymphocyte (T and NK cells) recovery in the bone marrow.
  • FIG. 67E shows the granulocyte and lymphocyte (T and NK cells) recovery in peripheral blood.
  • FIG. 68 illustrates BLI imaging of the in vivo efficacy of CAR7 and CAR7-E3 UCAR-T cells.
  • FIG. 69 illustrates BLI imaging of the in vivo efficacy of L719 and L719-C7R UCAR-T cells.
  • administering refers to physically introducing a product of the present disclosure into a subject using any of a variety of methods and delivery systems, including intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other routes of parenteral administration, for example by injection or infusion.
  • an antigen refers to a molecule or a fragment thereof capable of being bound by a selective binding agent.
  • an antigen can be a ligand that can be bound by a selective binding agent such as a receptor.
  • an antigen can be an antigenic molecule that can be bound by a selective binding agent such as an immunological protein (e.g., an antibody).
  • An antigen can also refer to a molecule or fragment thereof capable of being used in an animal to produce antibodies capable of binding to that antigen.
  • an antigen may be bound to a substrate (e.g., a cell membrane). Alternatively, an antigen may not be bound to a substrate (e.g., a secreted molecule, such as a secreted polypeptide).
  • antibody (Ab) include, but is not limited to, an immunoglobulin that specifically binds to an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds, or an antigen thereof.
  • Each H chain comprises a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region comprises three constant domains CH1, CH2 and CH3.
  • Each light chain comprises a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region comprises a constant domain CL.
  • VH and VL regions can be further subdivided into hypervariable regions called complementarity determining regions (CDRs) interspersed with more conserved regions called framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • Each VH and VL contains three CDRs and four FRs, arranged from the amino terminus to the carboxy terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with the antigen.
  • nucleotide generally refers to a base-sugar-phosphate combination.
  • a nucleotide can comprise a synthetic nucleotide.
  • a nucleotide can comprise a synthetic nucleotide analog.
  • Nucleotides can be monomeric units of a nucleic acid sequence (e.g. deoxyribonucleic acid (DNA) and ribonucleic acid (RNA)).
  • nucleotide can include ribonucleoside triphosphates adenosine triphosphate (ATP), uridine triphosphate (UTP), cytosine triphosphate (CTP), guanosine triphosphate (GTP) and deoxyribonucleoside triphosphates such as dATP, dCTP, dITP, dUTP, dGTP, dTTP, or derivatives thereof.
  • Such derivatives can include, for example, [aS]dATP, 7-deaza-dGTP and 7-deaza-dATP, and nucleotide derivatives that confer nuclease resistance on the nucleic acid molecule containing them.
  • nucleotide as used herein can refer to dideoxyribonucleoside triphosphates (ddNTPs) and their derivatives.
  • ddNTPs dideoxyribonucleoside triphosphates
  • Illustrative examples of dideoxyribonucleoside triphosphates can include, but are not limited to, ddATP, ddCTP, ddGTP, ddITP, and ddTTP.
  • a nucleotide can be unlabeled or detectably labeled by well-known techniques. Labeling can also be carried out with quantum dots. Detectable labels can include, for example, radioactive isotopes, fluorescent labels, chemiluminescent labels, bioluminescent labels and enzyme labels.
  • Fluorescent labels of nucleotides can include but are not limited fluorescein, 5-carboxyfluorescein (FAM), 2′7′-dimethoxy-4′5-dichloro-6-carboxyfluorescein (JOE), rhodamine, 6-carboxyrhodamine (R6G), N,N,N′,N′-tetramethyl-6-carboxyrhodamine (TAMRA), 6-carboxy-X-rhodamine (ROX), 4-(4′dimethylaminophenylazo) benzoic acid (DABCYL), Cascade Blue, Oregon Green, Texas Red, Cyanine and 5-(2′-aminoethyl)aminonaphthalene-1-sulfonic acid (EDANS).
  • FAM 5-carboxyfluorescein
  • JE 2′7′-dimethoxy-4′5-dichloro-6-carboxyfluorescein
  • rhodamine 6-carboxy
  • fluorescently labeled nucleotides can include [R6G]dUTP, [TAMRA]dUTP, [R110]dCTP, [R6G]dCTP, [TAMRA]dCTP, [JOE]ddATP, [R6G]ddATP, [FAM]ddCTP, [R110]ddCTP, [TAMRA]ddGTP, [ROX]ddTTP, [dR6G]ddATP, [dR110]ddCTP, [dTAMRA]ddGTP, and [dROX]ddTTP available from Perkin Elmer, Foster City, Calif., FluoroLink DeoxyNucleotides, FluoroLink Cy3-dCTP, FluoroLink Cy5-dCTP, FluoroLink Fluor X-dCTP, FluoroLink Cy3-dUTP, and FluoroLink Cy5-dUTP available from Amersham, Arlington Heights, Ill.; Fluorescein-15-
  • Nucleotides can also be labeled or marked by chemical modification.
  • a chemically-modified single nucleotide can be biotin-dNTP.
  • biotinylated dNTPs can include, biotin-dATP (e.g., bio-N6-ddATP, biotin-14-dATP), biotin-dCTP (e.g., biotin-11-dCTP, biotin-14-dCTP), and biotin-dUTP (e.g. biotin-11-dUTP, biotin-16-dUTP, biotin-20-dUTP).
  • polynucleotide oligonucleotide
  • nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof, either in single-, double-, or multi-stranded form.
  • a polynucleotide can be exogenous or endogenous to a cell.
  • a polynucleotide can exist in a cell-free environment.
  • a polynucleotide can be a gene or fragment thereof.
  • a polynucleotide can be DNA.
  • a polynucleotide can be RNA.
  • a polynucleotide can have any three dimensional structure, and can perform any function, known or unknown.
  • a polynucleotide can comprise one or more analogs (e.g. altered backbone, sugar, or nucleobase). If present, modifications to the nucleotide structure can be imparted before or after assembly of the polymer. Some non-limiting examples of analogs include: 5-bromouracil, peptide nucleic acid, xeno nucleic acid, morpholinos, locked nucleic acids, glycol nucleic acids, threose nucleic acids, dideoxynucleotides, cordycepin, 7-deaza-GTP, fluorophores (e.g.
  • thiol containing nucleotides thiol containing nucleotides, biotin linked nucleotides, fluorescent base analogs, CpG islands, methyl-7-guanosine, methylated nucleotides, inosine, thiouridine, pseudourdine, dihydrouridine, queuosine, and wyosine.
  • Non-limiting examples of polynucleotides include coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, cell-free polynucleotides including cell-free DNA (cfDNA) and cell-free RNA (cfRNA), nucleic acid probes, and primers.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • genomic DNA refers to a nucleic acid (e.g., DNA such as genomic DNA and cDNA) and its corresponding nucleotide sequence that is involved in encoding an RNA transcript.
  • genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5′ and 3′ ends.
  • the term encompasses the transcribed sequences, including 5′ and 3′ untranslated regions (5′-UTR and 3′-UTR), exons and introns.
  • the transcribed region will contain “open reading frames” that encode polypeptides.
  • a “gene” comprises only the coding sequences (e.g., an “open reading frame” or “coding region”) necessary for encoding a polypeptide.
  • genes do not encode a polypeptide, for example, ribosomal RNA genes (rRNA) and transfer RNA (tRNA) genes.
  • rRNA ribosomal RNA genes
  • tRNA transfer RNA
  • the term “gene” includes not only the transcribed sequences, but in addition, also includes non-transcribed regions including upstream and downstream regulatory regions, enhancers and promoters.
  • a gene can refer to an “endogenous gene” or a native gene in its natural location in the genome of an organism.
  • a gene can refer to an “exogenous gene” or a non-native gene.
  • a non-native gene can refer to a gene not normally found in the host organism but which is introduced into the host organism by gene transfer.
  • a non-native gene can also refer to a gene not in its natural location in the genome of an organism.
  • a non-native gene can also refer to a naturally occurring nucleic acid or polypeptide sequence that comprises mutations, insertions and/or deletions (e.g., non-native sequence).
  • endogenous refers to a nucleic acid molecule or polypeptide normally expressed in a cell or tissue.
  • exogenous refers to the nucleic acid molecule or polypeptide is not endogenously present in the cell or is present at a level sufficient to achieve the functional effects obtained upon overexpression.
  • exogenous includes any recombinant nucleic acid molecule or polypeptide expressed in a cell, e.g., a foreign, heterologous, and overexpressed nucleic acid molecule and polypeptide.
  • T cell and NK cell consensus marker refers to a marker co-existing on T cells and NK cells, including but not limited to: CD2, CD7, CD38, CD45, CD48, CD50, CD52, CD56, CD69, CD100, CD122, CD132, CD161, CD159a, CD159c, CD314.
  • marker of T cells and/or NK cells refers to markers present in T cells or NK cells, respectively, or both T cells and NK cells, including but not limited to: CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD160, CD161 CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, SLAMF7.
  • the term “functionally inactivate” or “functional inactivation” as used herein refers to that a functional gene or the product of the gene such as mRNA or protein is prevented or inhibited.
  • the inactivation may be achieved by deletion, addition or substitution of the gene or the promoter thereof, so that expression does not occur, or mutation of the coding sequence of the gene so that the gene product such as mRNA or protein is inactive.
  • the functional inactivation may be complete or partial. Inactivation of a gene can encompass all degrees of inactivation, including gene silencing, knockout, inhibition and disruption.
  • the functional inactivation is introduced by CRISPR-Cas9 system.
  • subject refers to a vertebrate, preferably a mammal such as a human.
  • Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.
  • treatment refers to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit.
  • a treatment can comprise administering a system or cell population disclosed herein.
  • therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more conditions (e.g., diseases or symptoms) under treatment.
  • a composition can be administered to a subject at risk of developing a particular condition, or to a subject reporting one or more of the physiological symptoms of a disease, even though the condition may not have yet been manifested.
  • CARs can comprise an extracellular antigen recognition region, for example, a scFv (single-chain variable fragment), a transmembrane region, and an intracellular costimulatory signal region.
  • the extracellular domain of CARs can recognize a specific antigen and then transduce the signal through the intracellular domain, causing T cell activation and proliferation, cytolysis toxicity, and secretion of cytokines, thereby eliminating target cells.
  • the patient's autologous T cells (or heterologous donors) can be first isolated, activated and genetically engineered to produce CAR-T cells, which can be then injected into the same patient. In this way, the probability of graft-versus-host disease may be reduced, and the antigen can be recognized by T cells in a non-MHC-restricted manner.
  • a CAR-T can treat all cancers that express the antigen.
  • the present disclosure provides compositions and methods to engineer a cell, e.g., an immune cell, such that it can target both disease-associated antigen (e.g., tumor-associated antigen or tumor cell marker) and immune cell antigen (e.g., CD3, CD7 or CD137) through bispecific or multivalent CAR(s).
  • a cell e.g., an immune cell
  • disease-associated antigen e.g., tumor-associated antigen or tumor cell marker
  • immune cell antigen e.g., CD3, CD7 or CD137
  • the present disclosure provides an engineered immune cell that can target a tumor cell marker and an immune cell antigen such as CD3.
  • the endogenous TCR can be inactivated (e.g., disrupted, inhibited, knocked out or silenced).
  • the CAR-T of the present disclosure which targets the tumor cell marker and the immune cell antigen can eliminate positive tumor cells and clear host immune cell antigen positive T and NK cells, thereby avoiding host rejection (HVG).
  • the endogenous TCR of the engineered immune cell can be knocked out, and graft-versus-host disease (GVHD) can be prevented, thereby preparing a general-purpose or universal CAR-T (UCAR-T) cell.
  • the engineered immune cell can be derived from an autologous T cell or an allogeneic T cell.
  • the engineered immune cell can comprise a cell suicide element (e.g., inducible cell death moiety), and the CAR-T can be inactivated/cleared at any time to reduce side effects.
  • the engineered immune cell can further comprise an enhancer moiety.
  • the enhancer moiety can regulate one or more activities of the engineered immune cell when the engineered immune cell is administered to a subject.
  • the enhancer moiety can be a cytokine (e.g., IL-5 or IL-7) or a cytokine receptor (e.g., IL-5R or IL-7R).
  • the enhancer moiety can enhance a signaling pathway within the engineered immune cell, for example, STAT5 signaling pathway.
  • the engineered immune cell comprises a bispecific CAR targeting both CD19 and CD3.
  • the engineered immune cell show in this example can further comprise an inducible cell death moiety such as a truncated epidermal growth factor receptor (EGFRt or tEGFR, which can be used interchangeably herein; see U.S. Pat. No. 9,447,194B2 and PCT Publication No. WO2018038945).
  • EGFRt truncated epidermal growth factor receptor
  • the inducible cell death moiety or the enhancer moiety can be introduced in the immune cell via a separate expression vector.
  • the inducible cell death moiety and the enhancer moiety may be introduced into the immune cell via an expression vector comprising sequences encoding both moieties.
  • the inducible cell death moiety and the enhancer moiety are linked and are expressed as a chimeric polypeptide.
  • the application of the engineered immune cells provided herein in cell therapy can treat the disease (e.g., cancer) of a patient, be prepared in large-scale in advance to avoid GVHD and HvG, reduce treatment costs, inactivate CAR-T at any time if necessary, reduce side effects of immunotherapy, and ensure product safety.
  • the engineered cells provided herein can be referred to as universal CAR T cells (UCAR-T cells).
  • the cell e.g., immune cell or engineered immune cell
  • the CAR can include an extracellular domain, a transmembrane domain, and an intracellular signaling domain.
  • the extracellular domain can include a target-specific binding element (also known as an antigen binding domain).
  • the intracellular domain can include a costimulatory signaling region and a zeta ( ⁇ ) chain portion.
  • a costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • Costimulatory molecules are cell surface molecules other than antigens receptors or their ligands that may be needed for an efficient response of lymphocytes to antigen.
  • spacer domain generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the cytoplasmic domain in the polypeptide chain.
  • a spacer domain may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • the CAR can be designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR.
  • the transmembrane domain that naturally is associated with one of the domains in the CAR is used.
  • the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions of particular use in the present disclosure may be derived from (e.g., comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD3 ⁇ , CD64, CD80, CD86, CD134, CD137, CD154, or from an immunoglobulin such as IgG4.
  • the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • a glycine-serine doublet provides a particularly suitable linker.
  • the cytoplasmic domain or otherwise the intracellular signaling domain of the CAR of the present disclosure can be responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • intracellular signaling domains for use in the CAR of the present disclosure include the cytoplasmic sequences of the TCR and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
  • T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
  • Primary cytoplasmic signaling sequences can regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary cytoplasmic signaling sequences that are of particular use in the present disclosure include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that cytoplasmic signaling molecule in the CAR of the present disclosure comprises a cytoplasmic signaling sequence derived from CD3-zeta.
  • the cytoplasmic domain of the CAR can be designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the present disclosure.
  • the cytoplasmic domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signaling region.
  • the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that may be needed for an efficient response of lymphocytes to an antigen.
  • Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • 4-1BB as the co-stimulatory signaling element
  • LFA-1 lymphocyte function-associated antigen-1
  • cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of the present disclosure may be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage.
  • a glycine-serine doublet provides a particularly suitable linker.
  • the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28. In another embodiment, the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4-1BB. In yet another embodiment, the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28 and 4-1BB.
  • a CAR provided herein can comprise one or more antigen binding domains.
  • a CAR provided herein comprises an antigen binding domain that can target both an immune cell antigen (e.g., to inhibit killing activity of a T cell or NK cell) and a disease-associated antigen (e.g., a tumor-associated antigen).
  • an antigen binding domain targeting both immune cell antigens and cancer antigens include, but not limited to, CD2, CD3, CD4, CD5, CD7, CD8, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD69, CD100, CD122, CD132, CD137, CD161, CD159a, CD159c, CD279, CD314, CD319 (CS1) and TCR.
  • a CAR provided herein comprises two antigen binding domains such that one individual CAR is a bispecific CAR, targeting two different antigens.
  • one antigen binding domain can target immune cell antigen, and the other antigen binding domain can target disease-associated antigen.
  • the two antigen binding domains of a bispecific CAR can have a tandem structure, a parallel structure or a loop structure.
  • a CAR can target a tumor cell marker and CD3.
  • the CAR can have a structure as formula I. L-scFv1-I-scFv2-H-TM-C-CD3 (I), wherein each “-” is independently a linker peptide or a peptide bond; L is optionally a signaling peptide sequence; I is a flexible linker; H is optionally a hinge region; TM is a transmembrane domain; C is a costimulatory domain; CD3 ⁇ is a cytoplasmic signaling sequence derived from CD3 ⁇ ; one of scFv1 and scFv2 is an antigen binding domain targeting a tumor cell marker, and the other one is an antigen binding domain targeting CD3.
  • the CAR can have a structure as formula II or II′: L-VL-scFv-VH-H-TM-C-CD3 ⁇ (II), L-VH-scFv-VL-H-TM-C-CD3 ⁇ ((II′), wherein each “-” is independently a linker peptide or a peptide bond; the elements L, H, TM, C and CD3 ⁇ as described above; scFv is an antigen binding domain targeting a tumor cell marker, VH is an anti-CD3 antibody heavy chain variable region, and VL is an anti-CD3 antibody light chain variable region; or scFv is an antigen binding domain targeting CD-3, VH is an anti-tumor cell marker antibody heavy chain variable region, and VL is an anti-tumor cell marker antibody light chain variable region.
  • a CAR can comprise the structure of EGFRt-CD3 scFv-CD19 scFv-Hinge-TM-CD28/41BB-CD33, wherein EGFRt is a truncated EGFR, as a safety switch (e.g., inducible cell death moiety), CD3 scFv is the svFCv fragment of the heavy and light chain variable regions of the monoclonal antibody OKT3 or UCHT1 linked by a GS linker, and the CD19 scFv fragment is the heavy and light chain variable region of the monoclonal FMC63 antibody linked by a GS linker.
  • EGFRt is a truncated EGFR
  • a safety switch e.g., inducible cell death moiety
  • CD3 scFv is the svFCv fragment of the heavy and light chain variable regions of the monoclonal antibody OKT3 or UCHT1 linked by a GS linker
  • the structure of the CAR can further comprise a hinge, transmembrane regions, costimulatory signaling region of CD28 or 41BB, and/or CD3 (intracellular domain.
  • the nucleic acid construct of EGFRt-CD3 scFv-CD19 scFv-Hinge-TM-CD28/41BB-CD3 ⁇ can be inserted into a vector (e.g., a lentiviral vector).
  • the vector can be packaged in 293T cells.
  • T cells can be sorted from PBMC, and after activation, TCR and PD-1 genes can be knocked out by CRISPR/CAS technology. T cells can then be infected with the vectors to express the CARs.
  • the prepared CAR-T cells can be used to detect the infection efficiency and gene editing efficiency of CAR by flowcytometry.
  • the immune cell marker e.g., CD3, of the above examples can be replaced with other immune cell markers such as CD7 and CD137.
  • a CAR comprising two antigen binding domains arranged in a tandem form.
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH2-VL1-VH1; (ii) VL2-VH2-VH1-VL1; (iii) VL1-VH1-VL2-VH2; (iv) VL1-VH1-VH2-VL2; (v) VH2-VL2-VL1-VH1; (vi) VH2-VL2-VH1-VL1; (vii) VH1-VL1-VL2-VH2; or (viii) VH1-VL1-VH2-VL2, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain,
  • the CAR can have a structure represented by the following formula IV or IV′: L3-scFv1-R-scFv2-H3-TM3-C3-CD3 (IV); L3-scFv2-R-scFv1-H3-TM3-C3-CD3 ⁇ ((IV′), wherein each “-” is independently a linker peptide or peptide bond; L3 is an optional signal peptide sequence; scFv1 is an antigen binding domain that targets tumor cell markers; R is a rigid or flexible joint; scFv2 is an antigen binding domain (e.g., an antibody single-chain variable region sequence) that targets T cell and NK cell consensus markers; H3 is an optional hinge region; TM3 is a transmembrane domain; C3 is a costimulatory domain; CD3 ⁇ is a cytoplasmic signaling sequence derived from CD3 ⁇ .
  • a CAR comprising two antigen binding domains arranged in a loop form.
  • the first antigen binding domain and the second antigen binding domain is arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH1-VL1-VH2; (ii) VH2-VL1-VH1-VL2; (iii) VL1-VH2-VL2-VH1; (iv) VH1-VL2-VH2-VL1; (v) VL2-VL1-VH1-VH2; (vi) VH2-VH1-VL1-VL2; (vii) VL1-VL2-VH2-VH1; or (viii) VH1-VH2-VL2-VL1, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and
  • the CAR can have the following formula VI, VI′, VI′′ or VI′′′ structure: L8-VL1-VH2-I-VL2-VH1-H8-TM8-C8-CD3 (VI); L8-VH1-VL2-I-VH2-VL1-H8-TM8-C8-CD3 ⁇ ((VI′); L8-VL2-VH1-I-VL1-VH2-H8-TM8-C8-CD3 (VI′′); L8-VH2-VL1-I-VH1-VL2-H8-TM8-C8-CD3 ⁇ (VI′′′), wherein each “-” is independently a linker peptide or peptide bond; L8 is an optional signal peptide sequence; VH1 is an anti-tumor cell marker antibody heavy chain variable region, and VL1 is an anti-tumor cell marker antibody light chain variable region; VH2 is an anti-T cell and NK cell consensus marker (such as CD7 or CD2)
  • a CAR comprising two antigen binding domains are arranged in a parallel form.
  • the parallel form can comprise a full construct of a first CAR having a first antigen binding domain linked to a full construct of a second CAR having a second antigen binding domain.
  • An example of parallel form can be tEGFR-CD19 scFv-CD28-CD3 ⁇ -CD3 scFv-41BB-CD3 ⁇ .
  • the tEGFR shown here can function as a safety switch, which can be replaced by other safety switches as described in the present disclosure.
  • CD19 scFv and CD3 scFv are two examples of antigen binding domains, which may be replaced with various antigen binding domains as described in the present disclosure.
  • CD28 can be an example of transmembrane domain and can be replaced with other transmembrane domains described herein.
  • 41BB can be an example of co-stimulatory domain and can be replaced with other co-stimulatory domains described herein.
  • a linker is used to link the first CAR and the second CAR.
  • the linker can be a cleavable linker.
  • the cleavable linker can be self-cleaving peptide such as 2A self-cleaving peptide.
  • the nucleic acid can comprise a first sequence encoding a chimeric antigen receptor (CAR), wherein the CAR can comprise a binding moiety, which binding moiety comprises (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject linked to (ii) a second antigen binding domain capable of binding to a disease-associated antigen, and wherein each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • CAR chimeric antigen receptor
  • the first antigen binding domain can target an immune cell antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • an immune cell antigen selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD
  • the second antigen binding domain can target a disease-associated antigen such as CD19.
  • disease-associated antigen includes BCMA, VEGFR2, CD19, CD20, CD30, CD22, CD25, CD28, CD30, CD33, CD52, CD56, CD80, CD86, CD81, CD123, cd171, CD276, B7H4, CD133, EGFR, GPC3; PMSA, CD 3, CEACAM6, c-Met, EGFRvIII, ErbB2, ErbB3 HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, CD44V6, CEA, CA125, CD151, CTLA-4, GITR, BTLA, TGFBR2, TGFBR1, IL6R, gp130, Lewis, TNFR1, TNFR2, PD1, PD-L1,
  • the nucleic acid molecule can further comprise a second sequence encoding an enhancer moiety, which enhancer moiety can enhance one or more activities of the CAR when expressed in a cell.
  • the enhancer moiety can be selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the nucleic acid molecule can further comprise a second sequence encoding an inducible cell death moiety, which inducible cell death moiety, when expressed in a cell, can effect death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety can be selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ⁇ CD20, mTMPK, ⁇ CD19, RQR8, and EGFRt.
  • the nuclei acid molecule can further comprise a third sequence flanked by the first sequence and the second sequence, wherein the third sequence can encode a cleavable linker.
  • the cleavable linker can be a self-cleaving peptide.
  • the nucleic acid molecule can further comprise a regulatory sequence regulating expression of the first sequence and/or the second sequence.
  • kits comprising the nucleic acid molecule described herein.
  • the nucleic acid encoding the CAR described herein can be delivered into an immune cell for expression of the CAR to generate an engineered cell.
  • the present disclosure provides an engineered cell, such as an engineered immune cell.
  • the engineered immune cell can be prepared from a cell (e.g., an immune cell) isolated from a sample obtained from a subject.
  • the engineered immune cell can be prepared from a cell line cell.
  • the immune cell used to prepare the engineered immune cell can be a T cell, a B cell, a natural killer (NK) cell or a macrophage.
  • the immune cell used to prepare the engineered immune cell can be an innate lymphocyte (ILC).
  • ILC innate lymphocyte
  • the immune cell used to prepare the engineered immune cell can be a stem cell.
  • the stem cell can be a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC).
  • HSC hematopoietic stem cell
  • iPSC induced pluripotent stem cell
  • the immune cell may comprise a T-cell receptor (TCR).
  • TCR T-cell receptor
  • the TCR can be endogenous TCR of the immune cell.
  • the endogenous TCR can be inactivated.
  • a gene encoding a subunit of the TCR can be inactivated.
  • the immune cell can be an alpha beta T cells with impaired TCRs such that the immune cells can avoid GVHD.
  • the function of the endogenous TCR can be inhibited by an inhibitor such as TCR-derived peptides, peptides derived from amino acid sequences of fusion and other protein regions of various viruses, antibodies and small molecule inhibitors.
  • the viruses from which the TCR inhibiting peptides can be derived from include, but are not limited to, severe acute respiratory syndrome coronavirus (SARS-CoV), herpesvirus saimiri (HVS), human herpesvirus 6 (HHV-6), Lassa virus (LASV), lymphocytic choriomeningitis virus (LCMV), Mopeia virus (MOPV), Tacaribe virus (TACV), Friend murine leukemia virus (MLV); human T lymphotropic virus type 1 (HTLV-1); herpesvirus ateles (HVA); Marburg virus (MARV); Sudan Ebola virus (SEBOV); and Zaire Ebola virus (ZEBOV).
  • SARS-CoV severe acute respiratory syndrome coronavirus
  • HVS herpesvirus saimiri
  • HHV-6 human herpesvirus 6
  • Lassa virus LASV
  • LCMV lymphocytic choriomeningitis virus
  • MOPV Mopeia
  • the immune cells can be T cells containing TCRs that may not cause GVHD responses.
  • the immune cell can be an alpha beta T cell with TCRs that can recognize specific antigens such as viral specific antigen, tumor-associated antigens (TAAs) or tumor-specific antigens (TSAs).
  • TAAs tumor-associated antigens
  • TSAs tumor-specific antigens
  • the immune cell can be a gamma delta T cell or a natural killer T (NKT) cell.
  • the immune cell can be induced pluripotent stem cells produced from antigen-specific T cells (e.g., antigen-specific cytotoxic T cells).
  • the immune cell can be cord-blood T cells.
  • the immune cell may comprise a cell surface marker.
  • the cell surface marker can be an immune cell antigen.
  • the gene encoding the immune cell antigen of the immune cell used for preparing the engineered immune cell can be inactivated.
  • immune cell antigens include, but are not limited to, CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the immune cells can be isolated from a sample from a subject.
  • the subject can be a healthy donor.
  • the subject can have a condition (e.g., a disease such as cancer).
  • the sample can be a bodily fluid or a tissue, including but not limited to, peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • a sample comprises NK cells, NKT cells, T-cells or T-cell progenitor cells.
  • the sample is an umbilical cord blood sample, a peripheral blood sample (e.g., a mononuclear cell fraction) or a sample from the subject comprising pluripotent cells.
  • a sample from the subject can be cultured to generate induced pluripotent stem (iPS) cells and these cells used to produce NK cells, NKT cells or T-cells.
  • Cell samples may be cultured directly from the subject or may be cryopreserved prior to use.
  • obtaining a cell sample comprises collecting a cell sample.
  • the sample is obtained by a third party.
  • a sample from a subject can be treated to purify or enrich the T-cells or T-cell progenitors in the sample.
  • the sample can be subjected to gradient purification, cell culture selection and/or cell sorting (e.g., via fluorescence-activated cell sorting (FACS)).
  • FACS fluorescence-activated cell sorting
  • the immune cell can be an NK cell.
  • the NK cells can be obtained from peripheral blood, cord-blood, or other sources described herein.
  • the NK cells can be derived from induced pluripotent stem cells.
  • a cell that can be utilized in a method provided herein can be positive or negative for a given factor.
  • a cell utilized in a method provided herein can be a CD3+ cell, CD3 ⁇ cell, a CD5+ cell, CD5 ⁇ cell, a CD7+ cell, CD7 ⁇ cell, a CD14+ cell, CD14 ⁇ cell, CD8+ cell, a CD8 ⁇ cell, a CD103+ cell, CD103 ⁇ cell, CD11b+ cell, CD11b ⁇ cell, a BDCA1+ cell, a BDCA1 ⁇ cell, an L-selectin+ cell, an L-selectin ⁇ cell, a CD25+, a CD25 ⁇ cell, a CD27+, a CD27 ⁇ cell, a CD28+ cell, CD28 ⁇ cell, a CD44+ cell, a CD44 ⁇ cell, a CD56+ cell, a CD56 ⁇ cell, a CD57+ cell, a CD57 ⁇ cell, a CD62L
  • a cell may be positive or negative for any factor known in the art.
  • a cell may be positive for two or more factors.
  • a cell may be CD4+ and CD8+.
  • a cell may be negative for two or more factors.
  • a cell may be CD25 ⁇ , CD44 ⁇ , and CD69 ⁇ .
  • a cell may be positive for one or more factors, and negative for one or more factors.
  • a cell may be CD4+ and CD8 ⁇ .
  • a cellular marker provided herein can be utilized to select, enrich, or deplete a population of cells.
  • enriching comprises selecting a monocyte fraction. In some aspects, enriching comprises sorting a population of immune cells from a monocyte fraction. In some embodiments, the cells may be selected for having or not having one or more given factors (e.g., cells may be separated based on the presence or absence of one or more factors). In some embodiments, the selected cells can also be transduced and/or expanded in vitro. The selected cells can be expanded in vitro prior to infusion. In some embodiments, selected cells can be transduced with a vector provided herein. It should be understood that cells used in any of the methods disclosed herein may be a mixture (e.g., two or more different cells) of any of the cells disclosed herein.
  • a method of the present disclosure may comprise cells, and the cells are a mixture of CD4+ cells and CD8+ cells.
  • a method of the present disclosure may comprise cells, and the cells are a mixture of CD4+ cells and na ⁇ ve cells.
  • a cell can be a stem memory TSCM cell comprised of CD45RO ( ⁇ ), CCR7(+), CD45RA (+), CD62L+(L-selectin), CD27+, CD28+ and IL-7Ra+
  • stem memory cells can also express CD95, IL-2RP, CXCR3, and LFA-1, and show numerous functional attributes distinctive of stem memory cells.
  • Cells provided herein can also be central memory TCM cells comprising L-selectin and CCR7, where the central memory cells can secrete, for example, IL-2, but not IFN ⁇ or IL-4.
  • Cells can also be effector memory TEM cells comprising L-selectin or CCR7 and produce, for example, effector cytokines such as IFN ⁇ and IL-4.
  • a population of cells can be introduced to a subject.
  • a population of cells can be a combination of T cells and NK cells.
  • a population can be a combination of na ⁇ ve cells and effector cells.
  • a population of cells can be TILs.
  • the source immune cells can be T cells.
  • the T cells can be alpha beta T cells or gamma delta T cells.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • various T cell lines may be used.
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium may lead to magnified activation.
  • a washing step may be accomplished by methods such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca2+-free, Mg2+-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
  • a specific subpopulation of T cells such as CD3+, CD28+, CD4+, CD8+, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques.
  • T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3 ⁇ 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes. In a further embodiment, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further embodiment, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred embodiment, the time period is 10 to 24 hours. In some embodiments, the incubation time period is 24 hours. For isolation of T cells from patients with leukemia, use of longer incubation times, such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells.
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process.
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • multiple rounds of selection can also be used. In certain embodiments, it may be useful to perform the selection procedure and use the “unselected” cells in the activation and expansion process. “Unselected” cells can also be subjected to further rounds of selection.
  • Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • An example method can be cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
  • T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.
  • the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
  • concentrations can result in increased cell yield, cell activation, and cell expansion.
  • use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • lower concentrations of cells may be used. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized.
  • This method can select for cells that express high amounts of desired antigens to be bound to the particles.
  • CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations.
  • the concentration of cells used is 5 ⁇ 10 6 /ml. In other embodiments, the concentration used can be from about 1 ⁇ 10 5 /ml to 1 ⁇ 10 6 /ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.
  • T cells for stimulation can also be frozen after a washing step.
  • the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to ⁇ 80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at ⁇ 20° C. or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present disclosure.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
  • the cells are isolated for a patient and frozen for later use in conjunction with (e.g., before, simultaneously or following) bone marrow or stem cell transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • the cells are isolated prior to and can be frozen for later use for treatment following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • the engineered immune cell provided herein can exhibit enhanced activity toward tumor cells, but with reduced side effects such as GVHD.
  • the engineered immune cell can target a disease-associated antigen (e.g., tumor-associated antigen, or tumor cell marker) and at the same time suppress host immune cells.
  • a disease-associated antigen e.g., tumor-associated antigen, or tumor cell marker
  • One or more endogenous genes e.g., a gene encoding a subunit of a TCR, or a gene encoding a cell surface marker
  • the engineered immune cell comprises a first CAR and a second CAR, each targeting a different antigen.
  • the engineered immune cell comprises a CAR having a first antigen binding domain and a second antigen binding domain.
  • the engineered immune cell can comprise one or more chimeric antigen receptors (CARs) comprising a binding moiety.
  • the binding moiety can comprise a first antigen binding domain capable of binding to an immune cell antigen and a second antigen binding domain capable of binding to a disease-associated antigen.
  • Each CAR of the one or more CARs may further comprise a transmembrane domain and an intracellular signaling domain.
  • the engineered immune cell can also comprise an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • the endogenous T cell receptor (TCR) of the engineered immune cell can be inactivated.
  • the engineered immune cell can exhibit (i) enhanced degree of persistence by remaining viable in vitro for at least about 20 days while in presence of cells that are heterologous to the engineered immune cell, (ii) enhanced degree of expansion by at least about 10-fold within 15 days, or (iii) enhanced cytotoxicity against a target cell comprising the immune cell antigen or the disease-associated antigen, compared to an additional engineered immune cell comprising the one or more CARs but not the enhancer moiety.
  • the engineered immune cell can be characterized by exhibiting two or more of (i) enhanced degree of persistence, (ii) enhanced degree of expansion, and (iii) enhanced cytotoxicity. The (i), (ii), and/or (iii) characteristics can be measured in absence of any exogenous enhancer moiety such as exogenous cytokines.
  • the engineered immune cell can comprise a multi-specific CAR.
  • the engineered immune cell comprises a bispecific CAR targeting an immune cell antigen and a disease-associated antigen.
  • the two antigen binding domains of the bispecific CAR can be arranged in any form as described in the present disclosure, for example, parallel form, loop form, and tandem form.
  • an engineered immune cell described herein can comprise comprising a single chimeric antigen receptor (CAR) comprising (i) a first antigen binding domain that specifically binds CD7 and (ii) a second antigen binding domain capable of binding to a disease-associated antigen.
  • the CAR can further comprise a transmembrane domain and an intracellular signaling domain.
  • a gene encoding endogenous CD7 can be inactivated (e.g., silenced or knocked out) in the engineered immune cell.
  • the immune cell antigen can be selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the immune cell antigen is CD2, CD3, CD4, CD5, CD7, CD8, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD69, CD100, CD122, CD132, CD137, CD161, CD159a, CD159c, CD279, CD314, CD319 (CS1), TCR ⁇ or TCR ⁇ .
  • the immune cell antigen is CD2, CD3, CD5, CD7, or CD137.
  • the immune cell antigen is CD7.
  • the enhancer moiety can be configured to constitutively enhance the one or more activities of the engineered immune cell.
  • the enhancer moiety can be configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell.
  • the one or more intracellular signaling pathways can be one or more cytokine signaling pathways.
  • the enhancer moiety can be self-activating through self-oligomerizing.
  • the enhancer moiety can be self-activating through self-dimerizing.
  • the enhancer moiety can be a cytokine or a cytokine receptor.
  • the enhancer moiety can be selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • a gene encoding a subunit of the endogenous TCR of the engineered immune cell can be inactivated such that the endogenous TCR is inactivated.
  • the gene encoding the subunit can be TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the engineered immune cell can further comprise an inducible cell death moiety, which inducible cell death moiety can effect suicide of the engineered immune cell upon contact with a cell death activator.
  • the inducible cell death moiety can be selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9
  • the cell death activator is AP1903.
  • the cell death activator can comprise a nucleic acid, a polynucleotide, an amino acid, a polypeptide, lipid, a carbohydrate, a small molecule, an enzyme, a ribosome, a proteasome, a variant thereof, or any combination thereof.
  • HLA human leukocyte antigen
  • the expression of one or more endogenous HLA genes of the engineered immune cell can be upregulated. In some cases, the expressions of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell are upregulated.
  • the expression of one or more endogenous HLA genes of the engineered immune cell may be knocked out or partially knocked out.
  • HLA-I, HLA-II or both can be knocked out.
  • HLA-I, HLA-2, or both can be partially knocked out.
  • HLA-I/II can be partially knockout.
  • an endogenous HLA can be knocked out to reduce T cell killing activity but keep anti-NK killer function.
  • HLA-A/B can be knocked out while keeping HLA-C/E in the engineered immune cell.
  • HLA-A, HLA-B, or both is knocked out.
  • HLA-C, HLA-E, or both remains intact.
  • a killer/phagocyte inhibitor of the engineered immune cell can be overexpressed.
  • an endogenous HLA can be knocked out with co-expression of killer/phagocyte inhibitor(s).
  • HLA-I, HLA-II, or both can be knocked out with co-expression of killer/phagocyte inhibitors.
  • the killer/phagocyte inhibitor may suppress immune response toward the engineered immune cell.
  • the killer/phagocyte inhibitors include, but are not limited to, CD47, CD24, FASL, PDL1, or functional domains thereof.
  • the disease-associated antigen described herein can be a tumor-associated antigen or a tumor-specific antigen.
  • the first antigen binding domain or the second antigen binding domain can be an antibody or fragment thereof, for example, a scFv or a single domain antibody.
  • a gene encoding an endogenous surface marker of the engineered immune cell can be inactivated, wherein the endogenous surface marker is capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker can be the antigen that CAR targets.
  • the endogenous antigen or the gene encoding such antigen may be inactivated (e.g., disrupted, inhibited, silenced or knocked out).
  • Various gene editing methods described herein can be used.
  • the endogenous surface marker can be, for example, CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the engineered immune cell provided herein can comprise a chimeric polypeptide comprising (i) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, and (ii) an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the chimeric polypeptide with a cell death activator, wherein the enhancer moiety is linked to the inducible cell death moiety.
  • the enhancer moiety and the inducible moiety may be linked by a linker.
  • the linker can be a cleavable linker, for example, a self-cleaving peptide.
  • the engineered immune cell can further comprise one or more chimeric polypeptide receptors (CPRs) comprising a binding moiety, wherein the binding moiety comprises (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject and (ii) a second antigen binding domain capable of binding to a disease-associated antigen.
  • An individual CPR of the one or more CPRs can comprise (i) the first antigen binding domain, (ii) the second antigen binding domain, or (iii) both the first antigen binding domain and the second antigen binding domain.
  • a CPR of the one or more CPRs can further comprise a transmembrane domain and an intracellular signaling domain.
  • the one or more CPRs in the engineered immune cell are one or more chimeric antigen receptors (CARs) or engineered T cell receptors (TCRs).
  • the engineered immune cells comprise both CARs and engineered TCRs.
  • the engineered TCR can be a TCR fusion protein.
  • the TCR fusion protein can comprise a heterologous antigen binding domain fused to one or more subunits of a TCR complex.
  • the TCR fusion protein can comprise a TCR subunit comprising at least a portion of a TCR extracellular domain and a TCR intracellular domain; and an antibody domain comprising an antigen binding domain, where the TCR subunit and the antibody domain are linked.
  • the TCR fusion protein can incorporate into a TCR complex when expressed in a T cell.
  • the TCR fusion protein can further comprise a TCR transmembrane domain.
  • the TCR extracellular domain, the TCR intracellular domain, or the TCR transmembrane domain can be derived from TCR alpha chain, TCR beta chain, TCR gamma chain, TCR delta chain, CD3 epsilon, CD3 gamma, CD3 delta or CD3 zeta.
  • an endogenous TCR of the engineered immune cell comprising an engineered TCR is inactivated.
  • the engineered immune cell comprising inactivated endogenous TCR may not cause GVHD.
  • a gene encoding an endogenous TCR subunit can be inactivated.
  • a gene encoding an endogenous TCR subunit may be mutated such that an endogenous TCR may not be formed.
  • the engineered immune cell provided herein can comprise a chimeric polypeptide comprising (i) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, and (ii) an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the chimeric polypeptide with a cell death activator.
  • the enhancer moiety is linked to the inducible cell death moiety.
  • the one or more chimeric antigen receptors (CARs) can comprise a binding moiety.
  • the binding moiety can comprise (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject and (ii) a second antigen binding domain capable of binding to a disease-associated antigen.
  • an individual CAR of the one or more CARs comprises (i) the first antigen binding domain or (ii) the second antigen binding domain.
  • an individual CAR of the one or more CARs comprises both the first antigen binding domain and the second antigen binding domain.
  • each CAR of the one or more CARs further comprises a transmembrane domain and an intracellular signaling domain.
  • the first antigen binding domain of the engineered immune cell can bind to an immune cell antigen.
  • endogenous T cell receptors (TCRs) of the engineered immune cell is inactivated.
  • TCRs T cell receptors
  • Various methods can be used to inactivate endogenous TCRs.
  • a gene encoding a subunit of the endogenous TCR can be inactivated such that the endogenous TCR is inactivated.
  • the gene encoding the subunit can be TCR ⁇ , TCR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ .
  • the chimeric polypeptide may or may not comprise any self-cleaving peptide flanked by the enhancer moiety and the inducible cell death moiety.
  • the enhancer moiety can be configured to constitutively enhance the one or more activities of the engineered immune cell.
  • the enhancer moiety can be configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell.
  • the one or more intracellular signaling pathways can be one or more cytokine signaling pathways.
  • the enhancer moiety can be self-activating through self-oligomerizing.
  • the enhancer moiety can be self-activating through self-dimerizing.
  • the chimeric polypeptide described herein can be a secreted protein.
  • the chimeric polypeptide can be an intracellular protein.
  • the chimeric polypeptide can be a transmembrane protein.
  • the enhancer moiety or the inducible cell death moiety can be contained in an ectodomain of the transmembrane protein.
  • the enhancer moiety or the inducible cell death moiety is contained in an endodomain of the transmembrane protein.
  • the enhancer moiety can be contained in an endodomain of the transmembrane protein and the inducible cell death moiety can be contained in an ectodomain of the transmembrane protein.
  • the enhancer moiety can be contained in an ectodomain of the transmembrane protein, and the inducible cell death moiety can be contained in an endodomain of the transmembrane protein.
  • the enhancer moiety can be a cytokine or a cytokine receptor.
  • the enhancer moiety can be selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the inducible cell death moiety can be selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, and EGFRt.
  • the inducible cell death moiety is EGFRt
  • the cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and the cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and the cell death activator is AP1903.
  • the cell death activator may comprise a nucleic acid, a polynucleotide, an amino acid, a polypeptide, lipid, a carbohydrate, a small molecule, an enzyme, a ribosome, a proteasome, a variant thereof, or any combination thereof.
  • the engineered immune cell can be a CAR-T cell.
  • the CAR-T cell can express a CAR targeting a tumor cell marker and CD3.
  • the expression of endogenous CD3 gene can be silenced in the CAR-T cell.
  • the CAR can be a single CAR targeting both a tumor cell marker and CD3.
  • the CAR can comprise a first CAR targeting a tumor cell marker and a second CAR targeting CD3.
  • the CAR-T cell can have one or more of the following characteristics: (a) expression of PD-1 gene is silenced in the CAR-T cell; (b) expression of TCR gene is silenced in the CAR-T cell; (c) the CAR-T cell expresses an exogenous cellular suicide element (e.g., inducible cell death moiety).
  • the engineered immune cell can express a CAR and/or an exogenous TCR, and the CAR and/or exogenous TCR target a tumor cell marker.
  • the engineered immune cell can comprise a cytokine-related signaling pathway that is enhanced.
  • the cytokine-related signaling pathway can comprise a related signaling pathway of a cytokine selected from a group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, or a combination thereof.
  • Enhancing the cytokine-related signaling pathway can comprise introducing a gene encoding a cytokine and/or a receptor thereof, up-regulating a gene encoding a cytokine and/or a receptor thereof, or exogenously adding a cytokine, a receptor of cytokine that is introduced, or a combination thereof.
  • the engineered immune cell can be a CAR-T cell having one or more characteristics selected from a group consisting of (a) gene expression an endogenous TCR being silenced; (b) expressing an element for cellular suicide; (c) normal expression of endogenous HLA-I and HLA-II genes; (d) normal expression or overexpression of endogenous HLA-E and/or HLA-G.
  • the engineered immune cell can comprise a CAR or an exogenous TCR targeting a tumor cell marker.
  • the engineered immune cell can comprise a substance targeting a T cell or NK cell.
  • the engineered immune cell can comprise a CAR targeting a T cell and/or NK cell.
  • the engineered immune cell can comprise a bispecific CAR targeting both (i) a tumor cell marker and (ii) a T cell and/or NK cell marker.
  • the substance is an antibody.
  • the antibody target both T cell and NK cell can be H-69, 3Ale, 3Alf, T3-3A1, RFT2, SDZ214-380 (SDZCHH380), CD7-6B7, 124-1D1, 4H9, RPA-2.10, TS1/8, OKT11, AB75, 3E11, BH1, or Lo-CD2a.
  • the CAR-T cell provided herein can be a universal CAR-T cell.
  • the CAR-T cell can express a chimeric antigen receptor CAR that targets a tumor cell marker and the binding of the T cell receptor to PD-1 is inhibited.
  • the CAR-T cell can target a tumor cell marker and an immune cell marker such as CD2 or CD7.
  • the endogenous TCR expression in the CAR-T cells provided herein can be knocked out by gene editing technology. Upon knocking out the endogenous TCRs of the CAR-T cells, the normal cells may not be recognized and killed by the CAR-T cells during the allogeneic infusion. The GVHD reaction may be inhibited.
  • the CAR-T can further comprise a suicide gene switch (e.g., an inducible cell death moiety).
  • the CAR-T cells can be inactivated or removed by turning on the suicide gene switch (e.g., binding of an activator to the inducible cell death moiety) to reduce the side effects of the CAR-T cell therapy.
  • a CAR provided herein can have a structure of CD19 scFv-CD7 scFv-Hinge-TM-CD28/41BB-CD3 ⁇ , wherein the CD7 scFv fragment is a monoclonal 3Ale antibody, the heavy and light chain variable regions are joined by a GS linker, and the CD19 scFV fragment is the heavy and light chain variable region of the monoclonal FMC63 antibody linked by a GS linker.
  • the CAR can also include a hinge region and a transmembrane region in tandem, human CD28 and/or 41BB intracellular co-stimulatory elements, as well as human CD3 intracellular domain.
  • a gene fragment of a CAR construct CD19 scFv-CD7 scFv-Hinge-TM-CD28/41BB-CD3 ⁇ can be inserted into a lentiviral vector, and the recombinant vector can be packaged into viral particles in 293T cells.
  • T cells can be isolated from peripheral blood mononuclear cells, and after activation, some endogenous genes (e.g., CD7, TCR and PD-1 genes) can be knocked out by gene editing technologies such as CRISPR/CAS technology.
  • T cells can be infected by the viral particles containing the CAR construct describe herein to express the CAR.
  • the prepared CAR-T cells can be used to detect the infection efficiency and gene editing efficiency of CAR by flowcytometry.
  • the engineered immune cell may have one or more characteristics described herein: (a) the expression of the endogenous CD7 or CD2 gene of the engineered immune cell is silenced; (b) the PD-1 gene expression of the engineered immune cell is silenced; (c) the TCR gene expression of the engineered immune cell is silenced; (d) the engineered immune cell expresses a cytokine or cytokine receptor complex and the pSTAT5 signaling level is up-regulated; (e) the engineered immune cell expresses an exogenous inducible cell death moiety; (f) the first CAR, and/or the second CAR in the engineered immune cell is co-expressed with the inducible cell death moiety.
  • the engineered immune cell may comprise two different CARs, each having a different antigen binding domain target a different antigen.
  • the engineered immune cell may comprise a single CAR, which further comprises two antigen binding domains targeting two different antigens.
  • a first CAR, and/or a second CAR is linked to an inducible cell death moiety and/or an enhancer moiety by a self-cleaving element.
  • the enhancer moiety is a cytokine or cytokine complex.
  • cytokines or cytokine complexes examples include IL2, IL7, IL15, membrane-bound IL15 (mbIL15 or mb15), and a constitutive activating cytokine receptor such as an IL7 receptor (C7R).
  • mbIL and “mb” are used interchangeably to refer to a membrane-bound interleukin factor, for example, mbIL7 or mb7, and mbIL17 or mb17.
  • the engineered immune cell described herein may have the following characteristics: (a) the engineered immune cell expresses a CAR and/or an exogenous TCR, and the CAR and/or exogenous TCR targets tumor cell markers; and (b) the cytokine-associated signaling pathway is enhanced.
  • the engineered immune cell may be (i) chimeric antigen receptor T cells (CAR-T cells); (ii) chimeric antigen receptor NK cells (CAR-NK cells); or (iii) Exogenous T cell receptor (TCR) T cells (TCR-T cells).
  • the engineered immune cell can be a CAR-T cell, preferably a universal CAR-T cell (UCAR-T cell).
  • cytokine-related signaling pathway refers to a signaling pathway initiated by the cytokine binding to the corresponding receptor, converting the extracellular signal into an intracellular signal, which is then amplified, dispersed, and regulated by a signal cascade. A series of cellular responses can be produced.
  • the cytokine-related signaling pathway comprises a related signaling pathway of a cytokine selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, 25 or a combination thereof.
  • the engineered immune cell can comprise a bispecific CAR (or a dual CAR).
  • the bispecific CAR can comprise both a first antigen binding domain and a second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain can be linked via a linker.
  • the linker may not comprise a self-cleaving peptide.
  • the first antigen binding domain or the second antigen binding can be a scFv.
  • the first antigen binding domain and the second antigen binding domain can be arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH1-VL1-VH2; (ii) VH2-VL1-VH1-VL2; (iii) VL1-VH2-VL2-VH1; or (iv) VH1-VL2-VH2-VL1, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and VL2 is light chain variable domain of the second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain can be arranged, from amino terminus to carboxyl terminus, as: (i) VL2-VH2-VL1-VH1; (ii) VL2-VH2-VH1-VL1; (iii) VL1-VH1-VL2-VH2; or (iv) VL1-VH1-VH2-VL1, wherein VH1 is heavy chain variable domain of the first antigen binding domain, VL1 is light chain variable light domain of the first antigen binding domain, VH2 is heavy chain variable domain of the second antigen binding domain, and VL2 is light chain variable domain of the second antigen binding domain.
  • the first antigen binding domain and the second antigen binding domain can bind to the immune cell antigen and the disease-associated antigen.
  • the engineered immune cell may not comprise a bispecific CAR.
  • an individual CAR of the engineered immune cell can comprise only the first antigen binding domain and an additional individual CAR of the engineered immune cell can comprise only the second antigen binding domain.
  • the immune cell antigen can be a surface protein or a secreted protein of an immune cell.
  • the immune cell can be an NK cell, a T cell, a monocyte, a macrophage or a granulocyte.
  • the immune cell antigen can be selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the disease-associated antigen can be a tumor-associated antigen.
  • the tumor-associated antigen can be CD19 or other antigens described herein.
  • the first antigen binding domain can bind to an immune cell antigen selected from the group consisting of CD2, CD3, CD5, CD7 and CD137, and the second antigen binding domain can bind to CD19.
  • the first antigen binding domain can bind to CD3, and the second antigen binding domain can bind to CD19.
  • the first antigen binding domain can bind to CD7, and the second antigen binding domain can bind to CD19.
  • the first antigen binding domain can bind to CD137, and the second antigen binding domain can bind to CD19.
  • the expression of one or more endogenous human leukocyte antigen (HLA) genes of the engineered immune cell can remain intact.
  • the expression of endogenous HLA-I and/or HLA-II genes of the engineered immune cell can remain intact.
  • the expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell can remain intact.
  • the expression of one or more endogenous HLA genes of the engineered immune cell can be upregulated.
  • the expression of endogenous HLA-E and/or HLA-G and/or HLA-C genes of the engineered immune cell can be upregulated.
  • the engineered immune cell is a T cell, an NKT cell or an NK cell.
  • the engineered immune cell is derived from a stem cell.
  • the stem cell can be a hematopoietic stem cell (HSC) or an induced pluripotent stem cell (iPSC).
  • a cell e.g., an engineered immune cell
  • a cell can comprise one or more chimeric antigen receptors (CARs) comprising a binding moiety, where the binding moiety can comprise an antigen binding domain capable of binding to an immune cell antigen.
  • CARs chimeric antigen receptors
  • Each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • the cell can further comprise an enhancer moiety capable of enhancing one or more activities of the cell, where an endogenous T cell receptor (TCR) of the cell may be inactivated.
  • TCR endogenous T cell receptor
  • the enhancer moiety can enhance one or more activities of the cell.
  • the enhancer moiety can be configured to constitutively enhance the one or more activities of the cell.
  • the enhancer moiety can be configured to constitutively upregulate one or more intracellular signaling pathways of the cell.
  • the one or more intracellular signaling pathways can be one or more cytokine signaling pathways.
  • the enhancer moiety can be a cytokine or a cytokine receptor.
  • the enhancer moiety can be selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the cell can further comprise an inducible cell death moiety capable of effecting death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety can be selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety can be EGFRt
  • the cell death activator can be an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety can be HSV-TK, and the cell death activator can be GCV.
  • the inducible cell death moiety can be iCasp9, and the cell death activator can be AP1903.
  • a gene encoding an endogenous surface marker of the cell can be inactivated, where the endogenous surface marker may be capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker can be CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the engineered immune cell can comprise a first antigen binding domain and a second antigen binding domain.
  • a single or individual CAR of the engineered immune cell comprises both the first antigen binding domain and the second antigen binding domain.
  • two CARs of the engineered immune cell comprise the first antigen binding domain and the second antigen binding domain with each CAR contains only one antigen binding domain.
  • two engineered immune cells comprise the first antigen binding domain and the second antigen binding domain with each engineered immune cell comprises only one type of antigen binding domain.
  • the first antigen binding domain can target an immune cell antigen and the second antigen binding domain can target a disease-associated antigen.
  • the antigen binding domain can be a Fab, F(ab′) 2 , single domain antibody, single chain Fv (scFv), centyrin, darpin, or other polypeptides with antigen binding specificities.
  • the antigen binding domain can target an immune cell antigen.
  • immune cell antigen include, but are not limited to, CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the immune cell antigen is a cell marker expressed on both T cells and NK cells, including, but not limited to, CD2, CD7, CD38, CD45, CD48, CD50, CD52, CD56, CD69, CD100, CD122, CD132, CD134 (OX40), CD137 (4-1BB), CD178 (ICOS), CD161, CD159a, CD159c and CD314.
  • CD3 is a marker present on the surface of T lymphocytes. There are three subtypes, CD 3 ⁇ , CD 3 ⁇ and CD 3 ⁇ . CD 3 ⁇ and CD 3 ⁇ have a molecular weight of 20 kDa, and CD37 has a molecular weight of 26 kDa, which is expressed on the surface of T lymphocytes, thymocytes and NK cell membranes. CD3 can be expressed in 61% to 85% of normal peripheral blood lymphocytes and 60% to 85% in thymocytes. It belongs to the immunoglobulin superfamily.
  • CD3 is a component of the T-lymphocyte receptor (TCR) complex and forms a complex with the ⁇ - ⁇ and ⁇ / ⁇ T-lymphocyte receptors (TCRs), which can be the main membrane protein for conducting TCR signals upon TCR binding to peptide/MHC. TCR can be essential for cell surface expression, antigen recognition, and signaling.
  • CD3 is a surface-specific molecule of T lymphocytes through which T lymphocytes with killing effects can be recruited.
  • Monoclonal antibodies to CD3 can induce or prevent T lymphocyte activation.
  • Anti-CD3 antibodies induce apoptosis of T lymphocytes in the presence of anti-CD28 antibodies or IL-2.
  • CD3 is one of the markers of mature T lymphocytes in peripheral blood.
  • T lymphocyte deficiency T lymphocyte deficiency
  • leukemia T lymphoma
  • T lymphocyte type T lymphocyte type classification diagnosis.
  • Anti-CD3 monoclonal antibodies can be used for immunosuppressive therapy in organ transplantation or bone marrow transplantation, and can also be used for immunomodulatory treatment of severe autoimmune diseases to remove T lymphocytes.
  • the antigen binding domain can target CD7.
  • CD7 is a transmembrane protein and is a member of the immunoglobulin superfamily. CD7 proteins are expressed on the surface of mature T cells and NK cells as well as their precursor cells. CD7 can bind to its ligand K12/SECTM1 and function as a co-stimulatory effecter on T cell activation. In mice, CD7 knockout T cell precursors can develop into normal T cells with only a slight effect on T cell effector function. More than 90% of T-cell acute lymphoblastic leukemia (T-ALL) can express CD7, and therefore CD7 can be a marker for T-ALL.
  • T-ALL T-cell acute lymphoblastic leukemia
  • CD7 can also be expressed in NK lymphoma, T-cell lymphoma/leukemia, chronic myelogenous leukemia, acute myeloid leukemia, and lymphocyte-rich thymoma.
  • An example tissue distribution of CD7 expression is shown in FIG. 13 .
  • the antigen binding domain can target CD2. Similar to CD7, CD2 adhesion molecules may expressed on all peripheral blood T cells and natural killer cells, but not on B lymphocytes.
  • the CD2 extracellular domain contains an immunoglobulin-like domain that mediates homodimerization. Binding of CD2 to CD58 (LFA-3) or CD48 can help T cells adhere to antigen presenting cells, triggering signal transduction of T cell receptors for antigen binding.
  • the function of CD2 may be similar to other T cell costimulatory receptors (such as CD28). CD2 knockout mice can have normal immune function.
  • An example tissue distribution of CD2 expression is shown in FIG. 14 .
  • the antigen binding domain can target CD137.
  • CD137 also known as 4-1BB, is a member of the TNF receptor superfamily.
  • CD137 protein can be an activation-induced co-stimulatory receptor, which can be widely expressed in activated T cells, NK cells, dendritic cells, granulocytes and other immune cell types and certain tumor cells.
  • CD137 expression was found on activated T and NK cells with little expression in na ⁇ ve T cells and inactivated T and NK cells.
  • CD137 can initiate NF- ⁇ B pathway through TRAF2 and participate in T cell proliferation, cytokine secretion and anti-apoptosis.
  • CD137 can be used as a marker for reactive T cells.
  • CD137 signaling pathway by CD137 natural ligand or agonistic antibody can increase cytokine secretion and antitumor activity of cytotoxic lymphocytes.
  • Inhibition of reactive T cells with specific inhibitory CD137 antibodies can reduce autologous rejection in transplant rejection or reduce GVHD response caused by autoreactive T cells of an allogeneic origin.
  • CD137 expression can be regulated by TCR signaling and downstream signaling of cytokine TL-2/TL-15. Knockout of CD137 molecule may have no effect on the function of mature T cells in a non-activated state.
  • the endogenous CD137 of the engineered immune cell can be knocked out to avoid fratricide.
  • the endogenous TCRs of the engineered immune cell can be inactivated to prevent GVHD.
  • An example tissue distribution of CD137 expression is shown in FIG. 51 .
  • the antigen binding domain can target a disease-associated antigen, for example, tumor-associated antigen.
  • tumor-associated antigens include, but are not limited to, BCMA, VEGFR2, CD19, CD20, CD30, CD22, CD25, CD28, CD30, CD33, CD52, CD56, CD80, CD86, CD81, CD123, cd171, CD276, B7H4, CD133, EGFR, GPC3; PMSA, CD 3, CEACAM6, c-Met, EGFRvIII, ErbB2, ErbB3 HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, CD44V6, CEA, CA125, CD151, CTLA-4, GITR, BTLA, TGFBR2, TGFBR1, IL6R, gp130, Lewis, TNFR1, TNFR2,
  • the tumor-associated antigens comprise CD19, CD2, CD3, CD4, CD5, CD7, CD8, CD19, CD20, CD22, CD25, CD28, CD30, CD33, CD38, CD40, CD44V6, CD47, CD52, CD56, CD57, CD58, CD79b, CD80, CD86, CD81, CD123, CD133, CD137, CD151, CD171, CD276, CLL1, B7H4, BCMA, VEGFR-2, EGFR, GPC3, PMSA, CEACAM6, c-Met, EGFRvIII, ErbB2/HER2, ErbB3, HER-2, HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, Flt1, KDR, Flt4, Flt3, CEA, CA125, CTLA-4, GITR, BTLA, TGFBR1, TGFBR2, TGFBR1, IL6R,
  • the tumor-associated antigen is CD19.
  • CD19 is a 95 kDa glycoprotein on the surface of B cells that begins to express from the early development of B cells until it differentiates into plasma cells.
  • CD19 is a member of the immunoglobulin (Ig) superfamily and is involved in the regulation of the signal transduction process of B cell receptors as one of the constituent elements of the B cell surface signal transduction complex.
  • Ig immunoglobulin
  • CD19 is restricted to the B-cell lineage and not to the surface of pluripotent hematopoietic stem cells.
  • CD19 can also be expressed on the surface of most B cell lymphomas, mantle cell lymphomas, ALLs, CLLs, hairy cell leukemias, and some acute myeloid leukemia cells.
  • CD19 can be a target for immunotherapy in the treatment of leukemia/lymphoma.
  • CD19 may not be expressed on most normal cell surfaces other than B cells, including pluripotent hematopoietic stem cells. This feature can make CD19 a safe therapeutic target for autoimmune diseases because the risk of irreversible bone marrow toxicity damage can be minimized.
  • the antigen binding domain provided herein can have a structure shown as V H -V L or VL-VH, wherein VH is a heavy chain variable region of an antibody; V L is a light chain variable region of an antibody; “-” is a linker peptide (or flexible linker) or a peptide bond.
  • the antigen binding domain targets a tumor-associated antigen.
  • the tumor-associated antigen comprises CD19.
  • the antigen binding domain that targets CD19 comprises the heavy chain variable region and the light chain variable region of the monoclonal FMC63 antibody.
  • the sequence of the linker peptide or flexible linker comprises 2-6, preferably 3-4 consecutive (GGGGS) amino acid sequences (SEQ ID NO: 93).
  • the amino acid sequence of V L1 is as shown in SEQ ID NO.: 87
  • the amino acid sequence of VH1 is shown in SEQ ID NO.: 88.
  • An example amino acid sequence of CAR targeting CD19 is shown in SEQ ID NO.: 89.
  • the antigen binding domain targets an immune cell antigen.
  • the immune cell antigen targets CD7.
  • the immune cell antigen targets CD2.
  • the monoclonal antibody of CD7 is selected from the group consisting of TH-69, 3Ale, 3Alf, T3-3A1, RFT2, CD7-6B7, 124-1D1, 4H9, SDZ214-380, or a combination thereof.
  • the monoclonal antibody to CD2 is selected from the group consisting of RPA-2.10, TS1/8, OKT11, AB75, 3E11, BH1, or a combination thereof.
  • the amino acid sequence of V L is as shown in SEQ ID NO.: 90
  • the amino acid sequence of VH is shown in SEQ ID NO.: 91.
  • the engineered immune cell provided herein can comprise an enhancer moiety.
  • the enhancer moiety can regulate one or more activities of the engineered immune cell, for example, enhance or upregulate one or more signaling pathways to enhance or upregulate effector functions of the engineered immune cell.
  • the signaling pathways can be a cytokine-related signaling pathway.
  • the enhancer moiety can be a cytokine.
  • the enhancer moiety can be a cytokine receptor.
  • the cytokine-related signaling pathway can comprise a related signaling pathway of a cytokine.
  • cytokines include, but are not limited to, IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21 and IL25.
  • the cytokine-related signaling pathway comprises a related signaling pathway of two or more cytokines, wherein the cytokines include: IL-2 and IL-7, IL-2 and IL-15. IL-7 and IL-15, IL15 and IL21.
  • the cellular response can include regulation of downstream gene expression, changes in intracellular enzyme activity, changes in cellular bone architecture, changes in DNA synthesis, promotion of gene transcription, regulation of immune cell differentiation, proliferation, and resistance to cell death.
  • the cytokine-related signaling pathway is enhanced comprising: introducing or up-regulating a gene encoding a cytokine and/or a receptor thereof, exogenously adding a cytokine, being introduced into a cytokine receptor, or a combination thereof.
  • up-regulating the gene encoding the cytokine and/or its receptor comprises up-regulating the level of transcription and/or translation of the encoding gene.
  • the enhanced cytokine-related signaling pathway can be achieved by one or more of the following methods: expressing a gene encoding the cytokine and/or its receptor in the immune cell, increasing the copy number of the gene encoding the cytokine and/or its receptor in the immune cell, engineering a regulatory sequence (e.g., a promoter) of the encoding gene to enhance transcription speed (e.g., transcriptional initiation rate), modifying a translational regulatory region of a messenger RNA carrying the encoded gene to enhance translational strength, modifying the coding gene itself to enhance mRNA stability, protein stability and to release protein feedback inhibition.
  • a regulatory sequence e.g., a promoter
  • enhance transcription speed e.g., transcriptional initiation rate
  • modifying a translational regulatory region of a messenger RNA carrying the encoded gene modifying the coding gene itself to enhance mRNA stability, protein stability and to release protein feedback inhibition.
  • the cytokine-related signaling pathway can be enhanced by membrane expression of a cytokine and its receptor, secretion of a cytokine, enhancement of transcriptional regulation of a cytokine and/or its receptor, or a combination thereof.
  • the membrane-expressed cytokine and its receptors can include: IL-15 and its receptor (e.g., mbIL15 fusion protein), IL-7 and its receptor (e.g., mbIL7 fusion protein), IL-17 and its receptor (e.g., mbIL17 fusion protein), IL-2 and its receptor (e.g., mbTL2 fusion protein), IL-21 and its receptor (e.g., mbIL21 fusion protein), constitute the activated IL-7 receptor (C7R), or a combination thereof.
  • IL-7 and its receptor e.g., mbIL15 fusion protein
  • IL-7 and its receptor e.g., mbIL7 fusion protein
  • the enhancer moiety comprised in the engineered immune cell is a secretive cytokine.
  • the secretive cytokine can function with various mechanisms, for example, the secretive cytokine can be a trans-activating factor or a cis-activating factor.
  • the secretive cytokines can include IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, or a combination thereof.
  • the enhancer is a membrane bound protein such as mbIL15, mbIL7, mbIL21 and mbIL2.
  • the enhancer moiety is constitutively active cytokine receptor downstream signaling protein such as STAT5 and STAT3.
  • the enhancer moiety is a constitutively active cytokine receptor such as constitutively active IL-7 receptor (C7R) or derivatives thereof.
  • the constitutively active cytokine receptor can be an engineered protein (e.g., referred to as “E3” in the present disclosure) where the ecto domain of C7R is replaced by a safety switch, such as EGFRt or truncated form of human epidermal growth factor receptor 2 (Her2t; see U.S. Patent Application Publication No. 20170267742A1) or other peptides described in the present disclosure.
  • the constitutively active cytokine receptor can be an engineered protein (e.g., referred to as “E4” in the present disclosure) where the ectodomain of C7R is replaced by an immune cell inhibitor, such as CD47, CD24 or other peptides that inhibit killer or phagocytic immune cell function and protect therapeutic cells (e.g., the engineered immune cells described herein).
  • the cytokine can be a chemokine such as CCL21 and CCL19.
  • chemokines that may be used include CCL27, CCL28, CCL20, CXCL9, CXCL10, CXCL11, CXCL16, CXCL13, CXCL5, CXCL6, CXCL8, CXCL12, CCL2, CCL8, CCL13, CCL25, CCL3, CCL4, CCL5, CCL7, CCL14, CCL15, CCL16, CCL23, CX3CL1, XCL1, XCL2, CCL1, CCL17, CCL22, CCL11, CCL24, CCL26, CXCL1, CXCL2, CXCL3 and CXCL7.
  • the enhancer moiety is a ligand of CCR7, which can function to enhance infiltration of T cells, NK cells or dendritic cells.
  • CCR7 ligand includes, but not limited to, CCL21 and CCL19.
  • the enhancer moiety comprises co-expression of chemokines CCL21 and CCL19 for therapeutic use to treat lymphomas or other solid tumors.
  • the engineered immune cell is used as a therapeutic agent to treat liquid tumors, and in such situations, the enhancer moiety can comprise any cytokine in any form as described herein. In some situations, the engineered immune cell is used as a therapeutic agent to treat solid tumors, and in such situations, the enhancer moiety can comprise any cytokine in any form and further comprise one or more chemokines.
  • two cytokines may be used to enhance the cytokine-related signaling pathway in the engineered immune cell, including IL-2 and IL-7, IL-2 and IL-15, IL-7 and IL-15, and TL15 and IL21.
  • the cytokine-related signaling pathway enhancement can comprise the expression of a polypeptide selected from the group consisting of a mbTL fusion protein, a constitutively active IL-7 receptor (C7R), an interleukin, or a combination thereof.
  • the enhancer moiety described herein can be interleukin 15 (IL-15) or IL-15 receptor.
  • IL-15 is a 14-15kDs glycoprotein composed of 114 amino acids and belongs to the family of four helix bundle cytokines.
  • IL-15 is structurally homologous to interleukin 2 (IL-2).
  • IL-15 receptor comprises a high affinity IL-15 receptor alpha chain, an IL2/15 receptor beta chain, and a common gamma chain. Therefore, IL-15 may have some functions similar to IL-2, such as stimulating T cell activation and proliferation, enhancing NK cell killing activity and promoting B cell production of immunoglobulin.
  • IL-15 may play a role in the differentiation, proliferation and activation of NK cells, NKT cells and intestinal epithelial cells.
  • IL-15 and IL-17 may play a role in the regulation of CD8+ memory T cells.
  • IL-15 may also play a role in the non-immune system, such as regulation of skeletal muscle anabolism.
  • the enhancer moiety described herein can be interleukin 7 (IL-7).
  • IL-7 can promote the growth of pre-B cells, pro-B cells, B cells, and T cells. It can also promote growth and anti-apoptosis of B cells and T cells. IL-7 can play a role in the early differentiation and proliferation of thymus and the development and differentiation of dendritic cells. However, IL-7 may not have an enhanced effect on the killing activity of antigen-specific cytotoxic T lymphocytes. It can first transfer from the thymus to the peripheral blood, then induce thymocytes or peripheral blood lymphocytes to produce lymphokines, activate and enhance lymphokine-activated killer cell activity of LAK cells. CD8+ subpopulation can be the main effector cell of IL-7, and IL-7 Can also support memory CD8+ T cell expansion and survival.
  • IL-7 can promote bone marrow tissue production.
  • IL-7 not only can stimulate myeloid precursor cells and megakaryocytes to produce colony forming units and platelets, but also can restore the body from the immunosuppression of cyclophosphamide. At higher concentrations, it can also induce cytotoxicity that enhances macrophages, function as a synergistic factor for the production of CTL cells, NK cells, and activated monocytes, induce monocyte-macrophages to secrete various cytokines and promote the expression of inflammatory factors such as macrophage inflammatory protein alpha (MIP-alpha), MIP-P, IL-8 and monocyte chemoattractant protein-1 (MCP-1) and the like.
  • MIP-alpha macrophage inflammatory protein alpha
  • MIP-P monocyte chemoattractant protein-1
  • IL-7 By activating a large number of inflammatory factors produced by inflammatory cells, IL-7 not only can regulate the interaction between the components of the inflammatory process, but also enhance the inflammatory cytokine receptors (CCR) such as CCR1, CCR2 and CCR5. In addition, IL-7 can play a role in inducing immune responses. IL-7 can induce type I immune responses and increase the production of IFN- ⁇ and IL2. IL-7 can synergize with IL12 to induce IFN- ⁇ and T cell proliferation. IL-7 and transforming growth factor beta (TGF ⁇ ) can play a regulatory role and can be part of the immune regulatory mechanism.
  • CCR inflammatory cytokine receptors
  • TGF ⁇ transforming growth factor beta
  • IL-7 not only can promote immune reconstitution of T cells, but also can induce up-regulation of T cell cycle and BCL-2 expression, which broadens the diversity and persistence of circulating T cell receptor pools and increases the number of CD4+ and CD8+ T cells. Moreover, for HIV antigens, expanded T cells can also secrete IL2 and IFN- ⁇ , and have good antiviral function. Therefore, IL-7 can reverse the defects of HIV-specific T lymphocytes in proliferation, cytokine secretion and cell function.
  • the enhance moiety can regulate (e.g., activate) signal transducer and activator of transcription 5 (STAT5)-mediated signaling pathway.
  • STAT5 can be widely present in the cytoplasm.
  • cytokines e.g., IL2, IL7, IL15 and IL21
  • the receptor-coupled JAK is activated, thereby phosphorylating the Tyr residue at the C-terminus of the STAT5 protein.
  • the phosphorylated STAT5 can form homologous or heterologous dimers through its SH2 region.
  • the homologous or heterodimer can be transferred to the nucleus and bind to the target gene, thereby regulating the expression of the target gene including the cell regulatory factor and the anti-apoptotic gene.
  • Activation of STAT5 can play a role in maintaining normal cell function and regulating cell proliferation and differentiation. Therefore, regulating the activity of STAT5 signaling pathway may regulate the survival and persistence of CAR-T cells described herein.
  • the enhancer moiety can be introduced into a cell (e.g., an immune cell or an engineered immune cell) by delivering a nucleic acid molecule encoding the enhancer moiety into the cell.
  • the nucleic acid molecule can be a vector.
  • the enhancer moiety can be a part of a fusion construct.
  • a fusion protein or corresponding nucleic acid construct can have a structure as presented by a formula selected from: S-2A-L1-scFv-H-TM-C-CD3 ⁇ -2A-L2-IL15-IL15Ra (A); S-2A-L1-scFv-H-TM-C-CD3 ⁇ -2A-L2-IL15-IL15Ra-2A-L3-IL7 (B); S-2A-L1-scFv-H-TM-C-CD3 ⁇ -2A-L2-C7R (C); S-2A-L1-scFv-H-TM-C-CD3 ⁇ -2A-L2-IL7-IL7Ra (D); wherein: each “-” is independently a linker peptide or a peptide bond; S is a safety switch; 2A is an optional self-cleaving peptide; each of L1, L2 and L3 is independently null or a signal peptide sequence; C7R is as described above; scFv
  • the enhancer moiety can be part of a chimeric polypeptide.
  • the enhancer moiety can be linked to an inducible cell death moiety.
  • the enhancer moiety can be linked to the inducible cell death moiety by a linker.
  • the linker may not be cleaved.
  • the linker may not comprise a self-cleaving peptide.
  • the enhancer moiety and the inducible cell death moiety can be expressed in a cell from a same nucleic acid molecule and can be cleaved to form two polypeptides.
  • the engineered immune cell described herein may comprise an inducible cell death moiety, also referred to as “suicide gene switch.” “suicide switch,” “safety switch,” or “cell suicide element.”
  • the inducible cell death moiety can be used to effectively remove of the engineered immune cells (e.g., CAR-T cells) in vivo under the action of exogenous factors (e.g., drugs).
  • the inducible cell death moiety described herein may be rapaCasp9, iCasp9, CD20 (and its mimotope), RQR8, Her2t, CD30, BCMA, EGFRt, HSV-TK, mTMPK and the like.
  • iCasp9, CD20 (and its mimotope), RQR8, and HSV-TK may have the same ability to clear T cells, but rapaCasp9, iCasp9, RQR8, and CD20 (and their mimotope) may be faster in comparison with HSV-TK.
  • an inducible cell death moiety is capable of effecting death of said cell upon contacting said inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety can be, for example, rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, or EGFRt.
  • the inducible cell death moiety is EGFRt
  • said cell death activator is an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety is HSV-TK, and said cell death activator is GCV.
  • the inducible cell death moiety is iCasp9, and said cell death activator is AP1903.
  • the inducible cell death moiety can be linked to an enhancer moiety and can be co-expressed in a cell as a chimeric polypeptide as described above.
  • T cells for the treatment of malignant and infectious diseases
  • cell therapy by infusion of T cells can be designed to re-establish immunity against pathogens and malignancies.
  • the amount of time required to produce the T cells with tumor-targeting properties with a sufficient number of T cells in vitro can be generally incompatible with the patient's therapeutic window.
  • autologous T cells from patients with advanced disease may have impaired function and are tolerant to the desired antigen.
  • patients can be administered with allogeneic T cells but need to be prevented from immune-mediated rejection by host T cells by recognizing different major or minor histocompatibility antigens on the infused cells.
  • Infusion of T cells without the expression of TCR alpha and beta chains and HLA-A molecules may not cause GVHD and HVG.
  • the T cells edited with CRISPR/CAS9 to delete TCR alpha chain and HLA-A molecular can serve as a source of universal effector donor cells.
  • Beta-2-Microglobulin may prevent donor CAR-T cells from being attacked by the host T cells.
  • the donor CAR-T cells may be attacked by host NK cells and affect the survival of CAR-T cells. Therefore, the present disclosure provides engineered immune cells which target tumor cells and host T cells and/or NK cells.
  • the engineered immune cells described herein can scavenge host T cells and/or NK cells, and enhance the survival, persistence and expansion ability of CAR-T cells, thereby being more effective against tumor cells.
  • TALENs transcription activator-like (TAL) effector nucleases
  • ZFNs Zinc finger nucleases
  • CRISPR/Cas9 system is used to edit the genes of the immune cells.
  • CRISPR/Cas9 system can be used to knockout endogenous TCRs or cell surface markers (e.g., CD7) of the immune cells to generate the engineered immune cells for T cell therapy.
  • the CRISPR/Cas9 (clustered regular interspaced short palindromic repeats)/Cas (CRISPR-associated) system is a natural immune system unique to prokaryotes that is resistant to viruses or exogenous plasmids.
  • the Type II CRISPR/Cas system has been applied in many eukaryotic and prokaryotic organisms as a direct genome-directed genome editing tool.
  • the development of the CRISPR/Cas9 system has revolutionized the ability of people to edit DNA sequences and regulate the expression levels of target genes, providing a powerful tool for accurate genome editing of organisms.
  • the simplified CRISPR/Cas9 system can comprise Cas9 protein and gRNA.
  • the principle of action is that gRNA forms a Cas9-gRNA complex with Cas9 protein through its own Cas9 handle, and the base complementary pairing sequence of gRNA in the Cas9-gRNA complex is paired with the target sequence of the target gene by the principle of base complementary pairing.
  • Cas9 uses its own endonuclease activity to cleave the target DNA sequence.
  • the CRISPR/Cas9 system has several distinct advantages: ease of use, simplicity, low cost, programmability, and the ability to edit multiple genes simultaneously.
  • the present disclosure also provides a pharmaceutical composition
  • a pharmaceutical composition comprising an engineered immune cell described herein and a pharmaceutically acceptable carrier, diluent or excipient.
  • the pharmaceutical composition is a liquid composition.
  • the pharmaceutical composition can be administered into a subject, for example, by injection.
  • the concentration of the engineered immune cells in the preparation can be at least about 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , or more cells/ml.
  • the concentration of the engineered immune cells in the preparation can be 1 ⁇ 10 3 -1 ⁇ 10 8 cells/ml, or 1 ⁇ 10 4 -1 ⁇ 10 7 cells/ml.
  • compositions of the present disclosure may comprise engineered immune cells as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • Compositions of the present disclosure may be formulated for intravenous administration.
  • compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated (or prevented).
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • an immunologically effective amount When “an immunologically effective amount”, “an anti-tumor effective amount”, “an tumor-inhibiting effective amount”, or “therapeutic amount” is indicated, the precise amount of the compositions of the present disclosure to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the engineered immune cells (e.g., CAR-T cells) described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, or in some cases, 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques. The optimal dosage and treatment regime for a particular patient can readily be determined by monitoring the patient for signs of disease and adjusting the treatment accordingly.
  • CAR-T cells the engineered immune cells
  • compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
  • the T cell compositions of the present disclosure are administered to a patient by intradermal or subcutaneous injection.
  • the T cell compositions of the present disclosure are preferably administered by i.v. injection.
  • the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection.
  • the present disclosure provides therapeutic applications with engineered immune cells (e.g., T cells or NK cells) transduced with a lentiviral vector (LV) encoding an expression cassette described herein.
  • Transduced T cells or NK cells can target tumor cell markers (such as CD19) and activated T cell and/or NK cell consensus markers (such as CD3, CD7, CD137, etc.).
  • the engineered immune cells can be used for allogeneic tumor treatment and can be prepared on a large scale.
  • the present disclosure also provides a method of stimulating a T cell mediated immune response to a target cell population or tissue of a subject (e.g., a mammal) comprising the step of administering to the subject an engineered immune cell (e.g., CAR-T cell) of the disclosure.
  • a subject e.g., a mammal
  • an engineered immune cell e.g., CAR-T cell
  • the present disclosure provides a type of cell therapy comprising directly administering engineered universal CAR-T cells of the present disclosure to a patient in need thereof.
  • the CAR-T cells of the present disclosure may have the endogenous TCR expression knocked out or silenced in the cells by gene editing technology. Inactivation of the endogenous TCRs can prevent killing of normal cells by the TCRs during the allogeneic infusion.
  • the GVHD reaction may be prevented.
  • the CAR-T cells targeting a tumor cell marker such as CD19
  • a marker for activated T cells and/or NK cells such as CD137
  • HVG host versus graft response
  • the cell therapy provided herein can also improve the survival and anti-tumor effect of allogeneic CAR-T cells in the subject.
  • provided herein is a method of treating or diagnosing a disease in a subject, comprising administering the pharmaceutical composition described herein to said subject.
  • the engineered immune cell in said pharmaceutical composition can be derived from an allogeneic immune cell.
  • the engineered immune cell derived from said allogeneic immune cell may not induce graft versus host disease (GvHD) in said subject.
  • the engineered immune cell in said pharmaceutical composition can be derived from an autologous immune cell.
  • the endogenous TCR of said engineered immune cell in said pharmaceutical composition may be functionally inactive.
  • the engineered immune cell can reduce GVHD in said subject compared to an additional immune cell having a functionally active TCR.
  • the disease can be a cancer.
  • the cancer can be, for example, lymphoma or leukemia.
  • the CAR-T cells of the present disclosure can undergo robust in vivo cell expansion and can be extended.
  • the CAR-mediated immune response can be part of a step of adoptive immunotherapy in which CAR-modified T cells can induce an immune response specific for the antigen-binding domain in the CAR.
  • anti-CD19 CAR-T cells elicit a specific immune response against cells expressing CD19.
  • the engineered immune cells provided herein can be used to treat cancers.
  • Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors.
  • the cancers may comprise non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors.
  • Types of cancers to be treated with the CARs of the present disclosure include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas.
  • sarcomas e.g., sarcomas, carcinomas, and melanomas.
  • Adult tumors/cancers and pediatric tumors/cancers are also included.
  • Hematologic cancers are cancers of the blood or bone marrow.
  • hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
  • Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas se
  • the antigen bind moiety portion of the CAR of the present disclosure is designed to treat a particular cancer.
  • the CAR designed to target CD19 can be used to treat cancers and disorders including but are not limited to pre-B ALL (pediatric indication), adult ALL, mantle cell lymphoma, diffuse large B-cell lymphoma, salvage post allogeneic bone marrow transplantation, and the like.
  • the CAR can be designed to target CD22 to treat diffuse large B-cell lymphoma.
  • cancers and disorders include but are not limited to pre-B ALL (pediatric indication), adult ALL, mantle cell lymphoma, diffuse large B-cell lymphoma, salvage post allogeneic bone marrow transplantation, and the like can be treated using a combination of CARs that target CD19, CD20, CD22, and RORl.
  • the CAR can be designed to target mesothelin to treat mesothelioma, pancreatic cancer, ovarian cancer, and the like.
  • the CAR can be designed to target CD33/IL3Ra to treat acute myelogenous leukemia and the like.
  • the CAR can be designed to target c-Met to treat triple negative breast cancer, non-small cell lung cancer, and the like.
  • the CAR can be designed to target PSMA to treat prostate cancer and the like.
  • the CAR can be designed to target Glycolipid F77 to treat prostate cancer and the like.
  • the CAR can be designed to target EGFRvIII to treat gliobastoma and the like.
  • the CAR can be designed to target GD-2 to treat neuroblastoma, melanoma, and the like.
  • the CAR can be designed to target NY-ESO-1 TCR to treat myeloma, sarcoma, melanoma, and the like. In some embodiments, the CAR can be designed to target MAGE A3 TCR to treat myeloma, sarcoma, melanoma, and the like.
  • the present disclosure should not be construed to be limited to solely to the antigen targets and diseases disclosed herein. Rather, the present disclosure should be construed to include any antigenic target that is associated with a disease where a CAR can be used to treat the disease.
  • the cell therapy disclosed herein can be co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more anti-cancer agents, cytotoxic or cytostatic agents, hormone treatment, vaccines, and/or other immunotherapies.
  • the engineered immune cells are administered in combination with other therapeutic treatment modalities, including surgery, radiation, cryosurgery, and/or thermotherapy.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • the methods and compositions described herein are administered in combination with one or more antibody molecules, chemotherapy, other anti-cancer therapy (e.g., targeted anti-cancer therapies, or oncolytic drugs), cytotoxic agents, immune-based therapies (e.g., cytokines), surgical and/or radiation procedures.
  • cytotoxic agents that can be administered in combination with include antimicrotubule agents, topoisomerase inhibitors, anti-metabolites, mitotic inhibitors, alkylating agents, anthracyclines, vinca alkaloids, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis, proteasome inhibitors, and radiation (e.g., local or whole body ir-radiation).
  • the combination therapy is used in combination with a standard of cancer care chemotherapeutic agent including, but not limited to, anastrozole (Arimidex®), bicalu-tamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan (Myleran®), busulfan injection (Busulfex®), capecitabine (Xeloda®), N4-pentoxycarbonyl-5-deoxy-5-fluorocytidine, carboplatin (Paraplatin®), carmustine (BiCNU®), chlorambucil (Leukeran®), cisplatin (Platinol®), cladribine (Leustatin®), cyclophosphamide (Cytoxan® or Neosar®), cytarabine, cytosine arabinoside (Cy-tosar-U®), cytarabine liposome injection (DepoCyt®
  • alkylating agents include, without limitation, nitrogen mustards, ethylenimine deriva-tives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen Mustard®, Uracillost®, Uracilmostaza®, Uramustin®, Uramustine®), chlormethine (Mustargen®), cyclophosphamide (Cytoxan®, Neosar®, Clafen®, Endoxan®, Procytox®, RevimmuneTM), ifosfamide (Mitoxana®), melphalan (Alkeran®), Chlorambucil (Leukeran®), pi-pobroman (Amedel®, Vercyte®), triethylenemelamine (Hemel®,
  • Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin®); Temozolomide (Temodar® and Temodal®); Dactinomycin (also known as actinomycin-D, Cosmegen®); Melphalan (also known as L-PAM, L-sarcolysin, and phenylal-anine mustard, Alkeran®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan (Busulfex® and Myleran®); Car-boplatin (Paraplatin®); Lomustine (also known as CCNU, CeeNU®); Cisplatin (also known as CDDP, Platinol® and Platinol®-AQ); Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine
  • anthracyclines examples include, e.g., doxorubicin (Adriamycin® and Rubex®); bleomycin (Lenoxane®); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydro-chloride, Cerubidine®); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome®); mitoxantrone (DHAD, Novantrone®); epirubicin (EllenceTM); idarubicin (Idamycin®, Idamycin PFS®); mitomycin C (Mutamycin®); geldanamycin; herbimycin; ravidomycin; and desacetyl-ravidomycin.
  • doxorubicin Adriamycin® and Rubex®
  • bleomycin Lenoxane®
  • daunorubicin daunorubicin hydrochloride, dauno
  • vinca alkaloids examples include, but are not limited to, vinorelbine tartrate (Navelbine®), Vincristine (Oncovin®), and Vindesine (Eldisine®)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®); and vinorelbine (Navelbine®).
  • proteasome inhibitors examples include, but are not limited to, bortezomib (Velcade®); carfilzomib (PX-171-007, (S)-4-Methyl-N—((S)-1-(((S)-4-methyl-1-((R)-2-methyloxiran-2-yl)-1-oxopentan-2-yl)amino)-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-(2-morpholinoacetamido)-4-phenylbutanamido)-pentanamide); marizomib (NPI-0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); 0-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-O-methyl-N-[(1S)-2-[(2
  • the cell therapy may be used in combination with a tyrosine kinase inhibitor (e.g., a receptor tyrosine kinase (RTK) inhibitor).
  • a tyrosine kinase inhibitor include, but are not limited to, an epidermal growth factor (EGF) pathway inhibitor (e.g., an epidermal growth factor receptor (EGFR) inhibitor), a vascular endothelial growth factor (VEGF) pathway inhibitor (e.g., a vascular endothelial growth factor receptor (VEGFR) inhibitor (e.g., a VEGFR-1 inhibitor, a VEGFR-2 inhibitor, a VEGFR-3 inhibitor)), a platelet derived growth factor (PDGF) pathway inhibitor (e.g., a platelet derived growth factor receptor (PDGFR) inhibitor (e.g., a PDGFR-P inhibitor)), a RAF-1 inhibitor, a KIT inhibitor and a RET inhibitor.
  • EGF epidermal growth factor
  • the anti-cancer agent used in combination with the hedgehog inhibitor is selected from the group consisting of: axitinib (AG013736), bosutinib (SKI-606), cediranib (RE-CENTIN, AZD2171), dasatinib (SPRYCEL®, BMS-354825), erlotinib (TARCEVA®), gefitinib (IRESSA®), imatinib (Gleevec®, CGP57148B, STI-571), lapatinib (TYKERB®, TYVERB®), lestaurtinib (CEP-701), neratinib (HKI-272), nilotinib (TASIGNA®), semaxanib (semaxinib, SU5416), sunitinib (SUTENT®, SU11248), toceranib (PALLADIA®), vandetanib (ZACTIMA®, ZD6474), vatalanib
  • hedgehog inhibitors include, but are not limited to, vismodegib (2-chloro-N-[4-chloro-3-(2-pyridinyl)phenyl]-4-(methylsulfonyl)-benzamide, GDC-0449); 1-(4-Chloro-3-(trifluoromethyl)phenyl)-3-((3-(4-fluorophenyl)-3,4-dihydro-4-oxo-2-quinazolinyl)methyl)-urea (CAS 330796-24-2); N-[(2S,3R,3′R,3aS,4′aR,6S,6′aR,6′bS,7aR,12′aS,12′bS)-2′, 3′, 3a,4,4′, 4′a,5,5′, 6,6′, 6′a,6′b,7,7′, 7a,8′, 10′, 12′, 12′a,12′b-Eicosahydro-3,
  • Selected tyrosine kinase inhibitors are chosen from sunitinib, erlotinib, gefitinib, or sorafenib erlotinib hydrochloride (Tarceva®); linifanib (N-[4-(3-amino-1H-indazol-4-yl)phenyl]-N′-(2-fluoro-5-methylphenyl)urea, also known as ABT 869, avail-able from Genentech); sunitinib malate (Sutent®); bosutinib (4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-1-yl)propoxy]quinoline-3-carbonitrile, also known as SKI-606, described in U.S.
  • the cell therapy can be used in combination with a Vascular Endothelial Growth Factor (VEGF) receptor inhibitors, including but not limited to, Bevacizumab (Avastin®), axitinib (Inlyta®); Brivanib alaninate (BMS-582664, (S)—((R)-1-(4-(4-Fluoro-2-methyl-1H-indol-5-yloxy)-5-methylpyrrolo[2,1-f][1,2,4]triazin-6-yloxy)propan-2-yl)2-aminopropanoate); Sorafenib (Nexavar®); Pazopanib (Votrient®); Sunitinib malate (Sutent®); Cediranib (AZD2171, CAS 288383-20-1); Vargatef (BIBF1120, CAS 928326-83-4); Foretinib (GSK1363089); Telatinib (BA
  • the cell therapy described herein can be used in combination with a PI3K inhibitor.
  • the PI3K inhibitor can be an inhibitor of delta and gamma isoforms of PI3K.
  • PI3K inhibitors include, but are not limited to, 4-[2-(1H-Indazol-4-yl)-6-[[4-(methylsulfonyl)piperazin-1-yl]methyl]thieno[3,2-d]pyrimidin-4-yl]morpholine; 2-Methyl-2-[4-[3-methyl-2-oxo-8-(quinolin-3-yl)-2,3-dihydroimidazo[4,5-c]quinolin-1-yl]phenyl]propionitrile; 4-(trifluoromethyl)-5-(2,6-dimorpholinopyrimidin-4-yl)pyridin-2-amine; Tozasertib (VX680 or MK-0457, CAS 639089-54-6); (5Z
  • the cell therapy described herein can be used in combination with a mTOR inhibitor, e.g., one or more mTOR inhibitors chosen from one or more of rapamycin, temsirolimus (TORISEL®), AZD8055, BEZ235, BGT226, XL765, PF-4691502, GDC0980, SF1126, OSI-027, GSK1059615, KU-0063794, WYE-354, Palomid 529 (P529), PF-04691502, or PKI-587.
  • a mTOR inhibitor e.g., one or more mTOR inhibitors chosen from one or more of rapamycin, temsirolimus (TORISEL®), AZD8055, BEZ235, BGT226, XL765, PF-4691502, GDC0980, SF1126, OSI-027, GSK1059615, KU-0063794, WYE-354, Palomid 529 (P529)
  • ridaforolimus (formally known as deferolimus, (1R,2R,4S)-4-[(2R)-2 [(1R,9S,12S,15R,16E,18R,19R,21R, 23S,24E,26E,28Z,30S,32S,35R)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23, 29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.04,9] hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl di-methylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No.
  • WO 03/064383 everolimus (Afinitor® or RAD001); rapamycin (AY22989, Sirolimus®); simapi-mod (CAS 164301-51-3); emsirolimus, (5- ⁇ 2,4-Bis[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl ⁇ -2-methoxyphenyl)methanol (AZD8055); 2-Amino-8-[trans-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-d]pyrimidin-7(8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-1-benzopyran-2-yl)morpholinium-4-yl]methoxy]butyl]-L-
  • the cell therapy can be used in combination with a BRAF inhibitor, e.g., GSK2118436, RG7204, PLX4032, GDC-0879, PLX4720, and sorafenib tosylate (Bay 43-9006).
  • a BRAF inhibitor e.g., GSK2118436, RG7204, PLX4032, GDC-0879, PLX4720, and sorafenib tosylate (Bay 43-9006).
  • a BRAF inhibitor includes, but is not limited to, regorafenib (BAY73-4506, CAS 755037-03-7); tuvizanib (AV951, CAS 475108-18-0); vemurafenib (Zel-boraf®, PLX-4032, CAS 918504-65-1); encorafenib (also known as LGX818); 1-Methyl-5-[[2-[5-(trifluoromethyl)-1H-imidazol-2-yl]-4-pyridinyl]oxy]-N-[4-(trifluoromethyl)phenyl-1H-benzimidazol-2-amine (RAF265, CAS 927880-90-8); 5-[1-(2-Hydroxyethyl)-3-(pyridin-4-yl)-1H-pyrazol-4-yl]-2,3-dihydroinden-1-one oxime (GDC-0879,
  • the cell therapy described herein can be used in combination with a MEK inhibitor.
  • MEK inhibitor can be used in combination including, but not limited to, selumetinib (5-[(4-bromo-2-chlorophenyl)amino]-4-fluoro-N-(2-hydroxyethoxy)-1-methyl-1H-benzimidazole-6-carboxamide, also known as AZD6244 or ARRY 142886);ARRY-142886 trametinib dimethyl sulfoxide (GSK-1120212, CAS 1204531-25-80); G02442104 (also known as GSK1120212), RDEA436; N-[3,4-Difluoro-2-[(2-fluoro-4-iodophenyl)amino]-6-methoxyphenyl]-1-[(2R)-2,3-dihydroxypropyl]-cyclopropanesulfonamide (also known as RDEA119 or BAY869766); RDEA
  • GDC-0973 Metal, [3,4-difluoro-2-[(2-fluoro-4-iodophenyl)amino]phenyl][3-hydroxy-3-(25)-2-piperidinyl-1-azetidinyl]-), G-38963; and G02443714 (also known as AS703206), or a pharmaceutically acceptable salt or solvate thereof.
  • MEK inhibitors include, but are not limited to, benimetinib (6-(4-bromo-2-fluorophenylamino)-7-fluoro-3-methyl-3H-benzoimidazole-5-carboxylic acid (2-hydroxyethyoxy)-amide, also known as MEK162, CAS 1073666-70-2); 2,3-Bis[amino[(2-aminophenyl)thio]methylene]-butanedinitrile (also known as U0126 and described in U.S. Pat. No.
  • the cell therapy described herein can be used in combination with a JAK2 inhibitor, e.g., CEP-701, INCB18424, CP-690550 (tasocitinib).
  • JAK inhibitors include, but are not limited to, ruxolitinib (Jakafi®); tofacitinib (CP690550); axitinib (AG013736, CAS 319460-85-0); 5-Chloro-N2-[(1S)-1-(5-fluoro-2-pyrimidinyl)ethyl]-N4-(5-methyl-1H-pyrazol-3-y)-12,4-pyrimidinediamine (AZD1480, CAS 935666-88-9); (9E)-15-[2-(1-Pyrrolidinyl)ethoxy]-7,12,26-trioxa-19,21,24-triazatetracyclo[18.3.1.12,5.114,18]-hexaco
  • the combination therapies disclosed herein include paclitaxel or a paclitaxel agent, e.g., TAXOL®, protein-bound paclitaxel (e.g., ABRAXANE®).
  • paclitaxel agents include, but are not limited to, nanoparticle albumin-bound paclitaxel (ABRAX-ANE, marketed by Abraxis Bioscience), docosahexaenoic acid bound-paclitaxel (DHA-paclitaxel, Taxoprexin, marketed by Protarga), polyglutamate bound-paclitaxel (PG-paclitaxel, paclitaxel poliglumex, CT-2103, XYOTAX, marketed by Cell Therapeutic), the tumor-activated prodrug (TAP), ANG105 (Angiopep-2 bound to three molecules of paclitaxel, marketed by Im-munoGen), paclitaxel-EC-1 (paclitaxel bound to the erbB2-recognizing
  • the present disclosure provides methods for generating an engineered cell.
  • the method can comprise (a) delivering a nucleic acid molecule expressing a chimeric polypeptide into a cell; and (b) expressing the nucleic acid molecule in the cell, thereby generating the engineered cell.
  • the chimeric polypeptide can be a chimeric antigen receptor as described herein.
  • the present disclosure also provides methods for administering an engineered cell as described herein.
  • the engineered cell can be an engineered immune cell.
  • the engineered immune cell can be a T cell.
  • the engineered immune cell can be derived from an autologous T cell.
  • the engineered immune cell can be derived from an allogeneic T cell.
  • an engineered immune cell comprising a chimeric polypeptide comprising (i) an enhancer moiety capable of enhancing one or more activities of the engineered immune cell, and (ii) an inducible cell death moiety capable of effecting death of the engineered immune cell upon contacting the chimeric polypeptide with a cell death activator.
  • the enhancer moiety can be linked to the inducible cell death moiety.
  • the engineered immune cell can further comprise one or more chimeric antigen receptors (CARs) comprising a binding moiety.
  • the binding moiety can comprise a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject.
  • the binding moiety can further comprise a second antigen binding domain capable of binding to a disease-associated antigen.
  • An individual CAR of the one or more CARs can comprise (i) the first antigen binding domain, (ii) the second antigen binding domain, or (iii) both the first antigen binding domain and the second antigen binding domain.
  • Each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • an engineered immune cell comprising one or more chimeric antigen receptors (CARs) comprising a binding moiety.
  • the binding moiety can comprise a first antigen binding domain capable of binding to an immune cell antigen and a second antigen binding domain capable of binding to a disease-associated antigen.
  • Each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • the engineered immune cell can further comprise an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • an endogenous T cell receptor (TCR) of the engineered immune cell can be inactivated.
  • the engineered immune cell can exhibit (i) enhanced degree of persistence by remaining viable in vitro for at least about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, or more days while in presence of cells (e.g., cancer cells, immune cells, or both) that are heterologous to the engineered immune cell, (ii) enhanced degree of expansion by at least about 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 110-fold, 120-fold, 130-fold, 140-fold, 150-fold, 200-fold, 250-fold, 300-fold
  • the engineered immune cell can exhibit enhanced degree of expansion by at least about 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 110-fold, 120-fold, 130-fold, 140-fold, 150-fold, 160-fold, 170-fold, 180-fold, 190-fold, 200-fold, 210-fold, 220-fold, 230-fold, 240-fold, 250-fold, 260-fold, 270-fold, 280-fold, 290-fold, 300-fold, 350-fold, 400-fold, 450-fold, 500-fold, or more within 30 days.
  • the engineered immune cell can exhibit enhanced degree of expansion by at least about 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 2,000-fold, 3,000-fold, 4,000-fold, 5,000-fold, 6,000-fold, 7,000-fold, 8,000-fold, 9,000-fold, 10,000-fold, 20,000-fold, 30,000-fold, 40,000-fold, 50,000-fold, 60,000-fold, 70,000-fold, 80,000-fold, 90,000-fold, 100,000-fold, 200,000-fold, 300,000-fold, 400,000-fold, 500,000-fold, 600,000-fold, 700,000-fold, 800,000-fold, 900,000-fold, 1,000,000-fold, or more within 60 days.
  • the viability or expansion can be measured in the presence of stimulation, for example, stimulation by a cancer antigen or a cancer cell.
  • the viability or expansion can be measured in the presence of multiple rounds or repeated stimulations.
  • a method of administering a cell comprising a functionally inactive T cell receptor (TCR).
  • the cell can further comprise one or more chimeric antigen receptors (CARs).
  • Each individual CAR of the one or more CARs can comprise a binding moiety.
  • the binding moiety can comprise (i) a first antigen binding domain, which first antigen binding domain suppresses or reduces a subject's immune response toward the engineered immune cell when administered into the subject and (ii) a second antigen binding domain that binds to a disease-associated antigen.
  • Each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • an engineered immune cell comprising an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • the engineered cell can further comprise a chimeric antigen receptor (CAR) comprising an antigen binding domain that specifically binds CD7.
  • CAR can further comprise a transmembrane domain and an intracellular signaling domain.
  • the endogenous CD7 in the engineered immune cell can be inactivated.
  • the engineered cell can comprise a CAR comprising an antigen binding domain that specifically binds an immune cell antigen.
  • the immune cell antigen can be any immune cell antigen described herein such as CD2, CD3, CD4, CD5, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ and SLAMF7.
  • the endogenous immune cell antigen of the engineered cell, which the antigen binding domain binds, can be inactivated in the engineered cell.
  • an engineered immune cell comprising a single chimeric antigen receptor (CAR) comprising (i) a first antigen binding domain that specifically binds CD7 and (ii) a second antigen binding domain capable of binding to a disease-associated antigen.
  • the CAR can further comprise a transmembrane domain and an intracellular signaling domain.
  • a gene encoding endogenous CD7 can be inactivated in the engineered immune cell.
  • the present disclosure also provides methods of treating or diagnosing a disease in a subject.
  • the method comprises administering a pharmaceutical composition comprising an engineered immune cell into a subject.
  • the engineered immune cell in the pharmaceutical composition can be derived from an allogeneic immune cell.
  • the engineered immune cell derived from the allogeneic immune cell may not induce graft versus host disease (GVHD) in the subject.
  • the engineered immune cell in the pharmaceutical composition can be derived from an autologous immune cell.
  • an endogenous TCR of the engineered immune cell in the pharmaceutical composition is functionally inactive.
  • the engineered immune cell can reduce GVHD in the subject compared to an immune cell having a functionally active TCR.
  • the disease can be a cancer.
  • the cancer can be lymphoma or leukemia.
  • the present disclosure also provides a method of delivering an allogeneic cell therapy comprising administering to a subject in need thereof a population of engineered immune cells.
  • An individual engineered immune cell of the population can comprise one or more chimeric antigen receptors (CARs) comprising a binding moiety.
  • the binding moiety can comprise a first antigen binding domain capable of binding to an immune cell antigen.
  • the binding moiety can further comprise a second antigen binding domain capable of binding to a disease-associated antigen.
  • the first antigen binding domain can suppress or reduce a subject's immune response toward the engineered immune cell when administered into the subject.
  • the engineered immune cell can further comprise an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • the endogenous T cell receptor (TCR) of the engineered immune cell can be inactivated.
  • TCR T cell receptor
  • a gene encoding a subunit of TCR can be inactivated.
  • Various gene editing methods described herein can be used to inactivate endogenous TCRs of a T cell.
  • a method provided herein can include activation of a population of cells.
  • the cell used to prepare the engineered immune cell can be activated before preparing the engineered immune cell.
  • the engineered immune cell can be activated.
  • Activation as used herein can refer to a process whereby a cell transitions from a resting state to an active state. This process can comprise a response to an antigen, migration, and/or a phenotypic or genetic change to a functionally active state.
  • activation can refer to the stepwise process of T cell activation.
  • a T cell can require one or more signals to become activated. For example, a T cell can require at least two signals to become fully activated.
  • the first signal can occur after engagement of a TCR by the antigen-MHC complex, and the second signal can occur by engagement of co-stimulatory molecules.
  • Anti-CD3 antibody (or a functional variant thereof) can mimic the first signal and anti-CD28 antibody (or a functional variant thereof) can mimic the second signal in vitro.
  • a method provided herein can comprise activation of a population of cells. Activation can be performed by contacting a population of cells with a surface having attached thereto an agent that can stimulate a CD3 TCR complex associated signal and a ligand that can stimulate a co-stimulatory molecule on the surface of the cells.
  • T cell populations can be stimulated in vitro such as by contact with an anti-CD3 antibody or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) sometimes in conjunction with a calcium ionophore.
  • a protein kinase C activator e.g., bryostatin
  • a ligand that binds the accessory molecule can be used.
  • a population of cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions that can stimulate proliferation of the T cells.
  • 4-1BB can be used to stimulate cells.
  • cells can be stimulated with 4-1BB and IL-21 or another cytokine.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used.
  • the agents providing a signal may be in solution or conjugated to a solid phase surface. The ratio of particles to cells may depend on particle size relative to the target cell.
  • the cells such as T cells
  • the cells can be combined with agent-coated beads, where the beads and the cells can be subsequently separated, and optionally cultured.
  • Each bead can be coated with either anti-CD3 antibody or an anti-CD28 antibody, or in some cases, a combination of the two.
  • the agent-coated beads and cells prior to culture, are not separated but are cultured together.
  • Cell surface proteins may be conjugated by allowing paramagnetic beads to which anti-CD3 antibody and anti-CD28 antibody can be attached (3 ⁇ 28 beads) to contact the T cells.
  • the cells and beads are combined in a buffer, for example, phosphate buffered saline (PBS) (e.g., without divalent cations such as, calcium and magnesium). Any cell concentration may be used.
  • PBS phosphate buffered saline
  • Any cell concentration may be used.
  • the mixture may be cultured for or for about several hours (e.g., about 3 hours) to or to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for or for about 21 days or for up to or for up to about 21 days.
  • Conditions appropriate for T cell culture can include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 5, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-g, TL-4, TL-7, GM-CSF, IL-10, IL-21, IL-15, TGF beta, and TNF alpha or any other additives for the growth of cells.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
  • Media can include RPMI 1640, Al M-V, DMEM, MEM, a-MEM, F-12, X-Vivo 1, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, can be included only in experimental cultures, possibly not in cultures of cells that are to be infused into a subject.
  • the target cells can be maintained under conditions necessary to support growth; for example, an appropriate temperature (e.g., 37 ⁇ C) and atmosphere (e.g., air plus 5% CO 2 ).
  • an appropriate temperature e.g., 37 ⁇ C
  • atmosphere e.g., air plus 5% CO 2
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • a soluble monospecific tetrameric antibody against human CD3, CD28, CD2, or any combination thereof may be used.
  • activation can utilize an activation moiety, a costimulatory agent, and any combination thereof.
  • an activation moiety binds: a CD3/T cell receptor complex and/or provides costimulation.
  • an activation moiety is any one of anti-CD3 antibody and/or anti-CD28 antibody.
  • a solid phase is at least one of a bead, plate, and/or matrix. In some aspects, a solid phase is a bead.
  • the activation moiety may be not be conjugated a substrate, e.g., the activation moiety may be free-floating in a medium.
  • a population of cells can be activated or expanded by co-culturing with tissue or cells.
  • a cell can be an antigen presenting cell.
  • An artificial antigen presenting cells (aAPCs) can express ligands for T cell receptor and costimulatory molecules and can activate and expand T cells for transfer, while improving their potency and function in some cases.
  • An aAPC can be engineered to express any gene for T cell activation.
  • An aAPC can be engineered to express any gene for T cell expansion.
  • An aAPC can be a bead, a cell, a protein, an antibody, a cytokine, or any combination.
  • An aAPC can deliver signals to a cell population that may undergo genomic transplant.
  • an aAPC can deliver a signal 1, signal, 2, signal 3 or any combination.
  • a signal 1 can be an antigen recognition signal.
  • signal 1 can be ligation of a TCR by a peptide-MHC complex or binding of agonistic antibodies directed towards CD3 that can lead to activation of the CD3 signal-transduction complex.
  • Signal 2 can be a co-stimulatory signal.
  • a co-stimulatory signal can be anti-CD28, inducible co-stimulator (ICOS), CD27, and 4-1BB (CD137), which bind to ICOS-L, CD70, and 4-1BBL, respectively.
  • Signal 3 can be a cytokine signal.
  • a cytokine can be any cytokine.
  • a cytokine can be IL-2, IL-7, IL-12, IL-15, IL-21, or any combination thereof.
  • an artificial antigen presenting cell may be used to activate and/or expand a cell population. In some cases, an artificial may not induce allospecificity. An aAPC may not express HLA in some cases.
  • An aAPC may be genetically modified to stably express genes that can be used to activation and/or stimulation.
  • a K562 cell may be used for activation.
  • a K562 cell may also be used for expansion.
  • a K562 cell can be a human erythroleukemic cell line.
  • a K562 cell may be engineered to express genes of interest.
  • K562 cells may not endogenously express HLA class I, II, or CD1d molecules but may express ICAM-1 (CD54) and LFA-3 (CD58). K562 may be engineered to deliver a signal 1 to T cells. For example, K562 cells may be engineered to express HLA class I. In some cases, K562 cells may be engineered to express additional molecules such as B7, CD80, CD83, CD86, CD32, CD64, 4-1BBL, anti-CD3, anti-CD3 mAb, anti-CD28, anti-CD28mAb, CD1d, anti-CD2, membrane-bound IL-15, membrane-bound IL-17, membrane-bound IL-21, membrane-bound IL-2, truncated CD19, or any combination.
  • additional molecules such as B7, CD80, CD83, CD86, CD32, CD64, 4-1BBL, anti-CD3, anti-CD3 mAb, anti-CD28, anti-CD28mAb, CD1d, anti-CD2, membrane-bound IL
  • an engineered K562 cell can expresses a membranous form of anti-CD3 mAb, clone OKT3, in addition to CD80 and CD83. In some cases, an engineered K562 cell can expresses a membranous form of anti-CD3 mAb, clone OKT3, membranous form of anti-CD28 mAb in addition to CD80 and CD83.
  • An aAPC can be a bead.
  • a spherical polystyrene bead can be coated with antibodies against CD3 and CD28 and be used for T cell activation.
  • a bead can be of any size. In some cases, a bead can be or can be about 3 and 6 micrometers. A bead can be or can be about 4.5 micrometers in size.
  • a bead can be utilized at any cell to bead ratio. For example, a 3 to 1 bead to cell ratio at 1 million cells per milliliter can be used.
  • An aAPC can also be a rigid spherical particle, a polystyrene latex microbeads, a magnetic nano- or micro-particles, a nanosized quantum dot, a 4, poly(lactic-co-glycolic acid) (PLGA) microsphere, a nonspherical particle, a 5, carbon nanotube bundle, a 6, ellipsoid PLGA microparticle, a 7, nanoworms, a fluidic lipid bilayer-containing system, an 8, 2D-supported lipid bilayer (2D-SLBs), a 9, liposome, a 10, RAFTsomes/microdomain liposome, an 11, SLB particle, or any combination thereof.
  • PLGA poly(lactic-co-glycolic acid)
  • an aAPC can expand CD4 T cells.
  • an aAPC can be engineered to mimic an antigen processing and presentation pathway of HLA class II-restricted CD4 T cells.
  • a K562 can be engineered to express HLA-D, DP a, DP R chains, Ii, DM ⁇ , DM ⁇ , CD80, CD83, or any combination thereof.
  • engineered K562 cells can be pulsed with an HLA-restricted peptide in order to expand HLA-restricted antigen-specific CD4 T cells.
  • the use of aAPCs can be combined with exogenously introduced cytokines for T cell activation, expansion, or any combination. Cells can also be expanded in vivo, for example in the subject's blood after administration of genomically transplanted cells into a subject.
  • a method provided herein can comprise transduction of a population of cells.
  • a method comprises introducing a polynucleotide encoding for a cellular receptor such as a chimeric antigen receptor and/or a T cell receptor.
  • a transfection of a cell can be performed.
  • a viral supernatant comprising a polynucleotide encoding for a cellular receptor such as a CAR and/or TCR is generated.
  • a viral vector can be a retroviral vector, a lentiviral vector and/or an adeno-associated viral vector.
  • Packaging cells can be used to form virus particles capable of infecting a host cell. Such cells can include 293 cells, (e.g., for packaging adenovirus), and Psi2 cells or PA317 cells (e.g., for packaging retrovirus).
  • Viral vectors can be generated by producing a cell line that packages a nucleic acid vector into a viral particle.
  • the vectors can contain the minimal viral sequences required for packaging and subsequent integration into a host.
  • the vectors can contain other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed.
  • the missing viral functions can be supplied in trans by the packaging cell line.
  • AAV vectors can comprise ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
  • Viral DNA can be packaged in a cell line, which can contain a helper plasmid encoding the other AAV genes, namely rep and cap, while lacking ITR sequences.
  • the cell line can also be infected with adenovirus as a helper.
  • the helper virus can promote replication of the AAV vector and expression of AAV genes from the helper plasmid.
  • Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. Additional methods for the delivery of nucleic acids to cells can be used, for example, as described in US20030087817, incorporated herein by reference.
  • a host cell can be transiently or non-transiently transfected with one or more vectors described herein.
  • a cell can be transfected as it naturally occurs in a subject.
  • a cell can be taken or derived from a subject and transfected.
  • a cell can be derived from cells taken from a subject, such as a cell line.
  • a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences.
  • Non-limiting examples of vectors for eukaryotic host cells include but are not limited to: pBs, pQE-9 (Qiagen), phagescript, PsiX174, pBluescript SK, pBsKS, pNH8a, pNH16a, pNH18a, pNH46a (Stratagene); pTrc99A, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia).
  • Eukaryotic pWL-neo, pSv2cat, pOG44, pXT1, pSG (Stratagene) pSVK3, pBPv, pMSG, pSVL (Pharmiacia).
  • any other plasmids and vectors can be used as long as they are replicable and viable in a selected host.
  • Any vector and those commercially available (and variants or derivatives thereof) can be engineered to include one or more recombination sites for use in the methods.
  • Such vectors can be obtained from, for example, Vector Laboratories Inc., Invitrogen, Promega, Novagen, NEB, Clontech, Boehringer Mannheim, Pharmacia, EpiCenter, OriGenes Technologies Inc., Stratagene, PerkinElmer, Pharmingen, and Research Genetics.
  • vectors of interest include eukaryotic expression vectors such as pFastBac, pFastBacHT, pFastBacDUAL, pSFV, and pTet-Splice (Invitrogen), pEUK-C1, pPUR, pMAM, pMAMneo, pBI101, pBIl21, pDR2, pCMVEBNA, and pYACneo (Clontech), pSVK3, pSVL, pMSG, pCH110, and pKK232-8 (Pharmacia, Inc.), p3′SS, pXT1, pSG5, pPbac, pMbac, pMClneo, and pOG44 (Stratagene, Inc.), and pYES2, pAC360, pBlueBa-cHis A, B, and C, pVL1392, pBlueBac111,
  • vectors include pUC18, pUC19, pBlueScript, pSPORT, cosmids, phagemids, YAC's (yeast artificial chromosomes), BAC's (bacterial artificial chromosomes), P1 ( Escherichia coli phage), pQE70, pQE60, pQE9 (quagan), pBS vectors, PhageScript vectors, BlueScript vectors, pNH8A, pNH16A, pNH18A, pNH46A (Stratagene), pcDNA3 (Invitrogen), pGEX, pTrsfus, pTrc99A, pET-5, pET-9, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia), pSPORT1, pSPORT2, pCMVSPORT2.0 and pSYSPORTI (Invitrogen) and variants or derivatives thereof.
  • Additional vectors of interest can also include pTrxFus, pThioHis, pLEX, pTrcHis, pTrcHis2, pRSET, pBlueBa-cHis2, pcDNA3.1/His, pcDNA3.1( ⁇ )/Myc-His, pSecTag, pEBVHis, pPIC9K, pPIC3.5K, pA081S, pPICZ, pPICZA, pPICZB, pPICZC, pGAPZA, pGAPZB, pGAPZC, pBlue-Bac4.5, pBlueBacHis2, pMelBac, pSinRep5, pSinHis, pIND, pIND(SP1), pVgRXR, pcDNA2.1, pYES2, pZEr01.1, pZErO-2.1, pCR-
  • Transduction and/or transfection can be performed by any one of: non-viral transfection, biolistics, chemical transfection, electroporation, nucleofection, heat-shock transfection, lipofection, microinjection, or viral transfection.
  • a provided method comprises viral transduction, and the viral transduction comprises a lentivirus.
  • Viral particles can be used to deliver a viral vector comprising a polypeptide sequence coding for a cellular receptor into a cell ex vivo or in vivo.
  • a viral vector as disclosed herein may be measured as pfu (plaque forming units).
  • the pfu of recombinant virus or viral vector of the compositions and methods of the disclosure may be about 10 8 to about 5 ⁇ 10 10 pfu.
  • recombinant viruses of this disclosure are at least about 1 ⁇ 10 8 , 2 ⁇ 10 8 , 3 ⁇ 10 8 , 4 ⁇ 10 8 , 5 ⁇ 10 8 , 6 ⁇ 10 8 , 7 ⁇ 10 8 , 8 ⁇ 10 8 , 9 ⁇ 10 8 , 1 ⁇ 10 9 , 2 ⁇ 10 9 , 3 ⁇ 10 9 , 4 ⁇ 10 9 , 5 ⁇ 10 9 , 6 ⁇ 10 9 , 7 ⁇ 10 9 , 8 ⁇ 10 9 , 9 ⁇ 10 9 , 1 ⁇ 10 10 , 2 ⁇ 10 10 , 3 ⁇ 10 10 , 4 ⁇ 10 10 , and 5 ⁇ 10 10 pfu.
  • recombinant viruses of this disclosure are at most about 1 ⁇ 10 8 , 2 ⁇ 10 8 , 3 ⁇ 10 8 , 4 ⁇ 10 8 , 5 ⁇ 10 8 , 6 ⁇ 10 8 , 7 ⁇ 10 8 , 8 ⁇ 10 8 , 9 ⁇ 10 8 , 1 ⁇ 10 9 , 2 ⁇ 10 9 , 3 ⁇ 10 9 , 4 ⁇ 10 9 , 5 ⁇ 10 9 , 6 ⁇ 10 9 , 7 ⁇ 10 9 , 8 ⁇ 10 9 , 9 ⁇ 10 9 , 1 ⁇ 10 10 , 2 ⁇ 10 10 , 3 ⁇ 10 10 , 4 ⁇ 10 10 , and 5 ⁇ 10 10 pfu.
  • the viral vector of the disclosure may be measured as vector genomes.
  • recombinant viruses of this disclosure are 1 ⁇ 10 10 to 3 ⁇ 10 12 vector genomes, or 1 ⁇ 10 9 to 3 ⁇ 10 13 vector genomes, or 1 ⁇ 10 8 to 3 ⁇ 10 14 vector genomes, or at least about 1 ⁇ 10 1 , 1 ⁇ 10 2 , 1 ⁇ 10 3 , 1 ⁇ 10 4 , 1 ⁇ 10 5 , 1 ⁇ 10 6 , 1 ⁇ 10 7 , 1 ⁇ 10 8 , 1 ⁇ 10 9 , 1 ⁇ 10 10 , 1 ⁇ 10 11 , 1 ⁇ 10 12 , 1 ⁇ 10 13 , 1 ⁇ 10 14 , 1 ⁇ 10 15 , 1 ⁇ 10 16 , 1 ⁇ 10 17 , and 1 ⁇ 10 18 vector genomes, or are 1 ⁇ 10 8 to 3 ⁇ 10 14 vector genomes, or are at most about 1 ⁇ 10 1 , 1 ⁇ 10 2 , 1 ⁇ 10 3 , 1 ⁇ 10 4 , 1 ⁇ 10 5 , 1 ⁇ 10 6 , 1 ⁇ 10 7 , 1 ⁇ 10 8 , 1 ⁇ 10 9 , 1 ⁇ 10 10 , 1 ⁇ 10 11
  • a viral vector provided herein can be measured using multiplicity of infection (MOI).
  • MOI may refer to the ratio, or multiple of vector or viral genomes to the cells to which the nucleic may be delivered.
  • the MOI may be 1 ⁇ 10 6 .
  • the MOI may be 1 ⁇ 10 5 to 1 ⁇ 10 7 .
  • the MOI may be 1 ⁇ 10 4 to 1 ⁇ 10 8 .
  • recombinant viruses of the disclosure are at least about 1 ⁇ 10 1 , 1 ⁇ 10 2 , 1 ⁇ 10 3 , 1 ⁇ 10 4 , 1 ⁇ 10 5 , 1 ⁇ 10 6 , 1 ⁇ 10 7 , 1 ⁇ 10 8 , 1 ⁇ 10 9 , 1 ⁇ 10 10 , 1 ⁇ 10 11 , 1 ⁇ 10 12 , 1 ⁇ 10 13 , 1 ⁇ 10 14 , 1 ⁇ 10 15 , 1 ⁇ 10 16 , 1 ⁇ 10 17 , and 1 ⁇ 10 18 MOI.
  • recombinant viruses of this disclosure are 1 ⁇ 10 8 to 3 ⁇ 10 14 MOI, or are at most about 1 ⁇ 10 1 , 1 ⁇ 10 2 , 1 ⁇ 10 3 , 1 ⁇ 10 4 , 1 ⁇ 10 5 , 1 ⁇ 10 6 , 1 ⁇ 10 7 , 1 ⁇ 10 8 , 1 ⁇ 10 9 , 1 ⁇ 10 10 , 1 ⁇ 10 11 , 1 ⁇ 10 12 , 1 ⁇ 10 13 , 1 ⁇ 10 14 , 1 ⁇ 10 15 , 1 ⁇ 10 16 , 1 ⁇ 10 17 , and 1 ⁇ 10 18 MOI.
  • a viral vector is introduced at a multiplicity of infection (MOI) from about 1 ⁇ 10 5 , 2 ⁇ 10 5 , 3 ⁇ 10 5 , 4 ⁇ 10 5 , 5 ⁇ 10 5 , 6 ⁇ 10 5 , 7 ⁇ 10 5 , 8 ⁇ 10 5 , 9 ⁇ 10 5 , 1 ⁇ 10 6 , 2 ⁇ 10 6 , 3 ⁇ 10 6 4 ⁇ 10 6 , 5 ⁇ 10 6 , 6 ⁇ 10 6 , 7 ⁇ 10 6 , 8 ⁇ 10 6 , 9 ⁇ 10 6 , 1 ⁇ 10 7 , 2 ⁇ 10 7 , 3 ⁇ 10 7 , or up to about 9 ⁇ 10 9 genome copies/virus particles per cell.
  • MOI multiplicity of infection
  • a method can comprise adding an infective agent to a composition comprising a population of cells.
  • An infective agent can comprise polybrene.
  • an infective agent can enhance efficiency of viral infection.
  • An infective agent can enhance viral infectivity from about 100 to 1,000 fold.
  • Polybrene can be added to a composition at a concentration from about 5 ug to 10 ug per ml.
  • a method provided herein can comprise a non-viral approach of introducing a cellular receptor to a cell.
  • Non-viral approaches can include but are not limited to: CRISPR associated proteins (Cas proteins, e.g., Cas9), Zinc finger nuclease (ZFN), Transcription Activator-Like Effector Nuclease (TALEN), Argonaute nucleases, and meganucleases.
  • Nucleases can be naturally existing nucleases, genetically modified, and/or recombinant.
  • Non-viral approaches can also be performed using a transposon-based system (e.g. PiggyBac, Sleeping beauty).
  • a method provided herein can utilize a PiggyBac system to introduce an exogenous polypeptide to a cell.
  • a PiggyBac system comprises two components, a transposon and a transposase.
  • the PiggyBac transposase facilitates the integration of the transposon specifically at ‘TTAA’ sites randomly dispersed in the genome.
  • the predicted frequency of ‘TTAA’ in the genome is approximately 1 in every 256 base-pairs of DNA sequence.
  • the PB transposase also enables the excision of the transposon in a completely seamless manner, leaving no sequences or mutations behind.
  • PB performance levels can be increased by codon-optimization strategies, mutations, deletions, additions, substitutions, and any combination thereof.
  • PB can have a larger cargo (approximately 9.1-14.3 kb), a higher transposition activity, and its footprint-free characteristic can make it appealing as a gene editing tool.
  • PB can comprise a few features: high efficiency transposition; large cargo; steady long-term expression; the trans-gene is integrated as a single copy; tracking the target gene in vivo by a noninvasive mark instead of traditional method such as PCR; easy to determine the integration site, and combinations thereof.
  • a method provided herein can utilize a Sleeping Beauty (SB) System to introduce a polypeptide coding for a cellular receptor to a cell.
  • SB Sleeping Beauty
  • the SB ITRs 230 bp
  • DRs imperfect direct repeats
  • Binding affinity and spacing between the DR elements within ITR has involved in transpositional activities.
  • the SB transposase can be a 39 kDa protein that possess DNA binding polypeptide, a nuclear localization signal (NLS) and the catalytic domain, featured by a conserved amino acid motif (DDE).
  • Modified SBs can contain mutations, deletions and additions within ITRs of the original SB transposon. Modified SBs can comprise: pT2, pT3, pT2B, pT4, SB100X, and combinations thereof.
  • Non-limited examples of modified SBs can be selected from: SB10, SB11 (3-fold higher than SB10), SB12 (4-fold higher than SB10), HSB1-HSB5 (up to 10-fold higher than SB10), HSB13-HSB17 (HSB17 is 17-fold higher than SB10), SB100X (100-fold higher than SB10), SB150X (130-fold higher than SB10), and any combination thereof.
  • SB100X is 100-fold hyperactive compared to the originally resurrected transposase (SB10).
  • SB transposition excision leaves a footprint (3 bp) at the cargo site. Integration occurs into TA dinucleotides of the genome, and results in target site duplications, generated by the host repair machinery.
  • SB appears to possess a nearly unbiased, close-to-random integration profile.
  • Transposon integration can be artificially targeted ( ⁇ 10%) to a predetermined genomic locus in wildtype systems, however in chimeric systems provided herein, SB transposon integration can be directed to a predetermined locus with efficiencies over 10%.
  • a non-viral approach may be taken to introduce an exogenous polynucleic acid to a population of cells.
  • a non-viral vector or nucleic acid may be delivered without the use of a virus and may be measured according to the quantity of nucleic acid.
  • any suitable amount of nucleic acid can be used with the compositions and methods of this disclosure.
  • nucleic acid may be at least about 1 pg, 10 pg, 100 pg, 1 pg, 10 pg, 100 pg, 200 pg, 300 pg, 400 pg, 500 pg, 600 pg, 700 pg, 800 pg, 900 pg, 1 ⁇ g, g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ g, 400 ⁇ g, 500 ⁇ g, 600 ⁇ g, 700 ⁇ g, 800 ⁇ g, 900 ⁇ g, 1 ng, 10 ng, 100 ng, 200 ng, 300 ng, 400 ng, 500 ng, 600 ng, 700 ng, 800 ng, 900 ng, 1 mg, 10 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1 g, 2 g, 3 g, 4 g, or 5 g.
  • nucleic acid may be at most about 1 pg, 10 pg, 100 pg, 1 pg, 10 pg, 100 pg, 200 pg, 300 pg, 400 pg, 500 pg, 600 pg, 700 pg, 800 pg, 900 pg, 1 ⁇ g, 10 pg, 100 ag, 200 ag, 300 ag, 400 ag, 500 ag, 600 ag, 700 ag, 800 ag, 900 ag, 1 ng, 10 ng, 100 ng, 200 ng, 300 ng, 400 ng, 500 ng, 600 ng, 700 ng, 800 ng, 900 ng, 1 mg, 10 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1 g, 2 g, 3 g, 4 g, or 5 g.
  • a non-viral approach of introducing a CAR and/or TCR sequence to a cell can include electroporation. Electroporation can be performed using, for example, the Neon® Transfection System (ThermoFisher Scientific) or the AMAXA® Nucleofector (AMAXA® Biosystems). Electroporation parameters may be adjusted to optimize transfection efficiency and/or cell viability. Electroporation devices can have multiple electrical wave form pulse settings such as exponential decay, time constant and square wave. Every cell type has a unique optimal Field Strength (E) that is dependent on the pulse parameters applied (e.g., voltage, capacitance and resistance).
  • E Field Strength
  • electroporation pulse voltage the electroporation pulse width, number of pulses, cell density, and tip type may be adjusted to optimize transfection efficiency and/or cell viability.
  • electroporation pulse voltage may be varied to optimize transfection efficiency and/or cell viability.
  • the electroporation voltage may be less than about 500 volts.
  • the electroporation voltage may be at least about 500 volts, at least about 600 volts, at least about 700 volts, at least about 800 volts, at least about 900 volts, at least about 1000 volts, at least about 1100 volts, at least about 1200 volts, at least about 1300 volts, at least about 1400 volts, at least about 1500 volts, at least about 1600 volts, at least about 1700 volts, at least about 1800 volts, at least about 1900 volts, at least about 2000 volts, at least about 2100 volts, at least about 2200 volts, at least about 2300 volts, at least about 2400 volts, at least about 2500 volts, at least about 2600 volts, at least about 2700 volts,
  • the electroporation pulse voltage required for optimal transfection efficiency and/or cell viability may be specific to the cell type. For example, an electroporation voltage of 1900 volts may optimal (e.g., provide the highest viability and/or transfection efficiency) for macrophage cells. In another example, an electroporation voltage of about 1350 volts may optimal (e.g., provide the highest viability and/or transfection efficiency) for Jurkat cells or primary human cells such as T cells. In some cases, a range of electroporation voltages may be optimal for a given cell type.
  • an electroporation voltage between about 1000 volts and about 1300 volts may optimal (e.g., provide the highest viability and/or transfection efficiency) for human 578T cells.
  • a primary cell can be a primary lymphocyte.
  • a population of primary cells can be a population of lymphocytes.
  • electroporation pulse width may be varied to optimize transfection efficiency and/or cell viability.
  • the electroporation pulse width may be less than about 5 milliseconds.
  • the electroporation width may be at least about 5 milliseconds, at least about 6 milliseconds, at least about 7 milliseconds, at least about 8 milliseconds, at least about 9 milliseconds, at least about 10 milliseconds, at least about 11 milliseconds, at least about 12 milliseconds, at least about 13 milliseconds, at least about 14 milliseconds, at least about 15 milliseconds, at least about 16 milliseconds, at least about 17 milliseconds, at least about 18 milliseconds, at least about 19 milliseconds, at least about 20 milliseconds, at least about 21 milliseconds, at least about 22 milliseconds, at least about 23 milliseconds, at least about 24 milliseconds, at least about 25 milliseconds, at least about 26 milli
  • the electroporation pulse width required for optimal transfection efficiency and/or cell viability may be specific to the cell type. For example, an electroporation pulse width of 30 milliseconds may optimal (e.g., provide the highest viability and/or transfection efficiency) for macrophage cells. In another example, an electroporation width of about 10 milliseconds may optimal (e.g., provide the highest viability and/or transfection efficiency) for Jurkat cells. In some cases, a range of electroporation widths may be optimal for a given cell type. For example, an electroporation width between about 20 milliseconds and about 30 milliseconds may optimal (e.g., provide the highest viability and/or transfection efficiency) for human 578T cells.
  • the number of electroporation pulses may be varied to optimize transfection efficiency and/or cell viability.
  • electroporation may comprise a single pulse.
  • electroporation may comprise more than one pulse.
  • electroporation may comprise 2 pulses, 3 pulses, 4 pulses, 5 pulses 6 pulses, 7 pulses, 8 pulses, 9 pulses, or 10 or more pulses.
  • the number of electroporation pulses required for optimal transfection efficiency and/or cell viability may be specific to the cell type. For example, electroporation with a single pulse may be optimal (e.g., provide the highest viability and/or transfection efficiency) for macrophage cells.
  • electroporation with a 3 pulses may be optimal (e.g., provide the highest viability and/or transfection efficiency) for primary cells.
  • a range of electroporation widths may be optimal for a given cell type.
  • electroporation with between about 1 to about 3 pulses may be optimal (e.g., provide the highest viability and/or transfection efficiency) for human cells.
  • the starting cell density for electroporation may be varied to optimize transfection efficiency and/or cell viability. In some cases, the starting cell density for electroporation may be less than about 1 ⁇ 105 cells. In some cases, the starting cell density for electroporation may be at least about 1 ⁇ 10 5 cells, at least about 2 ⁇ 10 5 cells, at least about 3 ⁇ 10 5 cells, at least about 4 ⁇ 10 5 cells, at least about 5 ⁇ 10 5 cells, at least about 6 ⁇ 10 5 cells, at least about 7 ⁇ 10 5 cells, at least about 8 ⁇ 10 5 cells, at least about 9 ⁇ 10 5 cells, at least about 1 ⁇ 10 6 cells, at least about 1.5 ⁇ 10 6 cells, at least about 2 ⁇ 10 6 cells, at least about 2.5 ⁇ 10 6 cells, at least about 3 ⁇ 10 6 cells, at least about 3.5 ⁇ 10 6 cells, at least about 4 ⁇ 10 6 cells, at least about 4.5 ⁇ 10 6 cells, at least about 5 ⁇ 10 6 cells, at least about 5.5 ⁇ 10 6 cells, at least about 6 ⁇ 10 6 cells, at least about 6.5 ⁇
  • the starting cell density for electroporation required for optimal transfection efficiency and/or cell viability may be specific to the cell type. For example, a starting cell density for electroporation of 1.5 ⁇ 10 6 cells may optimal (e.g., provide the highest viability and/or transfection efficiency) for macrophage cells. In another example, a starting cell density for electroporation of 5 ⁇ 10 6 cells may optimal (e.g., provide the highest viability and/or transfection efficiency) for human cells. In some cases, a range of starting cell densities for electroporation may be optimal for a given cell type. For example, a starting cell density for electroporation between of 5.6 ⁇ 10 6 and 5 ⁇ 10 7 cells may optimal (e.g., provide the highest viability and/or transfection efficiency) for human cells such as T cells.
  • a method for treating a lymphoid malignancy can comprise administering to a patient in need thereof a population of engineered immune cells.
  • An individual engineered immune cell of the population can comprise one or more chimeric antigen receptors (CARs) comprising a binding moiety, where the binding moiety can comprise an antigen binding domain capable of binding to an immune cell antigen, and where each CAR of the one or more CARs can further comprise a transmembrane domain and an intracellular signaling domain.
  • An individual engineered immune cell of the population can further comprise an enhancer moiety capable of enhancing one or more activities of the engineered immune cell.
  • An endogenous T cell receptor (TCR) of the engineered immune cell may be inactivated.
  • the number of affected cells in peripheral blood or the number of affected cells in bone marrow of the patient can be reduced by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more within a period (e.g., 3 weeks) after a last dosing of the engineered immune cells.
  • the period after a last dosing of the engineered immune cell can be about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks or more.
  • the number of any one or more of autologous T cell, granulocyte, and NK cell in peripheral blood of the patient can start to increase within a period (e.g., 3 weeks) after a last dosing of the engineered immune cells.
  • the period after a last dosing of the engineered immune cell can be about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks or more.
  • the enhancer moiety can enhance one or more activities of the engineered immune cell.
  • the enhancer moiety can be configured to constitutively enhance the one or more activities of the engineered immune cell.
  • the enhancer moiety can be configured to constitutively upregulate one or more intracellular signaling pathways of the engineered immune cell.
  • the one or more intracellular signaling pathways can be one or more cytokine signaling pathways.
  • the enhancer moiety can be a cytokine or a cytokine receptor.
  • the enhancer moiety can be selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, IL-15, IL-17, IL-18, IL-21, IL-23, PD-1, PD-L1, CD122, CSF1R, CTAL-4, TIM-3, CCL21, CCL19, TGFR beta, receptors for the same, functional fragments thereof, functional variants thereof, and combinations thereof.
  • the engineered immune cell can further comprise an inducible cell death moiety capable of effecting death of the cell upon contacting the inducible cell death moiety with a cell death activator.
  • the inducible cell death moiety can be selected from the group consisting of rapaCasp9, iCasp9, HSV-TK, ACD20, mTMPK, ACD19, RQR8, Her2t, CD30, BCMA, and EGFRt.
  • the inducible cell death moiety can be EGFRt
  • the cell death activator can be an antibody or an antigen binding fragment thereof that binds EGFRt.
  • the inducible cell death moiety can be HSV-TK, and the cell death activator can be GCV.
  • the inducible cell death moiety can be iCasp9, and the cell death activator can be AP1903.
  • a gene encoding an endogenous surface marker of the cell can be inactivated.
  • the endogenous surface marker can be capable of binding to the first antigen binding domain when expressed.
  • the endogenous surface marker can be CD2, CD3, CD4, CD5, CD7, CD8, CD16a, CD16b, CD25, CD27, CD28, CD30, CD38, CD45, CD48, CD50, CD52, CD56, CD57, CD62L, CD69, CD94, CD100, CD102, CD122, CD127, CD132, CD137, CD160, CD161, CD178, CD218, CD226, CD244, CD159a (NKG2A), CD159c (NKG2C), NKG2E, CD279, CD314 (NKG2D), CD305, CD335 (NKP46), CD337, CD319 (CS1), TCR ⁇ , TCR ⁇ or SLAMF7.
  • the number of any one or more of autologous T cell, granulocyte, and NK cell in peripheral blood of the patient may start to increase before the number of affected cells in peripheral blood or the number of affected cells in bone marrow is reduced by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the number of any one or more of autologous T cell, granulocyte, and NK cell in peripheral blood may start to increase after the number of affected cells in peripheral blood or the number of affected cells in bone marrow is reduced by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • PBMCs Peripheral Blood Mononuclear Cells
  • PBMCs Peripheral blood mononuclear cells
  • Rap cells (Burkitt's lymphoma cells, ATCC-CCL86);
  • K562 cells Human erythroleukemia cell line, ATCC-CCL243;
  • Raji-ffluc cell line obtained by screening Raji cells transfected with lentivirus having firefly luciferase
  • 293T cells (ATCC-CRL3216).
  • Raji cells, K562 cells and Raji-ffluc cell line were cultured in RPMI1640 medium, and 293T cells were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate. All of the cells were cultured in an incubator at 37° C., 5% Co 2 .
  • T cells and the obtained CAR-T cells were cultured in X-vivo15 medium (containing 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2).
  • the culture medium for CAR-T cells was further supplemented with rhIL-2 (ThermoFisher Scientific) at a final concentration of 300 IU/ml every two days. All of the cells were cultured in an incubator at 37° C., 5% CO 2 .
  • the structure of the chimeric antigen receptor is EGFRt-CD3 scFv-CD19 scFv-Hinge-TM-CD28-CD3 ⁇ (tandem), tEGFR-CD19 scFv-CD28-CD3 ⁇ -CD3 scFv-41BB-CD3 ⁇ (Parallel), tEGFR-CD3 scFv-CD19 scFv41BB-CD3 ⁇ (Tandem), and CD19VL-CD3VL-CD3VH-CD19VH-41BB-CD3 ⁇ (Loop), wherein EGFRt (or tEGFR) is a truncated EGFR as a switch, CD3 scFv fragment is the heavy chain and light chain variable region of monoclonal antibody OKT3 or UCHT1 (connected by a GS linker), CD 19 scFv fragment is the heavy chain and light chain variable region of monoclonal antibody FMC63 (connected by a GS link
  • amino acid sequence of EGFRt-OKT3-FMC63-CD28z (SEQ ID NO.: 1) is as set forth below:
  • the underlined part is the safety switch signal peptide region
  • the italic part is tEGFR
  • the italic underlined part is tEGFR TM
  • the curve underlined part is P2A
  • the italic curve underlined part is CAR signal peptide
  • the bold part is OKT3 VH
  • the dashed underlined part is a linking peptide
  • the bold underlined part is OKT3 VL
  • the bold italic part is FMC63 VL
  • the bold italic underlined part is FMC63 VH
  • the boxed part is CD28 hinge region transmembrane region and costimulatory domain
  • the boxed italic part is CD3z.
  • nucleotide acid sequence of EGFRt-OKT3-FMC63-CD28z is as set forth in SEQ ID NO.: 2.
  • amino acid sequence of EGFRt-UCHT1-FMC63-CD28z (SEQ ID NO.: 3) is as set forth below:
  • the underlined part is the safety switch signal peptide (GMCSFR-L), the italic part is tEGFR, the italic underlined part is tEGFR TM, the curve underlined part is P2A, the italic curve underlined part is CAR signal peptide (CD8 L), the bold part is UCHT1 VL, the dashed underlined part is the linking peptide, the bold underlined part is UCHT1 VH, the bold italic part is FMC63 VH, the bold italic underlined part is FMC63 VL, the boxed part is CD28 hinge region transmembrane region and costimulatory domain, and the boxed italic part is CD3z.
  • GMCSFR-L safety switch signal peptide
  • the italic part is tEGFR
  • the italic underlined part is tEGFR TM
  • the curve underlined part is P2A
  • the italic curve underlined part is CAR
  • nucleotide acid sequence of EGFRt-UCHT1-FMC63-CD28z is as set forth in SEQ ID NO.: 4.
  • the CAR gene was cloned into the FUW lentiviral vector backbone under the promoter of EF1 ⁇ (EF-1 ⁇ ) to form Fuw-EF1 ⁇ -CAR.
  • Fuw-EF1 ⁇ -CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transfected into 293 T cells by using Lipofectamine3000 to prepare the whole lentiviral expression vector. The supernatant was collected at 48 and 72 h and subject to ultra-centrifuge (Merck Millipore) for concentration. The concentrated virus was ready for the transfection of T cells.
  • gRNA sequences targeting the first exon of the TCR conserved region were designed at http://crispr.mit.edu, and two gRNA sequences with scores above 80 were selected for higher knockout efficiency.
  • the forward primer comprises a T7 promotor followed by 20 bp of the target sequence, and the reverse primer has 20 bp of the complementary sequence.
  • pX330 plasmid was used as the PCR template. After purification, T7-PCR product was further used as the template for MEGAshortscript T7 kit to obtain RNA. The RNA was purified with a MEGAclear column and eluted with RNA-free water. Cas9 plasmid was purchased from Addgene.
  • the gRNA targeting sequences are as below:
  • TRAC-gRNA TGTGCTAGACATGAGGTCTA,; SEQ ID NO: 5
  • monocytes were isolated by using Histopaque-1077 (Sigma-Aldrich) through density gradient centrifugation. Then T cells were enriched, activated by magnetic beads coupled with anti-CD3/anti-CD28, cultured and expanded.
  • X-vivo 15 with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2 was used as CAR-T cell medium.
  • the cells were incubated and cultured at 37° C., 5% CO 2 .
  • Cell line expressing CD 19 Raji (Burkitt's lymphoma cell line, ATCC-CCL86); K562 cells (Human erythroleukemia cell line, ATCC-CCL243); Raji-ffluc cell line was obtained by screening Raji cells transfected with lentivirus having firefly luciferase;
  • Cell line expressing CD3 Jurkat cell.
  • RPMI1640 All of the cells were cultured in RPMI1640 medium and 293T cells (ATCC-CRL3216) were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate.
  • the anti-CD3/anti-CD28 magnetic beads and the cells were collected into a tube and subject to centrifuge at 300 g for 5 min, and then washed twice with DPBS and re-suspended in opti-mem at a cell density of 1-3 ⁇ 10 8 /ml.
  • the amount of cas9/gRNA required was calculated based on the density of the cells, 30 ⁇ g/ml each.
  • Cas9 and gRNA were 1:1 mixed, and incubated at room temperature for 10 mins and then transferred to electroporation buffer to further mix with the cells for electroporation by 4D-Nucleofector System N (Lonza) system. Then the cells were re-suspended in a pre-warmed medium to a density of 1-2 ⁇ 10 6 /ml, transferred to a plate and then cultured in an incubator at 37° C., 5% CO 2 .
  • the cells were transfected by lentiviral vector at MOI of 2-8, transferred to a flask and cultured at 37° C., 5% Co 2 .
  • FIG. 3 shows flow cytometry data of fractions of the engineered immune cells expressing dual-CARs or control cells with or without specified markers.
  • CD3 can be a marker indictive of endogenous TCR knockout efficiency
  • 3CAR CAR targeting CD3
  • 19CAR CAR targeting CD19
  • EGFR can be a marker indictive of CAR-T expressing EGFRt.
  • FIG. 4 shows another flow cytometry data of fractions of the engineered immune cells expressing dual-CARs or control cells with or without specified markers.
  • FIG. 3CAR CAR targeting CD3
  • 19CAR CAR targeting CD19
  • EGFR can be a marker indictive of CAR-T expressing EGFRt.
  • FIG. 4 shows another flow cytometry data of fractions of the engineered immune cells expressing dual-CARs or control cells with or without specified markers.
  • the CAR targeting CD19 was a scFv of monoclonal antibody FMC63
  • the CAR targeting CD3 was a scFv of monoclonal antibody OKT3 or UCHT1.
  • the result shows that positive ratio of EGFR and CAR and negative ratio of CD3 were high in the prepared EGFRt-CD3-CD19 CAR-T cells, indicating the gene knockout dual CAR-T cells (e.g., parallel-EGFRt) with safety switch (e.g., EGFRt) were successfully prepared.
  • CBA kit Cytokine bead array kit
  • a stably transfected cell line was obtained by introducing the luciferase gene into the target cell followed by screening. After adding fluorescein, luciferase could react with the fluorescein to produce fluorescence. By detecting the intensity of the fluorescence, the activity of luciferase can be measured, and the survival of the cells can be detected so that to evaluate the killing effect of CART cells.
  • FIG. 5A shows bar-graphs of cytotoxicity of CAR-T cells, including CAR-T cells targeting CD3 with scFv of monoclonal antibody OKT3 or UCHT1, dual-specific CAR-T cells targeting CD19 and CD3 (para193-O and para193-U), CD19 CAR with endogenous TCR knocked out (TCR KO CD19 CAR), and T cells controls with endogenous TCR knocked out (TCR KO T cell control), toward CD19+ NALM6-Luc cells and CD3+ Jurkat-Luc cells at 1:1 E:T (Effector CAR-T cells to Target cancer cells) ratio for 6 hours and 24 hours, respectively.
  • FIG. 1 shows bar-graphs of cytotoxicity of CAR-T cells, including CAR-T cells targeting CD3 with scFv of monoclonal antibody OKT3 or UCHT1, dual-specific CAR-T cells targeting CD19 and CD3 (para193-O and para193-U), CD19 CAR with end
  • FIG. 5B shows cytotoxicity of CAR-T cells toward Jurket cells measured from Day 1 to Day3 of co-culture of Jurkat cells and CAR-T cells at 1:1 E:T ratio.
  • FIG. 5C shows cytotoxicity of CAR-T cells toward T cells expressing CD3 measured from Day1 to Day 3 of co-culture of NALM6 cells and CAR-T cells at 1:1 E:T ratio.
  • the cytotoxicity of the dual-specific CAR-T cells targeting CD19 and CD3 were also tested against NALM6-LucG, Jurkat-LucG, Raji, allogeneic NTcells (non-treated T cells), and autologous NT cells.
  • FIG. 6A shows 40 hour cytotoxicity of CAR-T cells toward NALM6 cells at different effector: target ratios.
  • FIG. 6B shows 6 hour cytotoxicity of CAR-T cells toward Jurkat cells at different effector: target ratios.
  • FIG. 6C shows 40 hour cytotoxicity of CAR-T cells toward Jurkat, allogeneic NT cells, autologous NT cells, Raji cells, and NALM6 cells.
  • FIG. 7A shows 16 hour cytotoxicity of dual-specific CAR-T cells in parallel or loop form toward NALM6 cells.
  • CD19-CD3 dual-specific CAR-T cells showed comparable anti-tumor efficacy to single CD19 CAR-T cells.
  • FIG. 7B shows 16 hour cytotoxicity of dual-specific CAR-T cells in parallel or loop form toward Jurkat cells.
  • CD19-CD3 dual-specific CAR-T cells showed comparable anti-tumor efficacy to single CD3 CAR-T cells.
  • EGFRt-CD3-CD19 CAR-T cells significantly killed Nalm6, Raji, Jurkat and primary allogeneic PBMCs, indicating the function of CAR-T against CD19-positive or CD3-positive target cells, and their capabilities of simultaneous targeting both CD19+ cancer cells and CD3+ killer T cells.
  • NPG mice NOD-Prkdcscid Il2rgnull mice were selected and intraperitoneally injected with 2 ⁇ 10 5 Raji-ffluc cells or Jurkat-ffluc cells, 50 ⁇ L DPBS and 50 ⁇ L matrigel matrix (Corning). Two days later, the tumor graft burden of the mice was measured, and the mice were divided into 4 groups based on the tumor burden. One day later, 200 ⁇ L DPBS, 5 ⁇ 10 6 NT cells and 5 ⁇ 10 6 EGFRt-CD3-CD19 CAR-T cells were respectively injected to each mouse. The tumor burden of the mice was further evaluated 7 days after the CAR-T treatment. Then each mouse was injected intraperitoneally with 3 mg d-luciferin for a 4-minutes reaction, and subsequently photographed by using a Xenogen IVIS Imaging System with 30 s exposure.
  • EGFRt-CD3-CD19 CAR-T significantly decreased the tumor burden compared to NT cells for tumors from by both Raji-ffluc and Jurkat-ffluc cells, indicating EGFRt-CD3-CD19 CAR-T can clear CD19 positive or CD3 positive target cells in vivo.
  • mice were systemically treated with a sub-lethal dose of irradiation (175 cGy) first. Then CAR-T cells were re-suspended in PBS and injected into the thorax of the treated mice. The mice were observed 2-3 times a week by using GVHD clinical criteria including weight loss, arch-back, activity, fur texture, and skin integrity.
  • mice without TCR knockout showed GVHD symptoms, however, no GVHD was detected in the EGFRt-CD3-CD19 CAR-T+TCR dual knockout group.
  • FIGS. 66A-C show the in vivo GvHD study comparing CD19 CAR-T vs TCR KO CD19 CAR-T cells.
  • 2e7 CD19 CAR-T or TCR KO CD19 CAR-T cells were infused into each Raji-tumor bearing NOG mice to compare GvHD response.
  • Mice from CD19 CAR-T group showed significant CAR-T expansion along with severe weight loss (>20%), arch-back, ruffled fur, and early death compared with TCR KO CAR-T cells.
  • No GVHD was detected in any TCR KO CD19 CAR-T infused mice.
  • EGFRt-CD3-CD19 CAR-T+TCR knockout and EGFRt-CD3-CD19 CAR-T+TCR/B2M dual knockout cells were 1:1 incubated with NK cells overnight to detect apoptosis and cytokine release (IFN- ⁇ ).
  • HVG can also induce allogeneic T cells against HLA intact CAR-T cells.
  • FIG. 6C shows that dual CAR-T cells can target allogeneic T cells within 40 hours, preventing CAR-T rejection by host allogeneic T cells, which usually takes 72 hours.
  • NK cells were isolated from PBMCs as effector cells, and 1:1 co-cultured with CD19-28z CART or EGFRt-CD3-CD19 CAR-T, with or without Cetuximab at a final concentration of 10 ⁇ g/mL. 4 h and 24 h later, the expression of CD3 and CAR was detected by flow cytometry.
  • ADCC percentage (1 ⁇ monoclonal antibody group CAR positive ratio/no antibody group CAR positive ratio)*100%
  • NK cells significantly cleared EGFRt-CD3-CD19 CAR-T cells, but failed to clear CD19-28z CART. Without Cetuximab, NK failed to kill either of the cells. This indicates that Cetuximab functions as a safety switch, which binds to EGFRt-CD3-CD19 CAR-T, and allows NK to mediate the ADCC function so that to clear CART cells.
  • FIG. 8A shows tumor burden post CAR-T treatment. TCR intact CD19 CAR-T cells were able to eliminate tumors, but TCR KO CD19 CAR-T wasn't able to control Raji tumor growth.
  • FIG. 8B shows CAR-T proliferation in peripheral blood.
  • TCR KO CAR-T cells showed a proliferation defects compared to WT CAR-T cells, the peak of CAR-T cell expansion is much weaker than that of WT cells, which is consistent with their tumor control effects.
  • FIGS. 9A-9C show proliferation of CD19 CAR-T cells with TCR knockout.
  • FIG. 9A shows an experimental timeline of repeated stimulations by NALM6 cells and measurements of residual tumor cells.
  • FIG. 9B shows the proliferation data of CD19 CAR-T cells with TCR knockout and expression of different enhancers in comparison to CD19 CAR-T cells without TCR knockout and CD19 CAR-T cells with TCR knockout but without expression of the enhancers. Additions of NALM6 cells are indicated by arrows according to the experimental trimline in FIG. 9A .
  • FIG. 9B shows the clearing activity of various CD19 CAR-T cells as indicated by the amount of residual tumor cells measured at the indicated days according to the experimental timeline in FIG. 9A . Under multiple rounds or repeated stimulations by NALM6 cells, the CD19 CAR-T cells with TCR knockout and C7R or IL7 exhibited persistent expansion and enhanced expansion ability compared with other cells tested in this experiment.
  • FIGS. 10A and 10B show additional proliferation data comparing expansion ability of engineered CAR-T cells.
  • FIG. 10A shows proliferation data of CD19 CAR-T cells with TCR knockout and two different enhancers (C7R and IL2) in comparison to cells without the expression of the enhancer. The results showed that under multiple rounds or repeated stimulation by NALM6 cells, CD19 CAR-T cells with TCR knockout and C7R or IL2 exhibited persistent expansion and enhanced expansion ability compared with the cell without the expression of any enhancer.
  • FIG. 10B shows proliferation data of CD7 CAR-T cells with TCR knockout and two different enhancers (C7R and mbIL15) in comparison to cells without the expression of the enhancer.
  • CD7 CAR-T cells with TCR knockout and C7R or mbIL15 exhibited persistent expansion and enhanced expansion ability compared with the cell without the expression of any enhancer.
  • the cells with the expression of C7R exhibited better expansion ability than the cells expressing mbIL15.
  • FIG. 11 shows an example of in vivo comparison of enhancers in TCR KO CD19 CAR-T cells.
  • 5 ⁇ 10 5 Raji-luciferase cells were grafted into NOG mice by intravenous (IV) injection and grew for 5 days.
  • TCR KO CD19 CAR-T cells CD19 CAR-T cells with TCR knockout
  • enhancers as well as vehicle and T cell controls were intravenously infused (IV) into Raji grafted mice. Tumor burden was assessed by bioluminescence intensity (BLI).
  • FIG. 12 shows corresponding images of the NOG mice indicating tumor burden assessed by BLI.
  • PBMCs Peripheral Blood Mononuclear Cells
  • PBMCs Peripheral blood mononuclear cells
  • CCRF-CEM T lymphoblast, ATCC® CCL-119TM
  • CCRF-CEM-luc cells obtained by screening CCRF-CEM cells transfected with lentivirus having firefly luciferase
  • K562 cells Human erythroleukemia cell line, ATCC-CCL243;
  • NK92 cells (ATCC-CRL2407).
  • the CCRF-CEM-luc cell line was cultured in RPMI1640 medium, and 293T cells were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate. All of the cells were cultured in an incubator at 37° C., 5% Co 2 .
  • NK92 cells were cultured in RPMI1640 medium supplemented with 10% (v/v) fetal bovine serum, 2 mM glutamine, 1 mM sodium pyruvate, 1% NEAA, 0.1 mM mercaptoethanol and 200 IU/ml rhIL2.
  • T cells and the obtained CAR-T cells were cultured in X-vivo15 medium (containing 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2).
  • the culture medium for CAR-T cells was further supplemented with rhIL-2 (ThermoFisher Scientific) at a final concentration of 300 IU/ml every two days. All of the cells were cultured in an incubator at 37° C., 5% CO 2 .
  • CD7 and TCR gRNAs for gene editing were selected after evaluating gene editing efficiency and off-target risk at website http://crispr.mit.edu, www.idtdna.com and https://www.synthego.com.
  • gRNAs and HiFi-Cas9 protein used in the present disclosure were purchased from Integrated DNA Technologies, Inc (IDT).
  • RNP ribonucleoprotein
  • TRAC-gRNA1 has a higher knockout efficiency for TCR (the sequence is set forth as SEQ ID NO.: 20).
  • SEQ ID NO.: 20 the sequence is set forth as SEQ ID NO.: 20.
  • CD7-gRNA1 SEQ ID NO.: 34 was selected as the gRNA to knockout CD7.
  • TRAC-gRNA1 TTCGGAACCCAATCACTGAC,; SEQ ID NO 20 CD7-gRNA1: GAGGTCAATGTCTACGGCTC,. SEQ ID NO 25
  • CD2 gRNA2 showed the highest CD2 knockout efficiencies (as shown in FIG. 65 ).
  • CD2-gRNA1 CAAAGAGATTACGAATGCCT (SEQ ID NO: 29)
  • CD2-gRNA2 GTGCCACAAAGACCATCAAG (SEQ ID NO: 30)
  • CD2-gRNA3 AGAGGGTCATCACACACAAG (SEQ ID NO: 31)
  • CD2-gRNA4 CTTGTAGATATCCTGATCAT (SEQ ID NO: 32)
  • the structure of the chimeric antigen receptor and the cytokines are: CAR7, CAR7-mb15 and CAR7-C7R (as shown in FIG. 17 ).
  • the nucleotide sequences and amino acid sequences are set forth as SEQ ID NO.: 35-40.
  • the amino acid sequence of two CD2 scFv constructed to single or a dual CAR are as below:
  • CD2 scFv1 VH (SEQ ID NO: 95) QLQQPGAELVRPGSSVKLSCKASGYTFTRYWIHWVKQRPIQGLEWIGNID PSDSETHYNQKFKDKATLTVDKSSGTAYMQLSSLTSEDSAVYYCATEDLY YAMEYWGQGTSVTVSS
  • CD2 scFv1 VL (SEQ ID NO: 96) DIMMTQSPSSLAVSAGEKVTMTCKSSQSVLYSSNQKNYLAWYQQKPGQSP KLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQPEDLAVYYCHQYLSS HTFGGGTKLEIKR
  • CD2 scFv2 VH (SEQ ID NO: 97) QVQLQQPGTELVRPGSSVKLSCKASGYTFTSYWVNWVKQRPDQGLEWIGR IDPYDSETHYNQKFTDKAISTIDTSSNTAY
  • the CAR genes were cloned into the FUW lentiviral vector backbone under the promoter of EF a (EF-1 ⁇ ) to form Fuw-EF1 ⁇ -CAR.
  • Fuw-EF1 ⁇ -CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transfected into 293 T cells by using Lipofectamine3000 to prepare the whole lentiviral expression vector. The supernatant was collected at 48 and 72 h and subject to ultra-centrifuge (Merck Millipore) for concentration.
  • the whole preparation process is illustrated in FIG. 15 .
  • monocytes were isolated using Histopaque-1077 (Sigma-Aldrich) by density gradient centrifugation. T cells were then enriched, activated by magnetic beads coupled with anti-CD3/anti-CD28, cultured and expanded.
  • UCAR-T cell medium X-vivo 15 with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2 was used as UCAR-T cell medium. The cells were incubated and cultured at 37° C., 5% CO 2 .
  • the anti-CD3/anti-CD28 magnetic beads were removed and the cells were collected into a tube and subject to centrifuge at 300 g for 5 min, and then washed twice with DPBS and re-suspended in opti-mem at a cell density of 50 ⁇ 10 6 /ml.
  • the amount of cas9/gRNA RNP required was calculated based on the density of the cells, and then mixed with cells and transferred for electroporation by 4D-Nucleofector System N (Lonza) system. Then the cells were re-suspended in a pre-warmed medium to a density of 2 ⁇ 10 6 /ml.
  • the cells were further subject to lentiviral transfection at MOI of 2-8, transferred to a flask and cultured in an incubator at 37° C., 5% Co 2 .
  • pSTAT5 level of CAR7 went down to basal level.
  • the level of pSTAT5 in CAR7-C7R T cells (CD34+ cells) or CAR7-T cells with exogenous IL2 addition were at quite high levels, indicating expression of C7R and exogenously added IL-2 can both enhance the activation of STAT5 signaling pathway.
  • a stably transfected CCRF-CEM-luc cell line was obtained by introducing the luciferase gene into the target cell CCRF-CEM followed by screening. After adding fluorescein, luciferase could react with the fluorescein to produce fluorescence. By detecting the intensity of the fluorescence, the activity of luciferase can be measured, and the survival of the cells can be detected so that to evaluate the killing effect of UCAR-T cells.
  • the UCAR-T cells prepared in Example 3.3 were mixed with CD-7 positive T cell CCRF-CEM-luc, 100 ul each, in RPMI medium at 1:1 ratio to a density of 1 ⁇ 106/ml for each cell, and then cultured for a certain period of time in a 96-well plate. The medium was then collected and subject to centrifuge and the cytokine IFN- ⁇ and IL-2 were detected by Cytokine bead array kit (CBA kit, BD Biosciences). In addition, fluorescein substrate was added to the cell culture to detect the killing effect of the UCAR-T cells. The result shows that UCAR-T has a significant killing effect on CCRF-CEM tumor within 24 hours ( FIG. 20 ).
  • allogeneic T cells were labeled with CFSE and incubated with CAR-T for a predetermined period of time. Then changes in the number of CFSE positive cells were analyzed by flow cytometry. The result shows that CAR-T cells efficiently killed allogeneic T cells within 24 hours, which is much shorter than the time for allo-T cell mediated HVG to happen, and thus CAR7 can effectively protect CAR-T cells from allogeneic T cell killing ( FIG. 21 ).
  • NK92 The 24 hour killing effect of UCAR-T on NK tumor cell line (NK92): NK92 was labeled with carboxyfluorescein succinimidyl ester (CFSE) and incubated with UCAR-T for a predetermined period of time. Then changes in the number of CFSE positive cells were analyzed by flow cytometry, so that to calculate the in vitro killing effect of UCAR-T on NK92 tumor cell line ( FIG. 22 ).
  • CFSE carboxyfluorescein succinimidyl ester
  • CAR-T cells were continuously cultured for 2 weeks and counted twice a week to measure the proliferation.
  • FIGS. 23A and 23B shows that CAR7-mb15 and CAR7-C7R CAR-T cells had stronger proliferation rate than CAR7 CAR-T cells, and in absence of IL-2, they still had higher survival ratio within 2 weeks. CAR7-C7R showed better survival than CAR7-mb15.
  • In vitro killing assay indicates that the UCAR-T cells have superior killing effect against T-ALL cell line CCRF-CEM within 7 hours.
  • IL-2 was removed from UCAR-T.
  • CCRF-CEM was added twice a week at 1:1 effector: target ratio and counted twice a week to measure the proliferation.
  • FIGS. 24A and 24B show that after adding CCRF-CEM, CAR7-mb15 and CAR7-C7R UCAR-T cells showed significantly stronger proliferation than CAR7 UCAR-T and CAR7-C7R UCAR-T cells proliferated better than CAR7-mbIL15 UCAR-T cells.
  • UCAR-T cells still showed significant ability to remove tumor cells, indicating after repeated antigen stimulation, the cytokine-related signaling pathway enhanced UCAR-T cells has a higher proliferation rate, and can survive better.
  • NOD/Shi-scid/IL-2R ⁇ null (NOG) mice were selected and intraperitoneally injected with 2 ⁇ 10 6 CCRF-CEM-luc cells. Two days later, the tumor graft burden of the mice was measured, and the mice were divided into 5 groups based on the tumor burden. 6 days after the tumor implantation, 1 ⁇ 10 6 UCAR-T or control was injected intravenously to each mouse, and the tumor burden was further evaluated every 1-2 weeks. Each mouse was injected intraperitoneally with 3 mg D-luciferin for a 4-minutes reaction, and then photographed using a Xenogen IVIS Imaging System with 30 s exposure (BLI). UCAR-T cell number in peripheral blood was counted every week.
  • FIG. 25 shows that CAR7-mb15 and CAR7-C7R UCAR-T had significant expansion, and CAR7 UCAR-T did not show any significant expansion.
  • FIG. 26 shows the result of BLI imaging, and it can be seen that CAR7-mb15 and CAR7-C7R UCAR-T cells had better effect on tumor clearance than CAR7 UCAR-T cells.
  • FIG. 27 shows BLI images of the mice treated with vehicle control or CAR7 UCAR-T cells with TCR knockout and with or without expression of enhancers.
  • CAR7 UCAR-T cells with TCR knockout and the expression of C7R or mbIL15 exhibited better efficiency on tumor clearance in comparison to vehicle control and TCR KO CAR7 UCAR-T cells without the expression of any enhancers.
  • C7R expressing CAR7 cells showed better tumor control and mouse survival than that expressing mbIL15.
  • “CAR7,” “CAR7 UCAR-T,” or CD7 CAR-T” can be used interchangeably to indicate an engineered CAR-T cell comprising a CAR targeting CD7.
  • FIG. 28A BLI imaging shows in vivo function of CD7 CAR-T cells in clearing tumor cells.
  • TCR KO CD7 CAR-T cells with the expression C7R or mbIL15 exhibited better in vivo efficiency on tumor clearance in comparison to vehicle control and TCR KO CD7 CAR-T cells without the expression of any enhancers.
  • FIG. 28B shows animal survival data of the NOG mice treated with TCR KO CD7 CAR-T with or without the expression of enhancer and vehicle control. Percentage of survived mice were measured against days after CAR-T cell infusion.
  • mice treated with TCR KO CD7 CAR-T with expression of C7R or mbIL15 had a better survival rate in comparison to mice treated with CAR-T cells without the expression enhancer or vehicle control.
  • C7R expressing CAR7 cells showed better tumor control and mouse survival than that expressing mbIL15.
  • FIG. 55A shows expansion data of CAR-T cells.
  • Freshly prepared CD7 CAR-T cells expressing C7R were cultured in T cell culture media without supplement of IL2 or antigen stimulation, compared to control cells that do not have C7R or any enhancer expression, CD7 CAR-T cells expressing C7R maintained better expansion and persisted in culture.
  • FIG. 55B shows proliferation of CAR-T cells in the presence of stimulation.
  • CD7 CAR-T (or UCART7), CD7 CAR-T expressing mbIL15 or C7R were repetitively stimulated by CCRF-CEM (CD7+ T-ALL cells).
  • the CD7 CAR-T expressing C7R showed the best persistence and proliferation.
  • CD7 CAR-T expressing mbIL15/C7R stopped proliferation when antigen stimulation was removed at round 6 of stimulation (CC6).
  • CC indicates co-culture with cancer cells.
  • mice were systemically treated with a sub-lethal dose of irradiation (175 cGy) first. Then CAR-T cells were re-suspended in PBS and injected into the thorax of the treated mice. The mice were observed 2-3 times a week by using GVHD clinical criteria including weight loss, arch-back, activity, fur texture, and skin integrity.
  • mice in groups without TCR knockout all showed symptoms of GVHD, however, no GVHD was detected in TCR knockout group.
  • FIGS. 54A-C show the effect of TCR knockout in the CAR-T cells.
  • TCR expression in Mesothelin CAR-T cells were impaired to avoid TCR related adverse event.
  • TCR KO CAR-T cells unexpectedly showed significant expansion defects after infusion into the patients.
  • FIG. 54A shows example of TCR KO efficiency in autologous Mesothelin (MSLN) CAR+ T cells (left), and CAR+ T cells in patient's peripheral blood CAR-T cells at 13 days post infusion (right).
  • FIG. 54B shows TCR disruption efficiencies in autologous MSLN CAR-T products were highly effective, with less than 5% TCR+ cells remaining in the product.
  • FIG. 54C shows that TCR+ cells showed 40 to ⁇ 1000 fold more expansion than TCR-cells in cancer patients. Therefore, even in autologous CAR-T applications, where there is no cell survival and expansion pressure from allogeneic killer cells, TCR disruption dramatically impaired CAR-T cell expansion.
  • the structure of the chimeric antigen receptor is:
  • RQR8 is a safety switch
  • the CD19CAR fragment is the heavy chain and light chain variable region of monoclonal antibody FMC63 (connected by a GS linker), and also included are hinge region and transmembrane region, human CD 28 intracellular co-stimulatory element, and human CD3 ⁇ intracellular region in tandem
  • mbIL15 consists of IL15+IL15R ⁇ in tandem
  • C7R is a constitutively activated IL7 receptor consisting of CD34 extracellular domain and IL7 receptor transmembrane and intracellular domains
  • IL7 consists of IL7 signal peptide and mature peptide
  • mbIL7 consists of IL7+IL7Ra in tandem. Examples of the constructs described herein are shown in FIG. 29 .
  • RQR8 The amino acid sequence of RQR8 is as set forth below (SEQ ID NO.: 7):
  • RQR8 The DNA sequence of RQR8 is as set forth below (SEQ ID NO.: 8):
  • CD19CAR The amino acid sequence of CD19CAR is as set forth below (SEQ ID NO.: 9):
  • CD19CAR The DNA sequence of CD19CAR is as set forth below (SEQ ID NO.: 10):
  • amino acid sequence of mbIL15 is as set forth below (SEQ ID NO.: 11):
  • the underlined part is the signal peptide region
  • the italic part is IL-15
  • the bold part is the linking region
  • the dashed underlined part is IL-15 receptor ⁇ .
  • mbIL15 The DNA sequence of mbIL15 is as set forth below (SEQ ID NO.: 12):
  • amino acid sequence of IL7 is as set forth below (SEQ ID NO.: 13):
  • the DNA sequence of IL7 is as set forth below (SEQ ID NO.: 14):
  • amino acid sequence of C7R is as set forth below (SEQ ID NO.: 15):
  • the underlined part is CD34 extracellular region
  • the italic part is IL-7 receptor ⁇ transmembrane region
  • the bold part is IL-7 receptor a intracellular region.
  • amino acid sequence of mbIL7 is as set forth below (SEQ ID NO.: 17):
  • the underlined part is the signal peptide region
  • the italic part is IL-7
  • the bold part is the linking region
  • the dashed underlined part is IL-7 receptor ⁇ .
  • the above CAR genes were cloned into the FUW lentiviral vector backbone under the promoter of EF1 ⁇ (EF-1 ⁇ ) to form Fuw-EF1 ⁇ -CAR.
  • Fuw-EF1 ⁇ -CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transfected into 293 T cells by using Lipofectamine3000 to prepare the whole lentiviral expression vector. The supernatant was collected at 48 and 72 h and subject to ultra-centrifuge (Merck Millipore) for concentration. The concentrated virus was ready for the transfection of T cells.
  • gRNA sequences targeting the exon of the TCR conserved region were designed at http://crispr.mit.edu, and two gRNA sequences with scores above 80 were selected for higher knockout efficiency.
  • the forward primer comprises a T7 promotor followed by 20 bp of the target sequence, and the reverse primer has 20 bp of the complementary sequence.
  • Plasmids were used as PCR template. After purification, T7-PCR product was further used as the template for MEGAshortscript T7 kit to obtain RNA. The RNA was purified with a MEGAclear column and eluted with RNA-free water. Cas9 plasmid was purchased from Addgene.
  • the gRNA targeting sequences are as below:
  • TRAC-gRNA SEQ ID NO.: 5 TGTGCTAGACATGAGGTCTA
  • the knockout efficiency of the gRNA was analyzed by T7E1, TIDE and flow cytometry.
  • the result shows that the TCR gene was successfully knocked out with a knockout efficiency of higher than 90%.
  • monocytes were isolated using Histopaque-1077 (Sigma-Aldrich) by density gradient centrifugation. Then T cells were enriched, activated by magnetic beads coupled with anti-CD3/anti-CD28, cultured and expanded.
  • X-vivo 15 with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2 was used as CAR-T cell medium.
  • the cells were incubated and cultured at 37° C., 5% CO2.
  • Cell line expressing CD 19 Raji (Burkitt's lymphoma cell line, ATCC-CCL86); K562 cells (Human erythroleukemia cell line, ATCC-CCL243); Raji-ffluc cell line was obtained by screening Raji cells transfected with lentivirus having firefly luciferase;
  • RPMI1640 All of the cells were cultured in RPMI1640 medium and 293T cells (ATCC-CRL3216) were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate.
  • the anti-CD3/anti-CD28 magnetic beads were removed and the cells were collected into a tube.
  • Cas9 and gRNA as needed were mixed, incubated at room temperature and then transferred to electroporation buffer to further mix with the cells for electroporation by 4D-Nucleofector System N (Lonza) system. Then the cells were re-suspended in a pre-warmed medium to a density of 1-2 ⁇ 10 6 /ml, transferred to a plate and cultured in an incubator at 37° C., 5% CO 2 .
  • the cells were transfected by lentiviral vector at MOI of 2-8, transferred to a flask and cultured at 37° C., 5% CO 2 .
  • the sample was centrifuged to remove the medium, washed once with PBS, and then centrifuged at 400 g, 4° C. for 5 minutes. The supernatant was removed and specific surface antibodies CAR, CD3, CD4, and CD8 were added to each tube. Then the cells were re-suspended in 100 ⁇ l and put on ice for 30 minutes in dark.
  • a stably transfected cell line was obtained by introducing the luciferase gene into the target cell followed by screening.
  • the CAR-T cells prepared in Example 3 were mixed with CD19-positive tumor cells (Raji-luc, NALM6-luc) at different effector: target ratios.
  • luciferase could react with the fluorescein to produce fluorescence.
  • the intensity of the fluorescence the activity of luciferase can be measured, and the survival of the cells can be detected so that to evaluate the killing effect of CART cells.
  • CAR-T cells were continuously cultured for 2 weeks and counted twice a week to measure the proliferation.
  • IL-2 was removed from CAR-T.
  • K562-CD19 was added twice a week at 2 : 1 effector: target ratio.
  • the cells were cultured for 2 weeks and counted twice a week to measure cell proliferation
  • the result shows that after adding K562-CD19, RQR8-CD19CAR-MBIL15, RQR8-CD19CAR-MBIL15-IL7, RQR8-CD19CAR-C7R CAR-T cells showed significantly stronger proliferation rate than CD19 CAR-T.
  • the cell survival ratio was higher than CD19 CAR-T, indicating the cytokine-related signaling pathway enhanced CART has a higher proliferation rate, and can survive better.
  • NOD-Prkdcscid Il2rgnull (NOG) mice were selected and intraperitoneally injected with 2 ⁇ 10 5 Raji-ffluc cells, 50 ⁇ L DPBS and 50 ⁇ L matrigel matrix (Corning). Two days later, the tumor graft burden of the mice was measured, and the mice were divided into 4 groups based on the tumor burden. One day later, 200 ⁇ L DPBS, 5 ⁇ 10 6 NT cells, 5 ⁇ 10 6 CD19 CAR-T cells, RQR8-CD19CAR-MBIL15, RQR8-CD19CAR-MBIL15-IL7, RQR8-CD19CAR-C7R CAR-T cells were respectively injected to each mouse.
  • mice The tumor burden of the mice was further evaluated 7 days after the CAR-T treatment.
  • Each mouse was injected intraperitoneally with 3 mg d-luciferin for a 4-minutes reaction, and then photographed by using a Xenogen IVIS Imaging System with 30 s exposure.
  • mice were systemically treated with a sub-lethal dose of irradiation (175 cGy) first. Then CAR-T cells were re-suspended in PBS and injected into the thorax of the treated mice. The mice were observed 2-3 times a week by using GVHD clinical criteria including weight loss, arch-back, activity, fur texture, and skin integrity.
  • mice in the group without TCR knockout all showed symptoms of GVHD reaction, and no GVHD reaction was detected in TCR single knockout CAR-T cell groups.
  • NK cells were isolated from PBMCs as effector cells, and 1:1 co-cultured with CAR-T, with or without rituximab (Rutiximab) at a final concentration of 10 g/mL. 4 h and 24 h later, the expression CAR was detected by flow cytometry.
  • ADCC percentage (1 ⁇ monoclonal antibody group CAR positive ratio/no antibody group CAR positive ratio)*100%
  • NK cells significantly cleared RQR8-CD19CAR-MBIL15, RQR8-CD19CAR-MBIL15-IL7 and RQR8-CD19CAR-C7R CAR-T cells in the presence of Rutiximab, but failed to clear CD19 CAR-T. Without Rutiximab, NK failed to kill any of the cells. This indicates that Rutiximab can function as a safety switch, which binds to RQR8, and allows NK to mediate the ADCC function so that to clear CART cells.
  • FIG. 30 shows an example design of CAR-T cells expressing of enhancer E3.
  • E3 the ecto domain of C7R is replaced by a safety switch, such as EGFRt or Her2t or other peptides described in the present disclosure.
  • FIG. 31 shows flow cytometry data of fractions of CAR-T cells expressing CD19 CAR and the enhancer C7R or E3.
  • FIGS. 32A and 32B show in vitro killing activity of CAR-T cells toward HeLa cells expressing a CD19 antigen.
  • FIG. 32A shows in vitro killing activity of CD19 CAR-T cells expressing C7R or E3 in comparison with target only or T cell controls. The effector: target ratio in this experiment is 5:1.
  • FIG. 32B shows in vitro killing activity of CD19 CAR-T cells expressing C7R or E3 in comparison with target only or T cell controls. The effector: target ratio in this experiment is 1:1.
  • FIGS. 33A and 33B show expression of phosphorylated STAT5 (pSTAT5) and CD19 CAR in the tested engineered cells.
  • FIG. 33A shows flow cytometry data of fractions of CAR-T cells expressing CD19 CAR and pSTAT5.
  • FIG. 33B shows corresponding mean fluorescent index (MFI) of pSTAT5 of the data in FIG. 33A .
  • FIGS. 34A-C show proliferation data of CD19 CAR-T cells expressing C7R or E3 in comparison to CD19 CAR-T without enhancer.
  • FIG. 34A shows cytokine independent proliferation of the three different cells.
  • FIG. 34B shows proliferation under repeated NALM6 stimulations.
  • FIG. 34C shows percentage of CAR-T cells before and after the stimulation by NALM6. CAR stimulation enriched CAR+ cells.
  • FIG. 35A shows flow cytometry data of fractions of CAR-T cells co-cultured with NK cells at different effector: target ratios in the presence or absence of Cetuximab (CTX, anti-EGFR Antibody).
  • CTX Cetuximab
  • FIG. 35B shows the total killing activity of NK cells toward other cells.
  • FIG. 35C shows the killing activity of NK cells toward CAR-T cells.
  • FIGS. 36A and 36B show test of safety switch by ADCC after repeated stimulation.
  • FIG. 36A shows flow cytometry data of fractions of CAR-T cells co-cultured with NK cells at different effector: target ratios in the presence or absence of CTX. The cells shown in this example were repeated stimulated.
  • FIG. 36B shows killing activity of NK cells toward CAR-T cells.
  • FIG. 56A shows flow cytometry data of fractions of TCR KO CD7 CAR-T cells expressing CD7 CAR and enhancer C7R or E3 (EGFRt+IL7R ⁇ ) at day 12 of cell culture.
  • FIG. 56B shows 6-hour cytotoxicity of TCR KO CD7 CAR-T cells expressing CD7 CAR and enhancer C7R or E3 (EGFRt+IL7R ⁇ ) toward CCRF-CEM cells. The effector: target ratios tested in this experiment are 5:1 and 1:1.
  • FIG. 56C shows proliferation of TCR KO CD7 CART cells expressing C7R or E3 (EGFRt+IL7R ⁇ ).
  • FIG. 56D shows flow cytometry data of fractions of TCR KO CD7 CAR-T cells expressing phosphorylated STAT5 (pSTAT5) and C7R or E3.
  • pSTAT5 was highly upregulated in TCR KO CD7 CAR-T cells expressing C7R or E3.
  • CAR19 plus IL2 stimulation were used as positive control for pSTAT5.
  • FIG. 56E shows corresponding mean fluorescent index (MFI) of pSTAT5 of the data in FIG. 56D .
  • FIG. 68 shows BLI imaging of the in vivo efficacy of CAR7 and CAR7-E3 UCAR-T in CCRF-CEM (T-ALL) murine xenograft model.
  • T-ALL CCRF-CEM
  • Each mouse was inoculated intravenously with 3 ⁇ 10 5 CCRF-CEM cells.
  • CAR-T cells were intravenously infused (1 ⁇ 10 6 cells per mouse).
  • BLI imaging indicates CAR7-E3 UCAR-T cells had better effect on tumor clearance than CAR7 UCAR-T cells.
  • PBMCs Peripheral Blood Mononuclear Cells
  • PBMCs Peripheral blood mononuclear cells
  • K562 cells Human erythroleukemia cell line, ATCC-CCL243;
  • Raji-ffluc cell line obtained by screening Raji cells transfected with lentivirus having firefly luciferase
  • CCRF-CEM cells ATCC-CCL119
  • PBNK peripheral blood NK sorted from PBMC by using CD56 microbeads and cultured in NK serum free medium kit II (Cyagen Biosciences)+10% FBS+900 IU/ml IL2 (PeproTech);
  • NK92 cells ATCC-CRL2407;
  • NK92-ffluc cells obtained by screening NK92 cells transfected with lentivirus having firefly luciferase
  • Raji cells, Raji-ffluc cell line, and K562 cells were cultured in RPMI1640 medium, and 293T cells were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate. All of the cells were cultured in an incubator at 37° C., 5% Co 2 .
  • NK92 cells were cultured in RPMI1640 medium supplemented with 10% (v/v) fetal bovine serum, 2 mM glutamine, 1 mM sodium pyruvate, 1% NEAA, 0.1 mM mercaptoethanol and 200 IU/ml rhIL2.
  • T cells and the obtained CAR-T cells were cultured in X-vivo15 medium (containing 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2).
  • the culture medium for CAR-T cells was further supplemented with rhIL-2 (ThermoFisher Scientific) at a final concentration of 300 IU/ml every two days. All of the cells were cultured in an incubator at 37° C., 5% CO2.
  • TCR gRNAs for gene editing were selected after evaluating gene editing efficiency and off-target risk at website http://crispr.mit.edu, www.idtdna.com and https://www.synthego.com.
  • gRNAs used in the present disclosure were either synthesized by Integrated DNA Technologies, Inc (IDT) or prepared by in vitro transcription (See Shi et al., 2017, J Vis Exp. doi: 10.3791/55267). HiFi-Cas9 was purchased from IDT.
  • RNP ribonucleoprotein
  • gRNA targeting sequences used are as below:
  • TRAC-gRNA1 TTCGGAACCCAATCACTGAC
  • SEQ ID NO: 21 TRAC-gRNA2: TCAGGGTTCTGGATATCTGT
  • SEQ ID NO: 22 TRAC-gRNA3: AAGTTCCTGTGATGTCAAGC
  • SEQ ID NO: 25 CD7-gRNA1: GAGGTCAATGTCTACGGCTC
  • SEQ ID NO: 26 CD7-gRNA2: ATCACGGAGGTCAATGTCTA
  • SEQ ID NO: 27 CD7-gRNA3: GTAGACATTGACCTCCGTGA
  • SEQ ID NO: 28 CD7-gRNA4: GGAGCAGGTGATGTTGACGG
  • SEQ ID NO: 29 CD2-gRNA1: CAAAGAGATTACGAATGCCT
  • SEQ ID NO: 30 CD2-gRNA2: GTGCCACAAAGACCATCAAG
  • SEQ ID NO: 31 CD2-gRNA3: AGAGGGTCATCACACACAAG
  • SEQ ID NO: 32 CD2-gRNA
  • FIG. 16 shows efficiencies of CD7 knockout by using different CD7-gRNAs with TRAC-gRNA1, and CD7-gRNA1 and CD7-gRNA4 were obviously better, and CD7-gRNA1 was used in subsequent experiments.
  • the scFv of the CD7 single CAR is derived from TH69, 3Ale and SDZCHH380 antibodies.
  • the scFv in the CAR is designed as 3Ale-LH, TH69-LH, SDZ-LH, SDZ-HL.
  • the amino acid sequence of the CAR is as set forth in SEQ ID NO: 75-78.
  • the CAR gene was cloned into the FUW lentiviral vector backbone under the promoter of EF1 ⁇ (EF-1 ⁇ ) to form Fuw-EF1 ⁇ -CAR.
  • Fuw-EF1 ⁇ -CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transfected into 293 T cells by using Lipofectamine3000 or PEI to prepare the whole expression vector. The supernatant was collected at 48 and 72 h and subject to ultra-centrifuge (Merck Millipore) for concentration. The concentrated virus was ready for the transfection of T cells.
  • monocytes were isolated using Histopaque-1077 (Sigma-Aldrich) by density gradient centrifugation. Then T cells were enriched, activated by magnetic beads coupled with anti-CD3/anti-CD28, cultured and expanded.
  • X-vivo 15 with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2 was used as CAR-T cell medium.
  • the cells were incubated and cultured at 37° C., 5% CO2.
  • Cell line expressing CD 19 Raji (Burkitt's lymphoma cell line, ATCC-CCL86); K562 (ATCC-CCL243); Raji-ffluc and NK92 cell lines was obtained by screening cells transfected with lentivirus having firefly luciferase;
  • Cell line expressing CD7 and CD2 Jurkat cell, CCRF-CEM and NK92 cells.
  • RPMI1640 All of the cells were cultured in RPMI1640 medium and 293T cells (ATCC-CRL3216) were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate.
  • the anti-CD3/anti-CD28 magnetic beads were removed and the cells were collected into a tube and subject to centrifuge at 300 g for 5 min, and then washed twice with DPBS and re-suspended in opti-mem at a cell density of 50 ⁇ 10 6 /ml.
  • the amount of cas9/gRNA RNP required was calculated based on the density of the cells, and then mixed with cells and transferred for electroporation by 4D-Nucleofector System N (Lonza) system. Then the cells were re-suspended in a pre-warmed medium to a density of 1-2 ⁇ 10 6 /ml.
  • the cells were further subject to lentiviral transfection at MOI of 2-8, transferred to a flask and cultured in an incubator at 37° C., 5% Co 2 .
  • the number of cells and CAR positive cells were detected, and the positive ratio of CAR in T cells was calculated.
  • the positive ratio of TCR (or CD3), and CD7 was also detected to determine the knockout efficiency. Then the cells were continuously cultured in the incubator and half of the medium was replaced every 2-3 days till day 10 when the cells were ready for cryopreservation.
  • the expression of anti-CD7 CAR was successfully detected, among which TH69-LH shows the strongest expression, followed by 3Ale-LH, then SDZ-LH, and SDZ-HL.
  • 3Ale-LH CARs all showed the best killing effects on CD7-positive T cells, while TH69-LH, SDZ-LH and SDZ-HL CARs were less effective. Therefore, the scFv of 3Ale was selected for CD7 CAR in the dual CAR.
  • CD19-CD7 dual CAR targeting CD19 and CD7 is as illustrated in FIG. 37 and below:
  • Loop L719-LHLH and L719-HLHL, sequence as set forth in SEQ ID NO 79 and 80;
  • Tandem T197-LHLH, T197-LHLH-EAAAK3 (by using a linker with three connected EAAAK (SEQ ID NO: 102)), T719-LHLH, T719-LHHL, sequence as set forth in SEQ ID NO 81-84;
  • Loop dual CAR connected with a constitutively activated IL7 receptor C7R: L719-C7R, amino acid sequence as set forth in SEQ ID NO 85.
  • RTCA Real-Time Cell Analyzer
  • FIG. 42A shows that in vivo expanded PBNK cells (ratio of CD7+ cell was ⁇ 80%) were labelled with carboxyfluorescein succinimidyl ester (CFSE), and incubated with CAR-T cells for 1 day. Then the cells were subject to flow cytometry to analyze the change in ratio of CFSE positive cells.
  • FIG. 42A shows that dual CARs and CD7 single CAR had significant killing effects on NK cells, and CD19 single CAR and Mock T did not show any killing effect.
  • FIG. 42B shows that CD7+ cells in NK almost disappeared after co-culturing with dual CARs (L719-LHLH and T197-LHLH), indicating CAR7 and dual CARs completely killed the CD7+ cells in NK.
  • T719-LHLH and T719-LHHL were designed and compared with Loop CAR (L719-LHLH, also named as L719).
  • FIGS. 45A and 45B show that new Tandem dual CARs were successfully expressed ( FIG. 45A ), and also had significant killing effects on the remaining CD7+ cells after gene knockout ( FIG. 45B ).
  • RTCA Real-time Cell Analysis
  • FIGS. 47A and 47B shows that, Tandem dual CARs also had similar strong killing effects on allogeneic T cells and NK cells as L719 over 24 hours.
  • FIG. 48 shows that L719 and Tandem (T719-LHLH and T719-LHHL) dual CARs both greatly cleared the CCRF-CEM tumors in vivo (CCRF-CEM intravenous model in NOG mice).
  • CBA kit Cytokine bead array kit
  • mice were systemically treated with a sub-lethal dose of irradiation (175 cGy) first. Then CAR-T cells were re-suspended in PBS and injected into the thorax of the treated mice. The mice were observed 2-3 times a week by using GVHD clinical criteria including weight loss, arch-back, activity, fur texture, and skin integrity.
  • mice without TCR knockout showed GVHD symptoms, however, no GVHD was detected in the CD7-CD19 CAR-T+TCR/CD7double knockout group.
  • CD7 CAR can effectively and rapidly clear CD7+ cells, and in vitro experiments showed that allogeneic T cells did not display significant rejection on CAR-T cells expressing CD7 CAR, but displayed strong rejection on CAR-T cells expressing CAR19 only.
  • the allogeneic NK cells showed significantly less rejection on CAR-T cells expressing CD7 CAR than CAR-T cells without CD7 CAR.
  • rapaC9-L719 (SEQ ID NO. 86) MASRILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET SFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISKLEYSGGGSLEG VQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLESGGGGSGGGGS GGGGSGVDGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNI DCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQAS HLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTS PEDESPGSNPEPDATPFQEGLRTFDQ
  • FIG. 50A shows the expression of CD19 and CD7 antigen binding domains in L719 and L719-C7R dual CAR-T cells.
  • FIG. 50B shows cytotoxicity of L719 dual CAR-T cells with or without C7R expression toward HeLa cells expressing CD7 (HeLa-CD7).
  • FIG. 50C show cytotoxicity of L719 dual CAR-T cells with or without C7R expression toward HeLa cells expressing CD19 (HeLa-CD19). The effector: target ratio tested in FIGS.
  • FIGS. 50B and 50C is 4:1.
  • FIGS. 50B and 50C show that both L719 and L719-C7R effectively killed HeLa-CD7 and HeLa-CD19.
  • FIG. 50D shows flow cytometry data of fractions of L719 dual CAR-T cells expressing both an enhancer (C7R or E3) and CD7.
  • FIG. 50E shows 6-hour cytotoxicity data of L719 dual CAR-T cells expressing C7R or E3 toward NALM6 cells. The effector: target ratios tested in this experiment are 5:1 and 1:1.
  • FIG. 50F shows 6-hour cytotoxicity data of L719 dual CAR-T cells expressing C7R or E3 toward CCRF-CEM cells.
  • FIG. 50G shows flow cytometry data of fractions of L719 dual CAR-T cells expressing phosphorylated STAT5 (pSTAT5) and C7R or E3.
  • pSTAT5 was highly upregulated in L719 dual CAR-T cells expressing C7R or E3.
  • CAR19 plus IL2 stimulation were used as positive control for pSTAT5.
  • Non-engineered T cells were used as negative control for pSTAT5.
  • FIG. 50H shows proliferation of L719 dual CAR-T cells expressing C7R or E3 after IL-2 removal. The CAR-T cells were treated with two rounds of stimulations by NALM6 cells.
  • FIG. 50I shows cytotoxicity of L719 dual CAR-T cells expressing E3 (L719-E3) toward CD19 expressing HeLa cells (HeLa-CD19).
  • the L719-E3 cells were compared with control groups including target cells only, non-transduced TCR/CD7 double knockout cells (NT-DKO), and CD19 CAR-T cells, and L719-E3 showed better cytotoxicity toward HeLa-CD19 cells.
  • the effector: target ratio tested in this experiment is 5:1.
  • FIG. 50J shows cytotoxicity of L719 dual CAR-T cells expressing E3 (L719-E3) toward CD7 expressing HeLa cells (HeLa-CD7).
  • the L719-E3 cells were compared with control groups including target cells only, non-transduced TCR/CD7 double knockout cells (NT-DKO), and CD19 CAR-T cells, and L719-E3 showed better cytotoxicity toward HeLa-CD7 cells.
  • the effector: target ratio tested in this experiment is 5:1.
  • FIGS. 63A and 63B show the expression of IL2 and IFN- ⁇ in TCR/CD7 double knockout CAR7 cells with no cytokine signaling enhancement, or with mbIL15, C7R, or E3 expression.
  • Cells were stimulated by CCRF-CEM cells at 1:1 effector: target cell ratio for 24 hours. Supernatant were collected and measured for IL12 and IFN ⁇ expression by cytokine bead array.
  • CAR7 cells expressing C7R and E3 showed enhanced IL-2 production.
  • FIG. 64 shows the expression of IL2 and IFN- ⁇ in TCR/CD7 double knockout CD19/CD7 dual CAR-L719 cells with no cytokine signaling enhancement, or with C7R, or E3 expression.
  • FMC63 scFv V L (SEQ ID NO 87) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRL HSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIT
  • FMC63 scFv V H (SEQ ID NO 88) EVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGS ETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWG QGTSVTVSS
  • FMC63 CD19CAR (SEQ ID NO 89) MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDISKYLN WYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIA
  • FIG. 57A shows proliferation of CD19 and CD7 dual specific CAR-T cells expressing C7R (GC197-C7R).
  • the engineered dual specific CAR-T cells were prepared from two different T cell donors. CAR-T cells from both donors displayed superior persistence and proliferation in response to repetitive cancer antigen stimulation.
  • FIG. 57B shows proliferation of GC197-C7R cells without stimulation. Freshly prepared GC197-C7R were cultured in T cell culture media without supplement of IL2 or antigen stimulation, compared to control T cells, GC197-C7R maintained better expansion, and persisted in culture.
  • FIG. 58A shows expression of CD7 CAR and enhancer in GC197-C7R and GC197-E3 at day 12 of cell culture.
  • FIG. 58B shows proliferation of GC197 cells expressing C7R (GC197-C7R) or E3 (GC197-E3) without stimulation.
  • GC197-C7R or GC197-E3 cells were cultured in T cell culture media without supplement of IL2 and monitored for fold of cell expansion and persistence.
  • FIG. 58C shows proliferation of GC197-C7R and GC197-E3 in the presence of antigen stimulation. The cells were repeated stimulated by Nalm6 (CD19+ B-ALL cell line) and monitored for fold of cell expansion. The data showed that GC197-C7R/E3 displayed comparably superior cell expansion and cell stability either with or without cytokine or antigen stimulation.
  • FIG. 69 shows BLI imaging of the in vivo efficacy of L719 and L719-C7R UCAR-T in Nalm6 (B-ALL) murine xenograft model.
  • B-ALL Nalm6
  • Each mouse was inoculated intravenously with 1 ⁇ 10 6 Nalm6 cells.
  • CAR-T cells were intravenously infused (high dose: 1 ⁇ 10 6 or low dose: 3 ⁇ 10 5 cells per mouse).
  • BLI imaging indicates L719-C7R UCAR-T cells had better effect on tumor clearance than L719 UCAR-T cells.
  • PBMCs Peripheral Blood Mononuclear Cells
  • PBMCs Peripheral blood mononuclear cells
  • PBNK Peripheral Blood Primary NK
  • K562 cells Human erythroleukemia cell line, ATCC-CCL243;
  • Raji-ffluc cell line obtained by screening Raji cells transfected with lentivirus having firefly luciferase
  • NK92 cells ATCC-CRL2407;
  • NK92-ffluc cells obtained by screening NK92 cells transfected with lentivirus having firefly luciferase
  • Raji cells, K562 cells and Raji-ffluc cell line were cultured in RPMI1640 medium, and 293T cells were cultured in DMEM medium. Both RPMI1640 and DMEM were supplemented with 10% (v/v) fetal bovine serum and 100 U/ml penicillin and streptomycin, 2 mM glutamine and 1 mM sodium pyruvate. All of the cells were cultured in an incubator at 37° C., 5% Co 2 .
  • NK92 cells and NK92-ffluc cells were cultured in RPMI1640 medium supplemented with 10% (v/v) fetal bovine serum, 2 mM glutamine, 1 mM sodium pyruvate, 1% NEAA, 0.1 mM mercaptoethanol and 200 IU/ml rhIL2.
  • PBNKs was sorted from PBMCs by using CD56 microbeads, and then cultured in above medium and expanded under the stimulation of K562 expressing 4-1BBL-mbIL15.
  • T cells and the obtained CAR-T cells were cultured in X-vivo15 medium (containing 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2).
  • the culture medium for CAR-T cells was supplemented with rhIL-2 (ThermoFisher Scientific) at a final concentration of 300 IU/ml every two days. All of the cells were cultured in an incubator at 37° C., 5% CO 2 .
  • CD19 CAR The structure of CD19 CAR is SP-CD19 scFv VL-Linker-CD19 scFv VH-Hinge-TM-4-1BB-CD3 ⁇ ; and the loop of CD19 and CD137 targeting dual CAR (CD19-CD7 dual-CAR) is SP-CD19 scFv VL-Linker-CD137 scFv VH-linker-CD137 scFv VL-Linker-CD19 scFv VH-Hinge-TM-4-1BB-CD3 ⁇ (as shown in FIG. 52 ).
  • the nucleotide sequence of CD19-CD137-loop-CAR is set forth as SEQ ID NO.: 41.
  • CD19-CD137-Loop-CAR (SEQ ID NO 41): ATGGCACTCCCTGTAACTGCACTTCTTTTGCCACTTGCCTTGCTCCTGCACGC AGCGCGGCCGGATATTCAAATGACACAAACTACCAGCTCCCTTTCAGCATCTTTGGG CGATAGAGTAACTATAAGTTGCCGCGCGTCCCAAGACATCTCTAAGTACCTTAACTG GTATCAACAAAAACCGGACGGGACGGTCAAACTGTTGATCTATCACACATCCAGAT TGCACTCAGGCGTGCCGAGCAGGTTCAGTGGGAGTGGGTCAGGAACGGATTACAGC TTGACGATTAGTAACCTGGAGCAAGAAGACATTGCCACCTACTTCTGCCAGCAAGG TAACACTCTCCCATATACGTTCGGGGGTGGCACCAAGCTGGAAATCACTGGCGGCG GAGGATCCGAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCGA GAGCCTGAGGATCAGCTGCAAGGGCAGCGGCT
  • the CAR gene was cloned into the FUW lentiviral vector backbone under the promoter of EF1 ⁇ (EF-1 ⁇ ) to form Fuw-EF1 ⁇ -CAR.
  • Fuw-EF1 ⁇ -CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transfected into 293 T cells by using Lipofectamine3000 to prepare the whole lentiviral expression vector. The supernatant was collected at 48 and 72 h and subject to ultra-centrifuge (Merck Millipore) for concentration. The concentrated virus was ready for the transfection of T cells.
  • the result shows that the lentiviral vector was successfully constructed and expressions of anti-CD19 and anti-CD19/CD137 of the dual CAR were detected as expected.
  • CD137 and TCR gRNAs for gene editing were selected after evaluating gene editing efficiency and off-target risk at website http://crispr.mit.edu, www.idtdna.com and https://www.synthego.com.
  • gRNAs used in the present disclosure were synthesized by Integrated DNA Technologies, Inc (IDT). HiFi-Cas9 was purchased from IDT.
  • RNP ribonucleoprotein
  • gRNA targeting sequences used are as below:
  • TRAC-gRNA1 TTCGGAACCCAATCACTGAC
  • SEQ ID NO: 21 TRAC-gRNA2: TCAGGGTTCTGGATATCTGT
  • SEQ ID NO: 22 TRAC-gRNA3: AAGTTCCTGTGATGTCAAGC
  • SEQ ID NO: 45 CD137-gRNA1: AACGTGGCATCTGTCGACCC
  • CD137-gRNA2 GCGCTGGAGAAACTATTTGG
  • SEQ ID NO: 47 CD137-gRNA3: ACATTTAACGATCAGAAACG
  • SEQ ID NO: 48 CD137-gRNA4: GGTCCTTTGTCCACCTGCGC
  • SEQ ID NO: 49 CD137-gRNA5: GAGAAACTATTTGGAGGACA
  • SEQ ID NO: 50 CD137-gRNA6: GGAGAAACTATTTGGAGGAC
  • gRNA with high knockout efficiency was found for each gene and high efficiency was also observed when knocking out two genes, TCR/CD137.
  • monocytes were isolated using Histopaque-1077 (Sigma-Aldrich) by density gradient centrifugation. Then T cells were enriched, activated by magnetic beads coupled with anti-CD3/anti-CD28, cultured and expanded.
  • X-vivo 15 with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate and 300 IU/ml rhIL2 was used as CAR-T cell medium.
  • the cells were incubated and cultured at 37° C., 5% CO2.
  • Allogeneic T cells were activated by using anti-CD3/anti-CD28 magnetic beads.
  • Allogeneic PBNK cells were activated by co-culturing K562 cells with PBNKs.
  • CD137 The expression of CD137 on the cell surface before and after the activation was determined by flow cytometry.
  • the anti-CD3/anti-CD28 magnetic beads were removed and the cells were collected into a tube and subject to centrifuge at 300 g for 5 min, and then washed twice with DPBS and re-suspended in opti-mem at a cell density of 50 ⁇ 10 6 /ml.
  • the amount of cas9/gRNA RNP required was calculated based on the density of the cells, and then mixed with cells and transferred for electroporation by 4D-Nucleofector System N (Lonza) system. Then the cells were re-suspended in a pre-warmed medium to a density of 1-2 ⁇ 106/ml.
  • the cells were further subject to lentiviral transfection at MOI of 2-8, and then transferred to a flask and cultured in an incubator at 37° C., 5% CO 2 .
  • the number of CAR-T cells and CFSE-labeled target cells was detected by flow cytometry, so that to determine the killing effect between CAR-T cells and target cells during co-culture.
  • the co-culture medium was also collected and subject to centrifuge and the released cytokine IFN- ⁇ and IL-2 were detected by Cytokine bead array kit (CBA kit, BD Biosciences).
  • CD19-CD137 dual CAR T cells only clear CD137 positive cells and NK cells, but fails to show any significant killing effect on CD137 negative inactivated T cells or NK cells, indicating the specificity of CD137 CAR.
  • NOD/Shi-scid/IL-2R ⁇ null (NOG) mice were selected and intravenously injected with 2 ⁇ 10 5 Raji-ffluc cells and allo-T cells. 5 days later, the tumor graft burden of the mice was measured, and the mice were divided into 4 groups based on the tumor burden. One day later, 200 ⁇ L DPBS, 0.5 ⁇ 10 6 CD19 CAR-T cells and 0.5 ⁇ 10 6 CD19-CD137 CAR-T cells were respectively injected to each mouse. The tumor burden of the mice was further evaluated every 7 days after the CAR-T treatment. Each mouse was injected intraperitoneally with 3 mg d-luciferin for a 4-minutes reaction, and then photographed using a Xenogen IVIS Imaging System with 30 s exposure.
  • CD19-CD137 CAR-T significantly decreased the tumor burden compared to CD19 CAR-T cells, and CD19-CD137 CAR-T cells showed significant better in vivo expansion than CD19 CAR-T cells, indicating the CD19-CD137 CAR-T cells survive better and have a stronger ability to clear CD19 positive tumor cells in vivo.
  • mice were systemically treated with a sub-lethal dose of irradiation (175 cGy) first. Then CAR-T cells were re-suspended in PBS and injected into the thorax of the treated mice. The mice were observed 2-3 times a week by using GVHD clinical criteria including weight loss, arch-back, activity, fur texture, and skin integrity.
  • FIG. 59A shows flow cytometry data of fractions of CD19 CAR-T cells expressing enhancer CD47 (CAR19-CD47) or E4 (CAR19-E4).
  • the ecto domain of C7R is replaced by the ecto domain from an immune cell inhibitor, such as CD47, CD24 or other peptides that inhibit killer or phagocytic immune cell function and protect therapeutic cells.
  • the CAR19-CD47 or CAR19-E4 was expressed in K562 cells, which lacks MHCI/II expression and are very sensitive to NK cell killing due to lack of MHC expression. Expression of CAR19 and CD47 were analyzed by flow cytometry.
  • 59B shows NK cell killing activity toward CAR19-CD47 and CAR19-E4 cells. Both CD47 and E4 were able to reduce the extent of NK cell killing for K562 cells. The data show that E4 may protect MHCI negative cells from killing by NK cells, which may be used in protection of MHCI KO CAR-T cells.
  • FIG. 60A shows flow cytometry data of fractions of TCR KO CD19 CAR-T cells expressing CD19 and phosphorylated STAT5 (pSTAT5).
  • the CAR19-CD47 or CAR19-E4 was expressed in TCR knockout T cells and accessed for CAR expression and STAT5 phosphorylation.
  • CAR19-E2 and CAR19-CD47 plus IL2 stimulation were used as positive controls.
  • E4 mediates up-regulation of pSTAT5.
  • FIG. 60B shows proliferation of TCR KO CD19 CAR-T cells expressing enhancer CD47 (CAR19-CD47) or E4 (CAR19-E4).
  • the CAR19-CD47, CAR19-E4, CAR19-C7R expressing TCR knockout T cells were compared for cell proliferation and cell survival without IL12 supplement.
  • E4 can mediate stronger cell proliferation as well as maintenance of cell number after removal of IL2 in culture media.
  • the E4 maintains better CAR-T cell stability without IL2 addition.
  • E4 may protect therapeutic cells, such as cells that with HLA-I KO, from NK cell killing or killing by phagocytes and T killer cells.
  • the etco domain of C7R can replaced by an immune cell inhibitor, such as truncated CD47, CD24, that can inhibit a killer or phagocytic immune cell function and protect the CAR-T/NK cells from being attached by patient's immune system.
  • an immune cell inhibitor such as truncated CD47, CD24, that can inhibit a killer or phagocytic immune cell function and protect the CAR-T/NK cells from being attached by patient's immune system.
  • This example provides clinical study designs and clinical data using CAR7-C7R.
  • Patients were enrolled with tumor burden at the enrollment that 38.2% of bone marrow cells were T-ALL cells.
  • the pre-conditional regimen used chemotherapy drug including fludarabine, cyclophosphamide and etoposide for lymphodepletion.
  • the pre-conditional regimen can provide better CAR-T engraftment and tumor clearance.
  • Two days after completion of lymphodepletion regimen CAR7-C7R cells were intravenously infused into patients at 1.5 ⁇ 10 7 /kg.
  • CAR7-C7R rapidly eliminated cancer cells (T-ALL cells) and expanded to the peak around 7-10 days, without affecting innate immune cell subsets such as granulocytes and monocytes.
  • T-ALL cells cancer cells
  • innate immune cell subsets such as granulocytes and monocytes.
  • FIGS. 67A-E show the clinical data of CAR7-C7R for treating T-acute lymphoblastic leukemia (T-ALL) patients.
  • the construct of CAR7-C7R used in the clinical studies is shown in FIG. 17 .
  • FIG. 67A shows the kinetics of T-ALL elimination in the peripheral blood. T-ALL cells were quickly eliminated within 7-10 days. T-ALL cell concentration were measured in the peripheral blood by flow cytometry.
  • FIGS. 67B and 67C shows the CAR7-C7R cell expansion kinetics, where FIG. 67B shows the CAR7-C7Rcell concentration in the peripheral blood and FIG. 67C shows CAR7-C7R DNA copy/ug DNA of peripheral blood cells.
  • FIGS. 67D and 67E show the granulocyte and lymphocyte (T and NK cells) recovery in the bone marrow and in peripheral blood.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Developmental Biology & Embryology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Reproductive Health (AREA)
  • Mycology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
US17/246,394 2018-11-01 2021-04-30 Compositions and methods for t cell engineering Abandoned US20210332101A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/821,664 US12454564B2 (en) 2018-11-01 2022-08-23 Compositions and methods for T cell engineering

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
CN201811297174 2018-11-01
CN201811297174.3 2018-11-01
CN201811535338 2018-12-14
CN201811535338.1 2018-12-14
CN201811549651 2018-12-18
CN201811549651.0 2018-12-18
CN201910492882 2019-06-06
CN201910492882.0 2019-06-06
CNPCT/CN2019/101651 2019-08-20
PCT/CN2019/114939 WO2020088631A1 (en) 2018-11-01 2019-11-01 Compositions and methods for t cell engineering

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/CN2019/114939 Continuation WO2020088631A1 (en) 2018-11-01 2019-11-01 Compositions and methods for t cell engineering

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/821,664 Division US12454564B2 (en) 2018-11-01 2022-08-23 Compositions and methods for T cell engineering

Publications (1)

Publication Number Publication Date
US20210332101A1 true US20210332101A1 (en) 2021-10-28

Family

ID=70464266

Family Applications (2)

Application Number Title Priority Date Filing Date
US17/246,394 Abandoned US20210332101A1 (en) 2018-11-01 2021-04-30 Compositions and methods for t cell engineering
US17/821,664 Active US12454564B2 (en) 2018-11-01 2022-08-23 Compositions and methods for T cell engineering

Family Applications After (1)

Application Number Title Priority Date Filing Date
US17/821,664 Active US12454564B2 (en) 2018-11-01 2022-08-23 Compositions and methods for T cell engineering

Country Status (11)

Country Link
US (2) US20210332101A1 (https=)
EP (2) EP4578507A3 (https=)
JP (1) JP2022512968A (https=)
KR (1) KR20210125978A (https=)
CN (1) CN113383071A (https=)
AU (1) AU2019372673A1 (https=)
ES (1) ES3035857T3 (https=)
IL (2) IL282735B2 (https=)
SG (1) SG11202104524YA (https=)
TW (1) TW202031894A (https=)
WO (1) WO2020088631A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20220356447A1 (en) * 2019-06-28 2022-11-10 Crage Medical Co., Limited Cell for resisting transplant reaction and method
WO2023150544A1 (en) * 2022-02-01 2023-08-10 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Simplified method of preparing cells for patient administration
WO2023192948A1 (en) * 2022-04-01 2023-10-05 Seattle Children's Hospital (dba Seattle Children's Research Institute) Chimeric cytokine receptors
WO2024019961A1 (en) * 2022-07-18 2024-01-25 Cargo Therapeutics, Inc. Cd2 recruiting chimeric antigen receptors and fusion proteins
WO2025193581A1 (en) * 2024-03-11 2025-09-18 Musc Foundation For Research Development Genetically encoded safety switch for transplanted stem cell-derived cells

Families Citing this family (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2020530280A (ja) 2017-07-03 2020-10-22 トルク セラピューティクス, インコーポレイテッド 免疫刺激性融合分子およびその使用
CN111094358A (zh) * 2018-02-11 2020-05-01 江苏恒瑞医药股份有限公司 一种分离的嵌合抗原受体以及包含其的修饰t细胞及用途
EP3829312A4 (en) * 2018-08-04 2022-07-06 Abcyte Therapeutics Inc. MULTIFUNCTIONAL AND MULTI-TARGETING CAR SYSTEM AND METHODS OF USE
AU2019372673A1 (en) * 2018-11-01 2021-05-27 Gracell Biotechnologies (Shanghai) Co., Ltd. Compositions and methods for T cell engineering
US11840575B2 (en) 2019-05-07 2023-12-12 Gracell Biotechnologies (Shanghai) Co., Ltd. Engineered immune cells targeting BCMA and their uses thereof
WO2021189008A1 (en) 2020-03-20 2021-09-23 Lyell Immunopharma, Inc. Novel recombinant cell surface markers
WO2022007784A1 (en) * 2020-07-06 2022-01-13 Nanjing Legend Biotech Co., Ltd. Methods of reducing graft rejection of allogeneic cell therapy
WO2022036495A1 (en) 2020-08-17 2022-02-24 Utc Therapeutics Inc. Lymphocytes-antigen presenting cells co-stimulators and uses thereof
TW202216990A (zh) * 2020-09-08 2022-05-01 中國大陸商亘喜生物科技(上海)有限公司 用於t細胞工程化的組合物和方法
WO2022061115A1 (en) * 2020-09-18 2022-03-24 Vor Biopharma Inc. Compositions and methods for cd7 modification
CN114525259B (zh) * 2020-11-03 2025-02-14 南京北恒生物科技有限公司 靶向cd7的嵌合抗原受体及其用途
AU2021372975A1 (en) * 2020-11-04 2023-06-15 Fate Therapeutics, Inc. Engineered ipsc and persistent immune effector cells
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
KR20230118887A (ko) 2020-12-03 2023-08-14 센츄리 쎄라퓨틱스 인코포레이티드 유전자 조작 세포 및 이의 용도
WO2022125439A2 (en) * 2020-12-07 2022-06-16 The Regents Of The University Of California Innate immune cell silencing by sirp-alpha engager
AR124414A1 (es) 2020-12-18 2023-03-22 Century Therapeutics Inc Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable
CN116648457A (zh) * 2020-12-31 2023-08-25 亘喜生物科技(上海)有限公司 膜融合蛋白及其在免疫细胞中的应用
CN114853900A (zh) * 2021-02-03 2022-08-05 南京北恒生物科技有限公司 新型嵌合抗原受体及其用途
WO2022171179A1 (zh) * 2021-02-10 2022-08-18 苏州克睿基因生物科技有限公司 一种扩增增强子及其应用
US12144827B2 (en) 2021-02-25 2024-11-19 Lyell Immunopharma, Inc. ROR1 targeting chimeric antigen receptor
US12577290B2 (en) 2021-03-04 2026-03-17 Allogene Therapeutics, Inc. FasL expression and FasR gene knockout to protect therapeutic cells from allogeneic rejection and activation-induced cell death
CN112980800A (zh) * 2021-03-08 2021-06-18 河北森朗生物科技有限公司 Car-t细胞、其构建方法及其应用
BR112023018844A2 (pt) * 2021-04-07 2023-10-10 Century Therapeutics Inc Composições e métodos para geração de células t gama-delta de células-tronco pluripotentes induzidas
JP2024514522A (ja) * 2021-04-07 2024-04-02 センチュリー セラピューティクス,インコーポレイテッド 遺伝子導入ベクターおよび細胞を操作する方法
WO2023283644A2 (en) * 2021-07-09 2023-01-12 Board Of Regents, The University Of Texas System Chimeric antigen receptor to target trop-2-positive cancers
MX2024000713A (es) * 2021-07-16 2024-03-25 Sana Biotechnology Inc Vectores policistrónicos para terapias a base de células.
CN113603778A (zh) * 2021-08-06 2021-11-05 上海优卡迪生物医药科技有限公司 一种封闭抗体及其在制备靶向t细胞表达抗原的car-t细胞中的应用
CN118056012B (zh) * 2021-08-24 2025-05-30 赛斯尔擎生物技术(上海)有限公司 一种修饰细胞的方法
CN115873801A (zh) * 2021-09-29 2023-03-31 南京北恒生物科技有限公司 工程化免疫细胞及其用途
CA3232365A1 (en) * 2021-09-29 2023-04-06 Ronnie Rong Wei Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof in hiv
TW202330594A (zh) * 2021-09-29 2023-08-01 美商莫德斯醫療公司 抗原結合多肽、抗原結合多肽複合物及其使用方法
CN118251411A (zh) * 2021-09-29 2024-06-25 摩德斯医疗股份有限公司 抗原结合多肽、抗原结合多肽复合物及其使用方法
CN113925876B (zh) * 2021-10-14 2022-08-12 范德里希(上海)生物科技有限公司 Cik免疫细胞在治疗癌症中的用途
WO2023086379A2 (en) * 2021-11-10 2023-05-19 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
CN114456262B (zh) * 2022-01-13 2024-06-11 浙江大学医学院附属第一医院 抗h1n1流感病毒核蛋白单克隆抗体zju-np-a1及其在检测中的应用
CN116462769A (zh) * 2022-04-02 2023-07-21 广东东阳光药业有限公司 一种嵌合受体及其应用
WO2023197980A1 (zh) * 2022-04-11 2023-10-19 苏州沙砾生物科技有限公司 一种嵌合抗原受体及其应用
CN117004603A (zh) * 2022-04-28 2023-11-07 南京北恒生物科技有限公司 一种cd7基因被敲除的工程化免疫细胞及其用途
CN115838423B (zh) * 2022-08-16 2023-05-09 北京科跃中楷生物技术有限公司 细胞快速融合技术及其制备的抗体
CN117683139A (zh) * 2022-09-09 2024-03-12 信达细胞制药(苏州)有限公司 组成型嵌合细胞因子受体及表达其的免疫细胞及应用
CN115960226B (zh) * 2022-09-20 2023-06-16 北京科跃中楷生物技术有限公司 一种磁微粒免疫层析快速反应方法及检测试剂盒
CN116179483B (zh) * 2022-12-16 2024-03-01 青岛海尔生物科技有限公司 一种体外快速扩增干细胞样记忆性宫颈癌肿瘤浸润淋巴细胞的方法
CN116143948A (zh) * 2023-02-14 2023-05-23 中国药科大学 一种以Jurkat为平台的靶向CD24和PD-L1双特异性嵌合抗原受体CAR及其应用
IL322949A (en) 2023-03-03 2025-10-01 Arsenal Biosciences Inc Systems targeting PSMA and CA9
CN118221828B (zh) * 2023-09-08 2024-12-31 北京昌平实验室 Car分子、car细胞和car药物组合物及其应用
CN120112648A (zh) * 2023-09-22 2025-06-06 京东方科技集团股份有限公司 一种免疫细胞的制备方法
CN120025438A (zh) * 2023-11-21 2025-05-23 合源生物科技(天津)有限公司 一种靶向cd7的人源化抗体、嵌合抗原受体及其应用
CN117402231B (zh) * 2023-12-14 2024-04-09 南方医科大学南方医院 一种自发传递il-21信号的受体及其应用
CN118891290A (zh) * 2024-04-12 2024-11-01 科济生物医药(上海)有限公司 细胞免疫疗法的组合物和方法
US20260000765A1 (en) * 2024-06-27 2026-01-01 Lentigen Technology, Inc. CHIMERIC ANTIGEN RECEPTOR THERAPIES FOR TREATING CANCER WITH IL7Fc ARMORED CAR-T CELLS
CN119161470B (zh) * 2024-11-21 2025-09-05 武汉生物制品研究所有限责任公司 一种识别cv-a6的中和单克隆抗体10g8及其应用
CN119775433B (zh) * 2024-12-09 2025-11-28 吉林大学第一医院 一种细胞膜表达的il-15融合蛋白及其在细胞治疗中的应用
CN120590523B (zh) * 2025-06-20 2026-01-27 中国农业科学院上海兽医研究所(中国动物卫生与流行病学中心上海分中心) 一种犬瘟热病毒n蛋白单克隆抗体,快速检测胶体金试纸条及其制备方法

Family Cites Families (109)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US2779780A (en) 1955-03-01 1957-01-29 Du Pont 1, 4-diamino-2, 3-dicyano-1, 4-bis (substituted mercapto) butadienes and their preparation
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
IL104570A0 (en) 1992-03-18 1993-05-13 Yeda Res & Dev Chimeric genes and cells transformed therewith
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
CZ121599A3 (cs) 1998-04-09 1999-10-13 Aventis Pharma Deutschland Gmbh Jednořetězcová molekula vázající několik antigenů, způsob její přípravy a léčivo obsahující tuto molekulu
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
KR20030032922A (ko) 2000-02-24 2003-04-26 싸이트 테라피스 인코포레이티드 세포의 동시 자극 및 농축
JP2003531588A (ja) 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
US6995162B2 (en) 2001-01-12 2006-02-07 Amgen Inc. Substituted alkylamine derivatives and methods of use
PT1478648E (pt) 2002-02-01 2014-07-15 Ariad Pharma Inc Compostos contendo fósforo e suas utilizações
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
TWI275390B (en) 2002-04-30 2007-03-11 Wyeth Corp Process for the preparation of 7-substituted-3- quinolinecarbonitriles
US7435596B2 (en) 2004-11-04 2008-10-14 St. Jude Children's Research Hospital, Inc. Modified cell line and method for expansion of NK cell
JP2008539796A (ja) 2005-05-20 2008-11-20 バイレクシス コーポレイション 初代細胞の形質導入
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
CA2651174A1 (en) 2006-05-03 2007-11-15 Government Of The United States Of America, Represented By The Secretary , Department Of Health And Human Services Chimeric t cell receptors and related materials and methods of use
US8088379B2 (en) 2006-09-26 2012-01-03 The United States Of America As Represented By The Department Of Health And Human Services Modified T cell receptors and related materials and methods
KR20100058509A (ko) 2007-07-31 2010-06-03 메디뮨 엘엘씨 다중특이적 에피토프 결합 단백질 및 이의 용도
US20100260668A1 (en) 2008-04-29 2010-10-14 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
US9676845B2 (en) 2009-06-16 2017-06-13 Hoffmann-La Roche, Inc. Bispecific antigen binding proteins
PH12013501201A1 (en) 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
WO2012151266A1 (en) 2011-05-03 2012-11-08 Michael Har-Noy Methods for handling biological drugs containing living cells
CA2861491C (en) 2012-02-13 2020-08-25 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
BR112014020826A8 (pt) 2012-02-24 2017-09-19 Stem Centrx Inc Anticorpo que se liga especificamente a um epítopo, ácido nucleico, vetor ou célula hospedeira, conjugado de fármaco – anticorpo, composição farmacêutica compreendendo o referido anticorpo, uso do mesmo, kit e método de preparação do conjugado
JP2015524255A (ja) 2012-07-13 2015-08-24 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア 二重特異性抗体を共導入することによってcart細胞の活性を強化する方法
WO2014055442A2 (en) 2012-10-01 2014-04-10 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
AU2013204922B2 (en) 2012-12-20 2015-05-14 Celgene Corporation Chimeric antigen receptors
US20160017286A1 (en) 2013-03-06 2016-01-21 The Trustees Of The University Of Pennsylvania Ikaros inhibition to augment adoptive t cell transfer
US10519251B2 (en) 2013-12-30 2019-12-31 Epimab Biotherapeutics, Inc. Fabs-in-tandem immunoglobulin and uses thereof
AU2015214145A1 (en) 2014-02-04 2016-08-25 Kite Pharma. Inc. Methods for producing autologous T cells useful to treat B cell malignancies and other cancers and compositions thereof
EP3114217A4 (en) * 2014-03-07 2017-09-20 Bellicum Pharmaceuticals, Inc. Caspase polypeptides having modified activity and uses thereof
CN106795221B (zh) 2014-04-03 2022-06-07 塞勒克提斯公司 用于癌症免疫治疗的cd33特异性嵌合抗原受体
US10611837B2 (en) 2014-04-10 2020-04-07 Seattle Children's Hospital Transgene genetic tags and methods of use
ES2836743T3 (es) 2014-06-02 2021-06-28 Us Health Receptores de antígeno quiméricos que seleccionan como diana CD-19
EP4166148B1 (en) 2014-06-06 2026-02-18 Memorial Sloan-Kettering Cancer Center Mesothelin-targeted chimeric antigen receptors and uses thereof
US20170274014A1 (en) 2014-07-21 2017-09-28 Jennifer Brogdon Combinations of low, immune enhancing, doses of mtor inhibitors and cars
CN105367661B (zh) 2014-08-26 2019-08-02 西比曼生物科技(上海)有限公司 嵌合抗原受体及其基因和重组表达载体、工程化her1靶向性的nkt细胞及其应用
DK4074735T3 (da) 2014-08-28 2025-07-14 Bioatla Inc Betinget aktive kimæriske antigenreceptorer til modificerede t-celler
ES2987570T3 (es) 2014-11-05 2024-11-15 Juno Therapeutics Inc Métodos para la transducción y el procesamiento de células
CA2964783C (en) 2014-11-05 2024-01-23 Board Of Regents, The University Of Texas System Chimeric antigen receptors (car) to selectively target protein complexes
KR101744959B1 (ko) 2014-12-05 2017-06-12 (주)케어젠 피부상태 개선 활성을 갖는 펩타이드 및 이의 용도
FI3240805T3 (fi) 2014-12-15 2025-02-17 Univ California Cd19- ja cd20-vasteellinen bispesifinen tai-veräjän kimeerinen antigeenireseptori
RU2021118125A (ru) 2014-12-29 2022-04-06 Новартис Аг Способы получения экспрессирующих химерный антигенный рецептор клеток
JP6797803B2 (ja) 2014-12-31 2020-12-09 セルジーン コーポレイション ナチュラルキラー細胞を用いて血液障害、固形腫瘍、又は感染性疾患を治療する方法
KR102763121B1 (ko) 2015-02-06 2025-02-04 내셔널 유니버시티 오브 싱가포르 치료적 면역 세포의 효능의 향상 방법
JP7237449B2 (ja) 2015-02-27 2023-03-13 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
GB201503742D0 (en) 2015-03-05 2015-04-22 Ucl Business Plc Chimeric antigen receptor
JP2018509148A (ja) * 2015-03-11 2018-04-05 セレクティスCellectis 患者における持続性および/または生着を増加させるために同種t細胞を改変する方法
AU2016249005B2 (en) 2015-04-17 2022-06-16 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
US20190119635A1 (en) 2015-05-05 2019-04-25 Fate Therapeutics, Inc. Modulation of t lymphocytes
AU2016274989A1 (en) 2015-06-12 2017-11-02 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
CA2992551A1 (en) 2015-07-21 2017-01-26 Novartis Ag Methods for improving the efficacy and expansion of immune cells
AU2016306209B2 (en) 2015-08-07 2023-07-06 Seattle Children's Hospital (dba Seattle Children's Research Institute) Bispecific CAR T-cells for solid tumor targeting
AU2016337525B2 (en) 2015-10-16 2022-01-20 The Trustees Of Columbia University In The City Of New York Compositions and methods for inhibition of lineage specific antigens
WO2017070042A1 (en) 2015-10-20 2017-04-27 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of producing t cell populations using akt inhibitors
AU2016341529B2 (en) 2015-10-22 2023-03-30 Juno Therapeutics Gmbh Methods for culturing cells and kits and apparatus for same
WO2017112877A1 (en) 2015-12-22 2017-06-29 Icell Gene Therapeutics, Llc Chimeric antigen receptors and enhancement of anti-tumor activity
CN108778329B (zh) 2016-02-17 2022-09-16 西雅图基因公司 Bcma抗体和其用以治疗癌症和免疫病症的用途
KR20180118175A (ko) 2016-03-04 2018-10-30 노파르티스 아게 다중 키메라 항원 수용체 (car) 분자를 발현하는 세포 및 그에 따른 용도
CA3021634A1 (en) * 2016-04-15 2017-10-19 Zymeworks Inc. Multi-specific antigen-binding constructs targeting immunotherapeutics
EP4628587A3 (en) 2016-04-15 2026-02-25 Memorial Sloan Kettering Cancer Center Transgenic t cell and chimeric antigen receptor t cell compositions and related methods
WO2017213979A1 (en) 2016-06-06 2017-12-14 St. Jude Children's Research Hospital Anti-cd7 chimeric antigen receptor and method of use thereof
CA3025667A1 (en) * 2016-06-08 2017-12-14 Intrexon Corporation Cd33 specific chimeric antigen receptors
CN109562126A (zh) 2016-06-24 2019-04-02 美商生物细胞基因治疗有限公司 嵌合抗原受体(car)、组合物及其使用方法
SG11201900344YA (en) 2016-07-15 2019-02-27 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
CN106191062B (zh) * 2016-07-18 2019-06-14 广东华南疫苗股份有限公司 一种tcr-/pd-1-双阴性t细胞及其构建方法
AU2017302668B9 (en) 2016-07-28 2023-06-22 Novartis Ag Combination therapies of chimeric antigen receptors and PD-1 inhibitors
US10630175B2 (en) 2016-08-03 2020-04-21 Texas Instruments Incorporated Pseudo current tracking for power supply regulation
KR102546839B1 (ko) 2016-08-03 2023-06-23 워싱턴 유니버시티 키메라 항원 수용체를 이용한 t 세포 악성종양의 치료를 위한 car-t 세포의 유전자 편집
KR20230167769A (ko) 2016-08-26 2023-12-11 베이롤 칼리지 오브 메드신 세포 치료요법을 위한 항상성 활성 사이토킨 수용체
US20190309307A1 (en) 2016-09-14 2019-10-10 Benitec Biopharma Limited REAGENTS FOR PRODUCING T-CELLS WITH NON-FUNCTIONAL T-CELL RECEPTORS (TCRs) COMPOSITIONS COMPRISING SAME AND USE THEREOF
US20190119636A1 (en) 2017-10-23 2019-04-25 Poseida Therapeutics, Inc. Modified stem cell memory t cells, methods of making and methods of using same
CN106544321B (zh) * 2016-10-13 2019-01-29 北京艺妙神州医疗科技有限公司 通用型car-t细胞及其制备方法和用途
CN106591363A (zh) * 2016-11-11 2017-04-26 广东万海细胞生物科技有限公司 一种通用型异体car‑t细胞制备方法及应用
NZ752984A (en) * 2016-11-22 2026-03-27 Nat Univ Singapore Blockade of cd7 expression and chimeric antigen receptors for immunotherapy of t-cell malignancies
KR20190098747A (ko) 2016-12-05 2019-08-22 주노 쎄러퓨티크스 인코퍼레이티드 입양 세포 치료법을 위한 조작된 세포의 제조방법
WO2018111340A1 (en) 2016-12-16 2018-06-21 Novartis Ag Methods for determining potency and proliferative function of chimeric antigen receptor (car)-t cells
GB201622044D0 (en) * 2016-12-22 2017-02-08 Ucl Business Plc T cell-targeted T cells
EP3615055A1 (en) 2017-04-28 2020-03-04 Novartis AG Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
MX2019013514A (es) 2017-05-12 2020-01-20 Crispr Therapeutics Ag Materiales y metodos para modificar celulas por ingenieria genetica y usos de los mismos en inmunooncologia.
WO2018231759A1 (en) 2017-06-12 2018-12-20 Obsidian Therapeutics, Inc. Pde5 compositions and methods for immunotherapy
EP3664835B1 (en) 2017-08-09 2024-10-23 Juno Therapeutics, Inc. Methods and compositions for preparing genetically engineered cells
WO2019036855A1 (en) 2017-08-21 2019-02-28 Adagene Inc. Anti-cd137 molecules and use thereof
AU2018334886B2 (en) 2017-09-22 2025-06-26 WuXi Biologics Ireland Limited Novel bispecific polypeptide complexes
WO2019079034A1 (en) 2017-10-17 2019-04-25 The General Hospital Corporation METHODS AND COMPOSITIONS RELATING TO GENETICALLY MODIFIED REGULATORY T LYMPHOCYTES
PT3703750T (pt) 2017-11-01 2025-01-17 Memorial Sloan Kettering Cancer Center Recetores de antigénio quimérico específicos para o antigénio de maturação das células b e polinucleótidos codificantes
GB201719646D0 (en) 2017-11-27 2018-01-10 Bivictrix Therapeutics Ltd Therapy
US20200371091A1 (en) 2017-11-30 2020-11-26 Novartis Ag Bcma-targeting chimeric antigen receptor, and uses thereof
CN108018312B (zh) 2017-12-20 2019-09-10 上海优卡迪生物医药科技有限公司 一种t淋巴细胞白血病的car-t治疗载体及其构建方法和应用
JP7416695B2 (ja) 2017-12-29 2024-01-17 メモリアル スローン-ケタリング キャンサー センター 増強されたキメラ抗原受容体およびその使用
CN108017717B (zh) 2018-01-24 2019-08-16 首都医科大学宣武医院 一种用于体外高效定向扩增的嵌合抗原受体及其应用
US10869888B2 (en) * 2018-04-17 2020-12-22 Innovative Cellular Therapeutics CO., LTD. Modified cell expansion and uses thereof
WO2019210153A1 (en) 2018-04-27 2019-10-31 Novartis Ag Car t cell therapies with enhanced efficacy
CA3100349A1 (en) 2018-05-17 2019-11-21 The Board Of Trustees Of The Leland Stanford Junior University Receptor inhibition by phosphatase recruitment
CN110526983B (zh) 2018-05-24 2022-02-11 北京马力喏生物科技有限公司 改良型抗cd19 car-t细胞
EP3801568A4 (en) 2018-05-31 2022-03-16 Washington University GENOMIC-EDITED INVARIANT NATURAL KILLER T CELLS FOR THE TREATMENT OF HEMATOLOGICAL MALIGNITIES
EP3802798A4 (en) 2018-05-31 2022-05-11 Washington University CHIMERIC ANTIGEN RECEPTOR T CELLS (CAR-T) FOR TREATMENT OF CANCER
US11319380B2 (en) * 2018-06-04 2022-05-03 Precigen, Inc. MUC16 specific chimeric antigen receptors and uses thereof
US12516099B2 (en) 2018-08-09 2026-01-06 Juno Therapeutics, Inc. Processes for generating engineered cells and compositions thereof
EP3836944A4 (en) * 2018-08-16 2022-05-11 Memorial Sloan Kettering Cancer Center LEUCINE ZIPPER BASED COMPOSITIONS AND METHODS OF USE
EP4635978A2 (en) 2018-08-31 2025-10-22 Novartis AG Methods of making chimeric antigen receptor-expressing cells
US20210301255A1 (en) 2018-09-10 2021-09-30 Atara Biotherapeutics, Inc. Methods for expanding antigen-specific car-t cells, compositions and uses related thereto
AU2019372673A1 (en) * 2018-11-01 2021-05-27 Gracell Biotechnologies (Shanghai) Co., Ltd. Compositions and methods for T cell engineering
KR20210125986A (ko) 2018-12-07 2021-10-19 그라셀 바이오테크놀로지스 (상하이) 컴퍼니, 리미티드 면역요법을 위한 조성물 및 방법
KR20210139472A (ko) 2019-04-11 2021-11-22 페이트 세러퓨틱스, 인코포레이티드 조작된 iPSC 및 면역 효과기 세포에서의 CD3 재구성
CN110358734B (zh) 2019-06-13 2020-08-25 首都医科大学宣武医院 以Tcm为主要效应成分的CAR-T制备方法及其应用

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20220356447A1 (en) * 2019-06-28 2022-11-10 Crage Medical Co., Limited Cell for resisting transplant reaction and method
WO2023150544A1 (en) * 2022-02-01 2023-08-10 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Simplified method of preparing cells for patient administration
WO2023192948A1 (en) * 2022-04-01 2023-10-05 Seattle Children's Hospital (dba Seattle Children's Research Institute) Chimeric cytokine receptors
WO2024019961A1 (en) * 2022-07-18 2024-01-25 Cargo Therapeutics, Inc. Cd2 recruiting chimeric antigen receptors and fusion proteins
WO2025193581A1 (en) * 2024-03-11 2025-09-18 Musc Foundation For Research Development Genetically encoded safety switch for transplanted stem cell-derived cells

Also Published As

Publication number Publication date
CN113383071A (zh) 2021-09-10
SG11202104524YA (en) 2021-05-28
IL320642B1 (en) 2026-03-01
EP4578507A3 (en) 2025-11-12
IL282735A (en) 2021-06-30
EP3874030A4 (en) 2022-03-09
US20230068085A1 (en) 2023-03-02
IL320642A (en) 2025-07-01
AU2019372673A1 (en) 2021-05-27
IL282735B2 (en) 2025-10-01
KR20210125978A (ko) 2021-10-19
WO2020088631A1 (en) 2020-05-07
IL282735B1 (en) 2025-06-01
JP2022512968A (ja) 2022-02-07
TW202031894A (zh) 2020-09-01
EP4578507A2 (en) 2025-07-02
EP3874030B1 (en) 2025-03-12
EP3874030A1 (en) 2021-09-08
US12454564B2 (en) 2025-10-28
ES3035857T3 (en) 2025-09-10

Similar Documents

Publication Publication Date Title
US12454564B2 (en) Compositions and methods for T cell engineering
US12344651B2 (en) CD19 and CD22 chimeric antigen receptors and uses thereof
US20230381233A1 (en) Compositions and methods for t cell engineering
WO2021223705A1 (en) Compositions and methods for t cell engineering
WO2022104061A1 (en) Combination therapies with chimeric antigen receptor (car)-expressing cells
US20230113157A1 (en) Compositions and methods for t cell engineering
CA3247638A1 (en) TREATMENT OF PATIENTS WITH NON-SMALL CELL LUNG CARCINOMA (NSCLC) WITH TUMOR-INFILTRATING LYMPHOCYTE THERAPIES
HK40128195A (en) Compositions and methods for t cell engineering
HK40060205A (en) Compositions and methods for t cell engineering
RU2847299C1 (ru) Химерные антигенные рецепторы для cd19 и cd22 и пути их применения
TW202307210A (zh) Cd19和cd22嵌合抗原受體及其用途
WO2026006794A1 (en) Chimeric antigen receptors and uses thereof
CN118159653A (zh) 嵌合受体疗法

Legal Events

Date Code Title Description
AS Assignment

Owner name: SUZHOU GRACELL BIOTECHNOLOGIES CO., LTD., CHINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD.;REEL/FRAME:056338/0273

Effective date: 20191029

Owner name: GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD., CHINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WANG, XINXIN;JIN, TAO;YANG, CHUNHUI;AND OTHERS;SIGNING DATES FROM 20190821 TO 20190902;REEL/FRAME:056338/0259

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION