US20210154269A1 - Combination therapies for treating cancer - Google Patents

Combination therapies for treating cancer Download PDF

Info

Publication number
US20210154269A1
US20210154269A1 US17/105,353 US202017105353A US2021154269A1 US 20210154269 A1 US20210154269 A1 US 20210154269A1 US 202017105353 A US202017105353 A US 202017105353A US 2021154269 A1 US2021154269 A1 US 2021154269A1
Authority
US
United States
Prior art keywords
sirpα
domain
domain variant
polypeptide
region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US17/105,353
Other languages
English (en)
Inventor
Hong Wan
Bang Janet Sim
Sophia Randolph
Jaume Pons
Tracy Chia-Chien Kuo
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ALX Oncology Inc
Original Assignee
ALX Oncology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ALX Oncology Inc filed Critical ALX Oncology Inc
Priority to US17/105,353 priority Critical patent/US20210154269A1/en
Assigned to ALX Oncology Inc. reassignment ALX Oncology Inc. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: PONS, JAUME, SIM, BANG JANET, KUO, TRACY CHIA-CHIEN, RANDOLPH, SOPHIA, WAN, HONG
Publication of US20210154269A1 publication Critical patent/US20210154269A1/en
Priority to US18/154,380 priority patent/US12527838B2/en
Priority to US18/342,331 priority patent/US20240075101A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • A61K31/17Amides, e.g. hydroxamic acids having the group >N—C(O)—N< or >N—C(S)—N<, e.g. urea, thiourea, carmustine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/28Compounds containing heavy metals
    • A61K31/282Platinum compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/337Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/513Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/517Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • A61K31/52Purines, e.g. adenine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/555Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/63Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide
    • A61K31/635Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • A61K31/7072Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid having two oxo groups directly attached to the pyrimidine ring, e.g. uridine, uridylic acid, thymidine, zidovudine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00Medicinal preparations containing inorganic active ingredients
    • A61K33/24Heavy metals; Compounds thereof
    • A61K33/243Platinum; Compounds thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/55Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to methods of treating cancer that comprise administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in conjunction with a chemotherapy agent and at least one additional anti-cancer agent and/or at least one additional mode of cancer therapy.
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • Tumor cells manipulate the myeloid compartment to evade the anti-tumor host immune response (Gabrilovich et al., Nat Rev Immunol (2012) 12(4):253-68).
  • CD47 expressed on the surface of normal cells binds SIRP ⁇ on macrophages and provides a “don't eat me” signal
  • tumor cells have also been found to overexpress CD47 to evade the macrophage component of immune surveillance (Oldenborg, ISRN Hematol (2013) 614619).
  • Macrophage-mediated destruction of cancer cells requires both the disruption of “don't eat me” signals (e.g., CD47-SIRP ⁇ ) and the activation of “eat me” signals. Neither component alone is sufficient to trigger maximal phagocytic reaction against tumor cells.
  • CD47 provides a fundamental “don't eat me” signal through its interaction with SIRP ⁇ on macrophages.
  • the pro-phagocytic “eat me” signal can be provided to the same macrophages by binding to their activating Fc gamma receptors.
  • the pro-phagocytic “eat me” signal can be provided by binding of anti-tumor antibodies to Fc receptors on macrophages.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant, and (b) a Bcl-2 inhibitor; wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of
  • the cancer is leukemia, multiple myeloma, or non-Hodgkin's lymphoma.
  • the non-Hodgkin's lymphoma is diffuse large B-cell lymphoma (DLBCL), mantle cell lymphoma (MCL), or follicular lymphoma (FL).
  • the leukemia is acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), Chronic myeloid leukemia (CIVIL), acute myeloid leukemia (AML), or myelodysplastic syndrome (MDS).
  • the leukemia is acute lymphoblastic leukemia.
  • the Bcl-2 inhibitor is venetoclax, ABT-737, navitoclax, BCL201, or AZD-0466. In some embodiments, the Bcl-2 inhibitor is venetoclax.
  • the cancer is a solid tumor.
  • the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the colon cancer is colon carcinoma.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • the polypeptide comprising the SIRP ⁇ D1 domain variant and the Fc domain variant is administered at a dose of 10 mg/kg once a week (qw). In some embodiments, the polypeptide comprising the SIRP ⁇ D1 domain variant and the Fc domain variant is administered at a dose of 15 mg/kg once a week (qw).
  • the HNSCC is advanced and/or metastatic HNSCC.
  • the PD-1 inhibitor is an anti-PD-1 antibody, e.g., pembrolizumab, nivolumab, pidilizumab, cemiplimab, or BMS-936559.
  • the anti-PD-1 antibody is pembrolizumab.
  • the antimetabolite is 5-fluorouracil, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate.
  • the antimetabolite is 5-fluorouracil.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant, (b) an anti-HER2 antibody, and (c) an anti-PD-L1 antibody (e.g., an anti-PD-L1 antagonist antibody); wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P,
  • the cancer is solid tumor.
  • the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the solid tumor is HER2 + solid tumor.
  • the solid tumor is colon cancer (e.g., HER2 + colon cancer).
  • the anti-HER2 antibody is trastuzumab.
  • the anti-PD-L1 antibody is atezolizumab, avelumab, or durvalumab.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant, (b) an anti-HER2 antibody, (c) an anti-VEGF2 antibody, and (d) paclitaxel; wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L
  • the gastric cancer or GEJ cancer is a HER2-overexpressing (e.g., HER2 + ) gastric cancer or a HER2-overexpressing GEJ cancer.
  • the individual has received prior therapy with an anti-HER2 antibody, with an anti-HER2 antibody and a fluoropyrimidine, or with an anti HER2 antibody and a platinum-based chemotherapy agent.
  • the anti-HER2 antibody is trastuzumab.
  • the anti-VEGF antibody is ramucirumab.
  • the polypeptide comprising the SIRP ⁇ D1 domain variant and the Fc domain variant is administered at a dose of 10 mg/kg once a week (qw). In some embodiments, the polypeptide comprising the SIRP ⁇ D1 domain variant and the Fc domain variant is administered at a dose of 15 mg/kg once a week (qw).
  • the cancer is solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma.
  • the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81. In some embodiments, the Fc domain variant is a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat. In some embodiments, the Fc domain variant comprises the amino acid sequence of SEQ ID NO: 91. In some embodiments, the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 136.
  • the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 135. In some embodiments, the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant forms a homodimer. In some embodiments, the individual is a human.
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with a Bcl-2 inhibitor for treating cancer in an individual in need, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kab
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with a platinum-based chemotherapy agent for treating cancer in an individual in need thereof, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat;
  • the cancer is solid tumor.
  • the solid tumor is colon cancer, colon carcinoma, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with a PD-1 inhibitor, an antimetabolite, and a platinum-based chemotherapy agent for treating cancer in an individual in need thereof, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG2
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-HER2 antibody, an anti-VEGFR2 antibody, and paclitaxel; wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering
  • the gastric cancer or GEJ cancer is HER2 + gastric cancer or HER2 + GEJ cancer.
  • the anti-HER2 antibody is trastuzumab.
  • the anti-VEGFR2 antibody is ramucirumab.
  • the gastric cancer or GEJ cancer in the individual progressed during or after prior therapy (or therapies) comprising anti-HER2 antibody (e.g., trastuzumab) and/or a fluoropyrimidine, and/or a platinum-based chemotherapeutic agent.
  • prior therapy or therapies
  • anti-HER2 antibody e.g., trastuzumab
  • fluoropyrimidine e.g., trastuzumab
  • platinum-based chemotherapeutic agent e.g., platinum-based chemotherapeutic agent.
  • the prior therapy comprised an anti-HER2 antibody and a fluoropyrimidine (e.g., administered during the same line of therapy or during different lines of therapy).
  • the prior therapy comprised an anti-HER2 antibody and a platinum-based chemotherapy agent (e.g., administered during the same line of therapy or during different lines of therapy)
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-TROP2 antibody for treating cancer in an individual in need thereof, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat;
  • the cancer is solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma.
  • kits comprising a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-HER2 antibody and an anti-PD-L1 antibody (e.g., an anti PD-L1 antagonist antibody) for treating cancer in an individual in need thereof, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A
  • the cancer is colon cancer. In some embodiments, the colon cancer is HER2 + colon cancer. In some embodiments, the anti-HER2 antibody is trastuzumab. In some embodiments, the anti-PD-L1 antibody is atezolizumab, avelumab, or durvalumab.
  • the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81. In some embodiments, the Fc domain variant is a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat. In some embodiments, the Fc domain variant comprises the amino acid sequence of SEQ ID NO: 91. In some embodiments, the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 136.
  • the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 135. In some embodiments, the polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant forms a homodimer. In some embodiments, the individual is a human.
  • FIG. 1B provides tumor volumes (mm 3 ) at the indicated times post implant in NOD-SCID female mice injected with RS4; 11 leukemia cells that had received treatment venetoclax, and which were subsequently re-treated with single agent venetoclax or with a venetoclax/Drug A combination.
  • FIGS. 2A-2D provide the tumor volume (mm 3 ) and body weight of BALB/c female mice injected with CT26 tumor cells following treatment with Drug A, Cisplatin, Cisplatin/Drug A combination, or vehicle (PBS) at the indicated times post implantation.
  • FIG. 2A provides the mean tumor volumes (+/ ⁇ SEM) for the indicated treatments. Dashed arrows indicate dosing of Cisplatin (two 5 mg/kg doses given 10 days apart). Dotted arrows indicate dosing of Drug A (two 30 mg/kg doses given 10 days apart). Both drugs were administered intraperitoneally. Mice treated with both agents were dosed with Drug A one day post treatment with cisplatin.
  • FIG. 2B provides the mean percent change in body weight from day 7 (D7) in mice treated according to the regimens shown in FIG. 2A .
  • FIG. 2C provides the mean tumor volumes (+/ ⁇ SEM) for the indicated treatments. Dashed arrows indicate dosing of Cisplatin (one 10 mg/kg dose). Dotted arrows indicate dosing of Drug A (two 30 mg/kg doses given 10 days apart). Both drugs were administered intraperitoneally. Mice treated with both agents were dosed with Drug A one day post treatment with cisplatin.
  • FIG. 2D provides the mean percent change in body weight from day 7 (D7) in mice treated according to the regimens shown in FIG. 2C .
  • FIG. 3 provides the results of experiments that were performed to determine the effect of Drug A in combination with an anti-TROP2 antibody on the phagocytosis of CFSE-labeled DLD-1 tumor cells by human monocyte-derived macrophages.
  • FIG. 4 provides the results of experiments that were performed to determine the effect of Drug A in combination with (a) an anti-HER2 antibody, (b) an anti-PD-L1 antibody, or (c) an anti-HER2 antibody and an anti-PD-L1 on tumor growth in a MC38 m/h colon cancer model.
  • FIG. 5A provides the results of experiments that were performed to assess the effects of the addition of Drug A, venetoclax, or both Drug A and venetoclax in the phagocytosis of HL60 cells by macrophages in an in vitro assay.
  • FIG. 5B provides the results of experiments that were performed to assess the effects of the addition of Drug A, venetoclax, or both Drug A and venetoclax in the phagocytosis of OCI-AML3 cells by macrophages in an in vitro assay.
  • FIG. 6A provides the results of experiments that were performed to assess the effects of Drug A or Drug C on CD8 + dendritic cell activation.
  • FIG. 6B provides the results of experiments that were performed to assess the effects of Drug A or Drug C on CD8 ⁇ dendritic cell activation.
  • FIG. 7A provides the results of experiments that were performed to assess the effects of Drug A or Drug B on CD8 + dendritic cell activation.
  • FIG. 7B provides the results of experiments that were performed to assess the effects of Drug A or Drug B on CD8 ⁇ dendritic cell activation.
  • FIG. 8A provides the results of experiments that were performed to assess the binding of Drug A, F59/magrolimab, TTI-621, and TTI-622 to hCD47.
  • FIG. 8B provides the results of quantitative experiments that were performed to assess the effect of Drug A, F59/magrolimab, TTI-621, and TTI-622 on SIRP ⁇ signaling.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
  • the terms “treatment”, “treating”, and the like refer to administering an agent, or carrying out a procedure, for the purposes of obtaining an effect.
  • the effect is prophylactic in terms of completely or partially preventing a disease or symptom thereof.
  • the effect is therapeutic in terms of affecting a partial or complete cure for a disease or symptoms of the disease.
  • antibody refers to intact antibodies; antibody fragments, provided that they exhibit the desired biological activity (e.g. epitope binding); monoclonal antibodies; polyclonal antibodies; monospecific antibodies; multi-specific antibodies (e.g., bispecific antibodies); and antibody-like proteins.
  • antibody variable domain refers to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs).
  • CDRs complementary determining regions
  • FRs framework regions
  • linker refers to a linkage between two elements, e.g., protein domains.
  • a linker can be a covalent bond or a spacer.
  • spacer refers to a moiety (e.g., a polyethylene glycol (PEG) polymer) or an amino acid sequence (e.g., a 1-200 amino acid sequence) occurring between two polypeptides or polypeptide domains to provide space or flexibility (or both space and flexibility) between the two polypeptides or polypeptide domains.
  • an amino acid spacer is part of the primary sequence of a polypeptide (e.g., joined to the spaced polypeptides or polypeptide domains via the polypeptide backbone).
  • the term “effective amount” refers to an amount of a polypeptide or a pharmaceutical composition containing a polypeptide described herein, e.g., a polypeptide having a SIRP ⁇ D1 domain or variant thereof, that is sufficient and effective in achieving a desired therapeutic effect in treating a patient having a disease, such as a cancer, e.g., solid tumor or hematological cancer.
  • a disease such as a cancer, e.g., solid tumor or hematological cancer.
  • an effective amount of polypeptide will avoid adverse side effects.
  • the term “pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that includes an active ingredient as well as excipients or diluents (or both excipients and diluents) and enables the active ingredient to be administered by suitable methods of administration.
  • the pharmaceutical compositions disclosed herein include pharmaceutically acceptable components that are compatible with the polypeptide.
  • the pharmaceutical composition is in tablet or capsule form for oral administration or in aqueous form for intravenous or subcutaneous administration, for example by injection.
  • the terms “subject,” “individual,” and “patient” are used interchangeably to refer to a vertebrate, for example, a mammal. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed. None of the terms entail supervision of a medical professional.
  • binding affinity refers to the strength of the binding interaction between two molecules.
  • binding affinity refers to the strength of the sum total of non-covalent interactions between a molecule and its binding partner, such as a SIRP ⁇ D1 domain variant and CD47.
  • binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair.
  • the binding affinity between two molecules is commonly described by the dissociation constant (K D ) or the association constant (KA).
  • K D dissociation constant
  • KA association constant
  • Two molecules that have low binding affinity for each other generally bind slowly, tend to dissociate easily, and exhibit a large K D .
  • Two molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small K D .
  • the K D of two interacting molecules is determined using known methods and techniques, e.g., surface plasmon resonance (SPR). K D can be calculated as the ratio of koff/kon.
  • K D less than refers to a numerically smaller K D value and an increasing binding affinity relative to the recited K D value.
  • K D greater than refers to a numerically larger K D value and a decreasing binding affinity relative to the recited K D value.
  • conjunction with refers to administration of one treatment modality in addition to another treatment modality.
  • in conjunction with refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the individual.
  • kits for treating cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) a chemotherapy agent (e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents).
  • a chemotherapy agent e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents.
  • the method further comprises administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies).
  • the method further comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents). Additionally or alternatively, in some embodiments, the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • an immunotherapeutic agent e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents.
  • the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) is a small molecule inhibitor of the CD47-SIRP ⁇ pathway (e.g., RRX-001 and others). See, e.g., Miller et al. (2019) “Quantitative high-throughput screening assays for the discovery and development of SIRP ⁇ -CD47 interaction inhibitors.” PLoS ONE 14(7): e0218897 and Sasikumar et al. ACR-NCI-EORTC International Conference: Molecular Targets and Cancer Therapeutics; Oct. 26-30, 2017; Philadelphia, Pa.; Abstract B007.
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) binds CD47 (e.g., hCD47).
  • the agent binds CD47 (e.g., hCD47) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 200 pM, 100 pM, 50 pM, 25 pM, 20 pM 10 pM or less than 10 pM).
  • the agent that binds CD47 exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the agent that binds CD47 e.g., hCD47
  • the agent that binds CD47 is an anti-CD47 antibody (e.g., a therapeutic anti-CD47 antibody) or an antigen-binding fragment thereof.
  • the antigen binding fragment is a Fab, a Fab′, a Fab′-SH, an F(ab′)2, an Fv, an scFv, a one-armed antibody, or a diabody.
  • the anti-CD47 antibody is a monospecific antibody.
  • the anti-CD47 antibody is a multispecific (e.g., bispecific) antibody.
  • anti-CD47 antibody encompasses antibody-based constructs (such as multispecific constructs) including, without limitation triomabs, DARTs (i.e., dual-affinity re-targeting antibodies), TandAbs (i.e., tandem diabodies), tandem scFvs, CrossMabs, DNLs (i.e., dock and lock antibodies), DVD-Ig (i.e., dual variable domain immunoglobulins), tetravalent bispecific IgGs, nanobodies, dual targeting domains, and ART-Igs (i.e., asymmetric reengineering technology-immunoglobulins).
  • DARTs i.e., dual-affinity re-targeting antibodies
  • TandAbs i.e., tandem diabodies
  • tandem scFvs tandem scFvs
  • CrossMabs i.e., dock and lock antibodies
  • DVD-Ig i.e., dual variable domain immunoglobulins
  • the anti-CD47 antibody is Hu5F9-G4, B6H12.2, BRIC126, CC-90002, SRF231, or IBI188 (from Innovent Biologics) (see, e.g., Zhao et al. (2011), PNAS USA 108:18342-18347; Chao et al. (2010) Cell 142:699-713, Kim et al. (2012) Leukemia 26:2538-2545; Chao et al. (2011) Blood 118:4890-4891; Goto et al. (2014) Eur J. Cancer 50:1836-1846; and Edris et al. (2012) PNAS USA 109:6656-61 for additional information about these anti-CD47 antibodies).
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) binds SIRP ⁇ (e.g., hSIRP ⁇ ).
  • the agent binds SIRP ⁇ (e.g., hSIRP ⁇ ) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 200 pM, 100 pM, 50 pM, 25 pM, 20 pM 10 pM or less than 10 pM).
  • the agent that binds SIRP ⁇ exhibits at least about 50% SIRP ⁇ receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the agent that binds SIRP ⁇ e.g., hSIRP ⁇
  • the agent that binds SIRP ⁇ is an anti-SIRP ⁇ antibody (e.g., a therapeutic anti-SIRP ⁇ antibody) or an antigen-binding fragment thereof.
  • the antigen binding fragment is a Fab, a Fab′, a Fab′-SH, an F(ab′)2, an Fv, an scFv, a one-armed antibody, or a diabody.
  • the anti-SIRP ⁇ antibody is a monospecific antibody or monospecific antibody construct (including, but not limited to those described above).
  • the anti-SIRP ⁇ antibody is a multispecific (e.g., bispecific) antibody or a multispecific antibody construct (including, but not limited to those described above).
  • the anti-SIRP ⁇ antibody is KWAR23, SE12C3, 040, or MY-1 (see, e.g., Ring et al. (2017) PNAS USA 114(49): E10578-E10585); Murata et al. (2016) Cancer Sci 109(5):1300-1308; and Yanigata et al. (2017) JCI Insight 2:e89140 for additional information about these anti-SIRP ⁇ antibodies).
  • the anti-SIRP ⁇ antibody is an antibody described in WO 2018/057669; US-2018-0105600-A1; US20180312587; WO2018107058; WO2019023347; US20180037652; WO2018210795; WO2017178653; WO2018149938; WO2017068164; and WO2016063233, the contents of which are incorporated herein by reference in their entireties.
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) is an anti-SIRP ⁇ antibody or an anti-SIRP ⁇ antibody (e.g., an anti-SIRP ⁇ antibody or anti-SIRP ⁇ antibody that is capable of binding SIRP ⁇ ), or an antigen-binding fragment thereof.
  • the agent is an antibody (or antigen binding fragment thereof) that is capable of bind two or more of SIRP ⁇ , SIRP ⁇ , and SIRP ⁇ .
  • such antibody binds SIRP ⁇ (e.g., hSIRP ⁇ ) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 200 pM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • SIRP ⁇ e.g., hSIRP ⁇
  • the antibody exhibits at least about 50% SIRP ⁇ receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the antibody has an EC50 of about 80 ng/ml or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, or 5 ng/ml.
  • the antigen binding fragment is a Fab, a Fab′, a Fab′-SH, an F(ab′)2, an Fv, an scFv, a one-armed antibody, or a diabody.
  • the antibody is a monospecific antibody or monospecific antibody construct (including, but not limited to those described above).
  • the antibody is a multispecific (e.g., bispecific) antibody or a multispecific antibody construct (including, but not limited to those described above).
  • the agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • the agent that blocks the interaction between CD47 is a fusion polypeptide comprising a moiety that binds CD47.
  • the fusion polypeptide comprises an antibody Fc region and a moiety that binds CD47.
  • the portion of the fusion polypeptide that binds CD47 binds CD47 (e.g., hCD47) binds CD47 (e.g., hCD47) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 20 OpM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • the fusion polypeptide exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the fusion polypeptide has an EC50 of about 80 ng/ml or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, or 5 ng/ml.
  • the fusion polypeptide comprises WT human antibody Fc region.
  • the fusion polypeptide comprises an Fc variant (e.g., a variant of a WT human antibody Fc region) that exhibits reduced (e.g., such as ablated) effector function as compared to a WT Fc region.
  • Fc variants are described in WO 2017/027422 and US 2017/0107270, the contents of which are incorporated herein by reference in their entireties.
  • moiety that binds CD47 e.g., hCD47
  • WT SIRP ⁇ e.g., hSIRP ⁇
  • WT SIRP ⁇ e.g., hSIRP ⁇
  • moiety that binds CD47 is a CD47-binding fragment (e.g., d1 domain) of a WT SIRP ⁇ (e.g., hSIRP ⁇ ), or a WT SIRP ⁇ (e.g., hSIRP ⁇ ).
  • the moiety that binds CD47 is a SIRP ⁇ variant, a SIRP ⁇ variant, a SIRP ⁇ variant, or a CD47-binding fragment thereof (e.g., the d1 domain).
  • SIRP ⁇ variants Exemplary SIRP ⁇ variants, SIRP ⁇ 1 variant, and SIRP ⁇ 2 variants are described in, e.g., WO 2013/109752; US 2015/0071905; U.S. Pat. No. 9,944,911; WO 2016/023040; WO 2017/027422; US 2017/0107270; U.S. Pat. Nos.
  • the agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • hCD47 a fusion polypeptide comprising an antibody Fc region and a SIRP ⁇ variant.
  • the SIRP ⁇ variant binds CD47 (e.g., hCD47) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 20 OpM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3 nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 20 OpM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • the fusion polypeptide exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the fusion polypeptide has an EC50 of about 80 ng/ml or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, or 5 ng/ml.
  • the fusion polypeptide comprises WT human antibody Fc region.
  • the fusion polypeptide comprises an Fc variant (e.g., a variant of a WT human antibody Fc region) that exhibits reduced (e.g., such as ablated) effector function as compared to a WT Fc region, such as those described in the references cited herein.
  • the fusion polypeptide comprises a SIRP ⁇ variant described in WO 2013/109752; US 2015/0071905; WO 2016/023040; WO 2017/027422; US 2017/0107270; U.S. Pat. Nos.
  • the fusion polypeptide comprising an antibody Fc region and a SIRP ⁇ variant is TTI-621, TTI-622, or IMM01 (see, e.g., Petrova et al. (2017) Clin Cancer Res 23:1086-1079; Russ et al.
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) is a fusion polypeptide comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • a method of treating cancer e.g., leukemia, such as acute lymphoblastic leukemia
  • an individual e.g., a human individual
  • administering comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) an BCL2 inhibitor (e.g., a selective BCL2 inhibitor, such as venetoclax).
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • an BCL2 inhibitor e.g., a selective BCL2 inhibitor, such as venetoclax
  • the agent is a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant) wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85, wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234
  • a method of treating cancer e.g., colon cancer in an individual (e.g., a human individual), comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), and (b) platinum-based chemotherapy agent (e.g., cisplatin).
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • platinum-based chemotherapy agent e.g., cisplatin
  • the agent is a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234
  • a method of treating cancer e.g., head and neck cancer, such as head and neck squamous cell carcinoma
  • an individual e.g., a human individual
  • administering comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ )
  • a PD-1 inhibitor e.g., a PD-1 inhibitor
  • an anti-metabolite e.g., a platinum-based chemotherapy agent.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant) wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85, wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S
  • a method of treating cancer e.g., gastric cancer or gastroesophageal cancer
  • an individual e.g., a human individual
  • administering comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ )
  • a agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • an anti-HER2 antibody e.g., hSIRP ⁇
  • an anti-VEGFR2 antibody e.g., paclitaxel
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is a polypeptide comprising a SIRP ⁇ D1 domain variant and an Fc domain variant) wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85, wherein the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S
  • SIRP ⁇ Signal-Regulatory Protein ⁇
  • polypeptides comprising a signal-regulatory protein a (SIRP- ⁇ ) D1 variant comprising a SIRP ⁇ D1 domain, or a fragment thereof, that comprises an amino acid mutation at residue 80 relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2); and at least one additional amino acid mutation relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein a
  • polypeptides comprising an Fc domain variants, wherein an Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • SIRP- ⁇ Signal-regulatory protein ⁇
  • SIRP-alpha Signal-regulatory protein ⁇
  • CD47 a protein broadly expressed on many cell types in the body. The interaction of SIRP ⁇ with CD47 prevents engulfment of “self” cells, which can otherwise be recognized by the immune system. It has been observed that high CD47 expression on tumor cells can act, in acute myeloid leukemia and several solid tumor cancers, as a negative prognostic factor for survival.
  • SIRP ⁇ comprises 3 highly homologous immunoglobulin (Ig)-like extracellular domains—D1, D2, and D3.
  • the SIRP ⁇ D1 domain (“D1 domain”) refers to the membrane distal, extracellular domain of SIRP ⁇ and mediates binding of SIRP ⁇ to CD47.
  • SIRP ⁇ polypeptide refers to any SIRP ⁇ polypeptide or fragment thereof that is capable of binding to CD47.
  • Table 1 shows the amino acid sequences of the D1 domains of the naturally occurring wild-type human SIRP ⁇ D1 domain variants (SEQ ID NOs: 1 and 2).
  • a SIRP ⁇ polypeptide comprises a SIRP ⁇ D1 domain.
  • a SIRP ⁇ polypeptide comprises a wild-type D1 domain, such as those provided in SEQ ID NOs: 1 and 2.
  • a SIRP ⁇ polypeptide includes a D2 or D3 domain (or both a D2 and a D3 domain) (see Table 3) of a wild-type human SIRP ⁇ .
  • SIRP ⁇ D1 domain variant refers to a polypeptide comprising a SIRP ⁇ D1 domain or a CD47-binding portion of a SIRP ⁇ polypeptide that has a higher affinity to CD47 than wild-type SIRP ⁇ .
  • a SIRP ⁇ D1 domain variant comprises at least one amino acid substitution, deletion, or insertion (or a combination thereof) relative to a wild-type SIRP ⁇ .
  • SIRP ⁇ D1 domain variants disclosed herein comprise a SIRP ⁇ D1 domain or variant thereof.
  • a SIRP ⁇ D1 domain variant comprises one or more amino acid substitutions, insertions, additions, or deletions relative to a wild-type D1 domain shown in SEQ ID NOs: 1 and 2.
  • Table 2 lists exemplary amino acid substitutions in each SIRP ⁇ D1 domain variant (SEQ ID NOs: 13-14).
  • the SIRP ⁇ D1 domain polypeptide or SIRP ⁇ D1 domain variant comprises a fragment of the D1 domain.
  • the SIRP ⁇ polypeptide fragment or SIRP ⁇ D1 domain variant fragment comprises an amino acid sequence of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length.
  • the SIRP ⁇ D1 domain fragments retain the ability to bind to CD47.
  • a polypeptide of the disclosure comprising a SIRP ⁇ D1 domain variant binds with higher binding affinity to CD47 than a wild-type human SIRP ⁇ D1 domain.
  • the SIRP ⁇ D1 domain variant binds to human CD47 with at least 1-fold (e.g., at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold or greater than 5-fold) affinity than the affinity of a naturally occurring D1 domain.
  • the SIRP ⁇ D1 domain variant binds to human CD47 with at least 1-fold (e.g., at least 10-fold, 100-fold, 1000-fold or greater than 1000-fold) affinity than the affinity of a naturally occurring D1 domain.
  • the term “optimized affinity” or “optimized binding affinity” refers to an optimized strength of the binding interaction between a polypeptide disclosed herein, including a SIRP ⁇ D1 domain variant, and CD47.
  • the polypeptide binds primarily or with higher affinity to CD47 on cancer cells and does not substantially bind or binds with lower affinity to CD47 on non-cancer cells.
  • the binding affinity between the polypeptide and CD47 is optimized such that the interaction does not cause clinically relevant toxicity or decreases toxicity compared to a variant which binds with maximal affinity.
  • the polypeptide including a SIRP ⁇ D1 domain variant in order to achieve an optimized binding affinity between a polypeptide provided herein and CD47, is developed to have a lower binding affinity to CD47 than which is maximally achievable.
  • the SIRP ⁇ D1 domain variants disclosed herein cross react with rodent, non-human primate (NHP), and human CD47.
  • immunogenicity refers to the property of a protein (e.g., a therapeutic protein) which causes an immune response in the host as though it is a foreign antigen.
  • the immunogenicity of a protein can be assayed in vitro in a variety of different ways, such as through in vitro T-cell proliferation assays.
  • minimal immunogenicity refers to an immunogenicity of a protein (e.g., a therapeutic protein) that has been modified, e.g., through amino acid substitutions, to be lower (e.g., at least 10%, 25%, 50%, or 100% lower) than the immunogenicity before the amino acid substitutions are introduced (e.g., an unmodified protein).
  • a protein e.g., a therapeutic protein
  • a protein is modified to have minimal immunogenicity and causes no or very little host immune response even though it is a foreign antigen.
  • the SIRP ⁇ D1 domain variant demonstrates minimal immunogenicity.
  • a SIRP ⁇ polypeptide of the disclosure administered to a subject has the same amino acid sequence as that of the SIRP ⁇ polypeptide in a biological sample of the subject, except for amino acid changes which increase affinity of the SIRP ⁇ D1 domain variant.
  • the polypeptide variants disclosed herein lower the risk of side effects compared to anti-CD47 antibodies or wild-type SIRP ⁇ .
  • the polypeptide variants disclosed herein lower the risk of anemia compared to anti-CD47 antibodies or wild-type SIRP ⁇ .
  • the polypeptide variants disclosed herein do not cause acute anemia in rodent or non-human primates (NHP) studies.
  • a SIRP ⁇ D1 domain variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 2.
  • a SIRP ⁇ D1 domain variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant includes at most ten amino acid substitutions relative to a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant includes at most seven amino acid substitutions relative to a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant is a chimeric SIRP ⁇ D1 domain variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof).
  • a chimeric SIRP ⁇ D1 domain variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain.
  • a chimeric SIRP ⁇ D1 domain variant further includes one or more amino acid substitutions listed in Table 2.
  • a polypeptide comprises a SIRP ⁇ D1 domain variant that comprises a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 13), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the sequence of SEQ ID NOs: 13, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is L, T, or G.
  • X 11 is K or R.
  • X 12 is V or I.
  • X 13 is F, L, V.
  • X 14 is F or V.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain that comprises the sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain that comprises the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain that comprises the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain that comprises the sequence of SEQ ID NO: 1.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP ⁇ D1 domain variant that comprises a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEXHKSGAGTELSVR AKPS (SEQ ID NO: 14), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • the polypeptide comprises the sequence of SEQ ID NO: 14, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is V, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is V or I. In some embodiments, X 13 is F, L, or V. In some embodiments, X 14 is F or V. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain that comprises the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 19 M, less than 1 ⁇ 10 ⁇ 19 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of: EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 NITPADAGTYYCX 24 KX 25 RKGSPDX 26 X 27 EX 28 KSGAGTELSVRX 29 KPS (SEQ ID NO: 23), wherein X 1 is E or G; X 2 is L, I, or V; X 3 is V, L, or, I; X 4 is S or F; X 5 is L or S; X 6 is S or T; X 7 is A or V; X 8 is I or T; X 9 is H or R; X 10 is A, V, I, or L;
  • X 2 is L, I, or V.
  • X 3 is V, L, or, I.
  • X 4 is S or F.
  • X 5 is L or S.
  • X 6 is S or T.
  • X 7 is A or V.
  • X 8 is I or T.
  • X 9 is H or R.
  • X 10 is A, V, I, or L.
  • X 11 is I, T, S, or F.
  • X 12 is A or G.
  • X 13 is E, V, or L.
  • X 14 is K or R.
  • X 15 is E or Q.
  • X 16 is H, P, or R.
  • X 17 is D or E.
  • X 18 is S, L, T, or G.
  • X 19 is K or R.
  • X 20 is E or D.
  • X 21 is S or P.
  • X 22 is S or R.
  • X 23 is S or G.
  • X 24 is V or I.
  • X 25 is F, L, V.
  • X 26 is D or absent.
  • X 27 is T or V.
  • X 28 is F or V. In some embodiments, X 29 is A or G. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide of the disclosure including a SIRP ⁇ D1 domain variant further comprises a D2 domain having the sequence of SEQ ID NO: 24, a D3 domain having the sequence of SEQ ID NO: 25, or a D2 domain having the sequence of SEQ ID NO: 24 and a D3 domain having the sequence of SEQ ID NO: 25 of a wild-type human SIRP ⁇ as shown in Table 3.
  • the SIRP ⁇ D1 domain variant further comprises a fragment or variant of a D2 domain or a fragment or variant of a D3 domain.
  • the SIRP ⁇ D1 domain variant further comprises a fragment or variant of a D2 domain and a fragment or variant of a D3 domain.
  • a SIRP ⁇ D1 domain variant is joined to a D2 or D3 domain by way of a linker. In some embodiments, a SIRP ⁇ D1 domain variant is joined to a D2 and D3 domain by way of a linker.
  • a polypeptide of the disclosure including a SIRP ⁇ D1 domain variant is attached to an Fc domain variant in order to improve the pharmacokinetic properties of the polypeptide, e.g., increase serum half-life.
  • a SIRP ⁇ D1 domain variant is attached to an Fc domain variant that is unable to dimerize.
  • Fc domain variants serve to increase the serum half-life of the polypeptides described herein.
  • a polypeptide of the disclosure including a SIRP ⁇ D1 domain variant does not include the sequence of any one of SEQ ID NOs: 26-36 shown in Table 4.
  • polypeptides and polypeptide constructs described herein are utilized in vitro for binding assays, such as immune assays.
  • the polypeptides and polypeptide constructs described herein are utilized in liquid phase or bound to a solid phase carrier.
  • polypeptides utilized for immunoassays are detectably labeled in various ways.
  • polypeptides and polypeptide constructs described herein are bound to various carriers and used to detect the presence of specific antigen expressing cells.
  • carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
  • the nature of the carrier can be either soluble or insoluble.
  • labels include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds.
  • Various techniques for binding labels to polypeptides disclosed herein are available.
  • the polypeptides are coupled to low molecular weight haptens. These haptens are then specifically detected by means of a second reaction.
  • the hapten biotin is used with avidin or the haptens dinitrophenol, pyridoxal, or fluorescein are detected with specific anti-hapten antibodies (e.g., anti-dinitrophenol antibodies, anti-pyridoxal antibodies, and anti-fluorescein antibodies respectively).
  • polypeptides comprising a signal-regulatory protein a (SIRP- ⁇ ) D1 variant comprising a SIRP ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2); and at least one additional amino acid mutation relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein a
  • polypeptides comprising an Fc domain variant, wherein an Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a polypeptide in a composition disclosed herein comprises a SIRP ⁇ D1 domain variant that has reduced or minimal glycosylation.
  • the D1 domain of SEQ ID NOs: 1 and 2 in Table 1 each contains a single potential N-linked glycosylation site at amino acid N80 in the sequence N80ITP.
  • Expression of a SIRP ⁇ D1 domain in Chinese Hamster Ovary (CHO) cells results in a major band of 16 kDa (non-glycosylated) and a minor band of higher molecular weight that was removed by Endo Hf.
  • Endo Hf is a recombinant protein fusion of Endoglycosidase H and maltose binding protein.
  • Endo Hf cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. This implies that a proline at amino acid position 83 can reduce the efficiency of glycosylation, leading to a protein with different degrees of glycosylation and therefore heterogeneity. For drug development, heterogeneity can give rise to challenges in process development. Therefore, to investigate the possibility of generating homogenous, non-glycosylated forms of SIRP ⁇ D1 domain variants, in some embodiments, amino acid N80 of a SIRP ⁇ D1 variant is mutated to Ala.
  • amino acid N80 in a SIRP ⁇ D1 domain variant is replaced by any amino acid, including any naturally and non-naturally occurring amino acid, e.g., N80A and N80Q.
  • a SIRP ⁇ D1 domain variant comprises an N80A mutation and at least 1 additional mutation (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 additional mutations or more).
  • the additional mutation is in the CD47 binding site.
  • the additional mutation is in the hydrophobic core of the D1 domain.
  • a polypeptide in a composition disclosed herein includes a SIRP ⁇ D1 domain variant that has increased glycosylation relative to a wild-type SIRP ⁇ D1 domain. Another option to increase homogeneity of the final product is to enhance the efficiency of glycosylation at amino acid N80 and generate SIRP ⁇ D1 domain variants with increased glycosylation relative to a wild-type.
  • the amino acid P83 in the sequence NITP83 affects the degree of glycosylation at amino acid N80. In some embodiments, changing P83 to any amino acid increases the efficiency of glycosylation at N80.
  • amino acid P83 in a SIRP ⁇ D1 domain variant is replaced by any amino acid, including naturally and non-naturally amino acids, e.g., P83V, P83A, P831, and P83L.
  • a polypeptide of the disclosure is expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, for example by genetic engineering of the cell line (e.g., genetically engineered yeast or mammalian host) or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote ( E. coli , etc.).
  • a SIRP ⁇ D1 domain variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 5.
  • the SIRP ⁇ D1 domain variants are not glycosylated or are minimally glycosylated.
  • the SIRP ⁇ D1 domain variants are fully glycosylated or almost fully glycosylated.
  • a SIRP ⁇ D1 domain variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant includes at most ten amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a SIRP ⁇ D1 domain variant includes at most seven amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a SIRP ⁇ D1 domain variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
  • a SIRP ⁇ D1 domain variant is a chimeric SIRP ⁇ D1 domain variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof).
  • a chimeric SIRP ⁇ D1 domain variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain.
  • a chimeric SIRP ⁇ D1 domain variant further includes one or more amino acid substitutions listed in Table 5.
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 37), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D,
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of SEQ ID NO: 37, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is L, T, or G.
  • X 11 is K or R.
  • X 12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 14 is V or I.
  • X 15 is F, L, V.
  • X 16 is F or V.
  • a polypeptide provided herein includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide provided herein includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELS VRAKPS (SEQ ID NO: 38), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D, E
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of SEQ ID NO: 38, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is V, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 14 is V or I.
  • X 15 is F, L, or V.
  • X 16 is F or V.
  • a polypeptide includes a SIRP ⁇ D1 domain variant having no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, a polypeptide includes a SIRP ⁇ D1 domain variant having no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 in less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGSP DX 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E or G; X 2 is L, I, or V; X 3 is V, L, or, I; X 4 is S or F; X 5 is L or S; X 6 is S or T; X 7 is A or V; X 8 is I or T; X 9 is H, R, or L; X 10 is A,
  • the polypeptide comprises the sequence of SEQ ID NO: 47, wherein X 1 is E or G.
  • X 2 is L, I, or V.
  • X 3 is V, L, or, I.
  • X 4 is S or F.
  • X 5 is L or S.
  • X 6 is S or T.
  • X 7 is A or V.
  • X 8 is I or T.
  • X 9 is H or R.
  • X 10 is A, V, I, or L.
  • X 11 is I, T, S, or F.
  • X 12 is A or G.
  • X 13 is E, V, or L.
  • X 14 is K or R.
  • X 15 is E or Q.
  • X 16 is H, P, or R.
  • X 17 is D or E.
  • X 18 is S, L, T, or G.
  • X 19 is K or R.
  • X 20 is E or N.
  • X 21 is S or P.
  • X 22 is S or R.
  • X 23 is S or G.
  • X 24 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 25 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 26 is V or I.
  • X 27 is F, L, V.
  • X 28 is D or absent.
  • X 29 is T or V.
  • X 30 is F or V.
  • X 31 is A or G.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP ⁇ D1 domain variant having a sequence of: EELQX 1 IQPDKSVX 2 VAAGEX 3 AX 4 LX 5 CTX 6 TSLX 7 PVGPIQWFRGAGPX 8 RX 9 LIYNQX 10 X 11 GX 12 FPRVTTVSX 13 X 14 TKRX 15 NMDFSIX 16 IX 17 X 18 ITPADAGTYYCX 19 KFRKGX 20 X 21 X 22 DX 23 E FKSGAGTELSVRAKPS (SEQ ID NO: 48), wherein X 1 is V or I; X 2 is L or S; X 3 is T or S; X 4 is T or I; X 5 is R or H; X 6 is A, V, or I; X 7 is I, R, Y, K or F; X 8 is G or A; X 9 is E or V; X 10 is K or R; X 11 is E, D or Q; X 12 is H or
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSDX 8 TKRNNMDFSIRIGX 9 ITPADAGTYYCX 10 KFRKGSPDDVEFKSGAGTELSVRAK PS (SEQ ID NO: 49), wherein X 1 is V, L, or I; X 2 is A, I, V, or L; X 3 is I, F, S, or T; X 4 is E, V, or L; X 5 is K or R; X 6 is E or Q; X 7 is H, P, or R; X 8 is L, T, S, or G; X 9 is A; and X 10 is V or I; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRP ⁇ D1 domain having the
  • the polypeptide comprises the sequence of SEQ ID NO: 49, wherein X 1 is V, L or I.
  • X 2 is A, I, V, or L.
  • X 3 is I, F, S, or T.
  • X 4 is E, V, or L.
  • X 5 is K or R.
  • X 6 is E or Q.
  • X 7 is H, P, or R.
  • X 8 is L, T, S or G.
  • X 9 is A.
  • X 10 is V or I.
  • the polypeptide comprises a SIRP ⁇ D1 domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 49, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , and X 10 are not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEELQX 1 IQPDKSVSVAAGESAILHCTX 2 TSLX 3 PVGPIQWFRGAGPARX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSEX 8 TKRENMDFSISISX 9 ITPADAGTYYCX 10 KFRKGSPDTEFKSGAGTELSVRAKPS, (SEQ ID NO: 50), wherein X 1 is V or I; X 2 is V or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is E or Q; X 7 is H or P; X 8 is S or T; X 9 is N or A; and X 10 V or I; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide comprises the sequence of SEQ ID NO: 50, wherein X 1 is V or I.
  • X 2 is V or I.
  • X 3 is I or F.
  • X 4 is E or V.
  • X 5 is K or R.
  • X 6 is E or Q.
  • X 7 is H or P.
  • X 8 is S or R.
  • X 9 is N or A.
  • X 10 is V or I.
  • the polypeptide comprises a SIRP ⁇ D1 domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 50, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , and X 10 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 EGX 6 FPR VTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 51), wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is N or A; and X 9 is V or I; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein X 1 is V or I.
  • X 2 is A or I.
  • X 3 is I or F.
  • X 4 is E or V.
  • X 5 is K or R.
  • X 6 is H or P.
  • X 7 is L or T.
  • X 8 is N or A.
  • X 9 is V or I.
  • X 4 is not V.
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein X 8 is A.
  • X 8 is A and X 1 is V or I.
  • X 8 is A and X 2 is A or I.
  • X 8 is A and X 3 is I or F.
  • X 8 is A and X 4 is E or V. In some embodiments, X 4 is not V.
  • X 8 is A and X 5 is K or R.
  • X 8 is A and X 6 is H or P. In any of the aforementioned embodiments, X 8 is A and X 7 is A or V. In any of the aforementioned embodiments, X 8 is A and X 9 is V or I.
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein X 8 is A.
  • X 8 is A and X 1 is I.
  • X 8 is A and X 2 is I.
  • X 8 is A and X 3 is F.
  • X 8 is A and X 4 is V.
  • X 8 is A and X 5 is R.
  • X 8 is A and X 6 is P.
  • X 8 is A and X 7 is T.
  • X 8 is A and X 9 is I.
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 51, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , and X 9 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure comprises no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure comprises no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NOs: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 10 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRELIYNQX 4 EGX 5 FPR VTTVSDX 6 TKRNNMDFSIRIGX 7 ITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 222), wherein X 1 is V, L, or I; X 2 is A, I, or L; X 3 is I, T, S, or F; X 4 is K or R; X 5 is H or P; X 6 is L, T, or G; X 7 is N or A; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRP ⁇ D1 domain having a sequence according to SEQ ID NO: 1.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X 1 is V, L, or I.
  • X 2 is A, I, or L.
  • X 3 is I, T, S, or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is L, T, or G.
  • X 7 is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X 1 is V or I.
  • X 2 is A or I.
  • X 3 is I or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is L or T.
  • X 7 is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X 7 is A.
  • X 7 is A and X 1 is V or I.
  • X 7 is A and X 2 is A or I.
  • X 7 is A and X 3 is I or F.
  • X 7 is A and X 4 is K or R.
  • X 7 is A and X 5 is H or P.
  • X 7 is A and X 6 is L or T.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X 7 is A.
  • X 7 is A and X 1 is I.
  • X 7 is A and X 2 is I.
  • X 7 is A and X 3 is F.
  • X 7 is A and X 4 is R.
  • X 7 is A and X 5 is P.
  • X 7 is A and X 6 is T.
  • the polypeptide comprises a SIRP ⁇ D1 domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 222, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 1.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRP ⁇ D1 domain variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP ⁇ polypeptide binds to CD47.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP ⁇ D1 domain variant having a sequence of: EEELQX 1 IQPDKSVSVAAGESAILHCTX 2 TSLX 3 PVGPIQWFRGAGPARELIYNQX 4 EGX 5 FPRV TTVSEX 6 TKRENMDFSISISX 7 ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS (SEQ ID NO: 212), wherein X 1 is V, L, or I; X 2 is V, I, or L; X 3 is I, T, S, or F; X 4 is K or R; X 5 is H, P, or R; X 6 is S, T, or G; X 7 is N or A; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X 1 is V, L, or I.
  • X 2 is V, I, or L.
  • X 3 is I, T, S, or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is S, T, or G.
  • X 7 is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X 1 is V or I.
  • X 2 is V or I.
  • X 3 is I or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is S or T.
  • X 7 is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X 7 is A.
  • X 7 is A and X 1 is V or I.
  • X 7 is A and X 2 is V or I.
  • X 7 is A and X 3 is I or F.
  • X 7 is A and X 4 is K or R.
  • X 7 is A and X 5 is H or P.
  • X 7 is A and X 6 is S or T.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X 7 is A.
  • X 7 is A and X 1 is I.
  • X 7 is A and X 2 is I.
  • X 7 is A and X 3 is F.
  • X 7 is A and X 4 is R.
  • X 7 is A and X 5 is P.
  • X 7 is A and X 6 is T.
  • the polypeptide comprises a SIRP ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 212, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 is not a wild-type amino acid.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRP ⁇ D1 domain variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP ⁇ polypeptide binds to CD47.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide comprising a SIRP ⁇ D1 domain variant having a sequence according to: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSDX 8 TKRNNMDFSIRIGX 9 X 10 X 11 X 12 ADAGTYYCX 13 KFRKGSPDDVEFKSGAGTELS VRAKPS (SEQ ID NO: 218), wherein X 1 is V, L, or I; X 2 is A, V, L, or I; X 3 is I, S, T, or F; X 4 is E, L, or V; X 5 is K or R; X 6 is E or Q; X 7 is H, R, or P; X 8 is S, G, L, or T; X 9 is any amino acid; X 10 is any amino acid; X 11 is any amino acid; X 12
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X 1 , wherein X 9 is A.
  • X 9 is N.
  • X 10 is I.
  • X 9 is N and X 10 is P.
  • X 9 is N and X 11 is any amino acid other than S, T, or C.
  • X 11 is T.
  • X 11 is an amino acid other than T.
  • X 12 is P.
  • X 9 is N and X 12 is any amino acid other than P.
  • a polypeptide comprising a SIRP ⁇ D1 domain variant having a sequence according to: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSDXsTKRNNMDFSIRIGX 9 ITX 10 ADAGTYYCX 11 KFRKGSPDDVEFKSGAGTELSVRA KPS (SEQ ID NO: 219), wherein X 1 is V, L, or I; X 2 is A, V, L, or I; X 3 is I, S, T, or F; X 4 is E, L, or V; X 5 is K or R; X 6 is E or Q; X 7 is H, R, or P; X 8 is S, G, L, or T; X 9 is N; X 10 is any amino acid other than P; and X 11 is V or I; and wherein the SIRP ⁇ D
  • compositions which include a SIRP ⁇ D1 domain variant polypeptide having the amino acid sequence of SEQ ID NO: 48, or a fragment thereof.
  • the SIRP ⁇ D1 domain variant polypeptide or fragment thereof binds to CD47 with a higher affinity compared to the affinity that a SIRP ⁇ polypeptide binds to the CD47.
  • the SIRP ⁇ D1 domain variant polypeptide binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, or less than 1 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • the above-mentioned SIRP ⁇ D1 domain variant polypeptides are attached or fused to a second polypeptide.
  • the second polypeptide includes, without limitation, an Fc polypeptide, an Fc variant or a fragment of the foregoing.
  • a SIRP ⁇ D1 domain variant polypeptide is selected from any one of SEQ ID NOs: 53-87 and 213 shown in Table 6.
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 6.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide comprises a SIRP ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 80, 81, or 85 in Table 6.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2); and at least one additional amino acid mutation relative to a wild-type SIRP ⁇ D1 domain (e.g., a wild-type SIRP ⁇ D1 domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • Fc domain variant dimers wherein the Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Antibodies that target cell surface antigens can trigger immunostimulatory and effector functions that are associated with Fc receptor (FcR) engagement on immune cells.
  • Fc receptor Fc receptor
  • Binding of the Fc region to Fc receptors on cell surfaces can trigger a number of biological responses including phagocytosis of antibody-coated particles (antibody-dependent cell-mediated phagocytosis, or ADCP), clearance of immune complexes, lysis of antibody-coated cells by killer cells (antibody-dependent cell-mediated cytotoxicity, or ADCC) and, release of inflammatory mediators, placental transfer, and control of immunoglobulin production. Additionally, binding of the C1 component of complement to antibodies can activate the complement system. Activation of complement can be important for the lysis of cellular pathogens. However, the activation of complement can also stimulate the inflammatory response and can also be involved in autoimmune hypersensitivity or other immunological disorders. Variant Fc regions with reduced or ablated ability to bind certain Fc receptors are useful for developing therapeutic antibodies and Fc-fusion polypeptide constructs which act by targeting, activating, or neutralizing ligand functions while not damaging or destroying local cells or tissues.
  • a SIRP ⁇ D1 polypeptide construct comprises a non-naturally occurring SIRP ⁇ D1 domain variant linked to an Fc domain variant which forms an Fc domain having ablated or reduced effector function.
  • a Fc domain variant refers to a polypeptide chain that includes second and third antibody constant domains (e.g., CH2 and CH3).
  • an Fc domain variant also includes a hinge domain.
  • the Fc domain variant is of any immunoglobulin antibody isotype, including IgG, IgE, IgM, IgA, and IgD.
  • an Fc domain variant is of any IgG subtype (e.g., IgG1, IgG2, IgG2a, IgG2b, IgG2c, IgG3, and IgG4).
  • an Fc domain variant comprises as many as ten amino acid modifications (e.g., insertions, deletions and/or substitutions) relative to a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof) that alter the interaction between an Fc domain and an Fc receptor.
  • amino acid modifications e.g., insertions, deletions and/or substitutions
  • a wild-type Fc domain monomer sequence e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof
  • Fc domain dimer refers to a dimer of two Fc domains.
  • two wild-type Fc domains dimerize by the interaction between the two CH3 antibody constant domains, as well as one or more disulfide bonds that form between the hinge domains of the two dimerized Fc domains.
  • Fc domain dimer variant comprises at least one Fc domain variant.
  • an Fc domain dimer variant comprises Fc domain variants that are mutated to lack effector functions, for example a “dead Fc domain dimer variant.”
  • each of the Fc domains in an Fc domain dimer variant includes amino acid substitutions in the CH2 antibody constant domain to reduce the interaction or binding between the Fc domain dimer variant and an Fc receptor, such as an Fc ⁇ receptor (Fc ⁇ R), an Fc ⁇ receptor (Fc ⁇ R), or an Fc ⁇ (Fc ⁇ R).
  • a SIRP ⁇ D1 domain variant (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc domain variant of an immunoglobulin or a fragment of an Fc domain variant.
  • an Fc domain variant of an immunoglobulin or a fragment of an Fc domain variant is capable of forming an Fc domain dimer with another Fc domain variant.
  • an Fc domain variant of an immunoglobulin or a fragment of an Fc domain variant is not capable of forming an Fc domain dimer with another Fc domain variant.
  • an Fc domain variant or a fragment of an Fc domain variant is fused to a polypeptide of the disclosure to increase serum half-life of the polypeptide.
  • an Fc domain variant or a fragment of an Fc domain variant fused to a polypeptide of the disclosure dimerizes with a second Fc domain variant to form an Fc domain dimer variant which binds an Fc receptor, or alternatively, an Fc domain variant binds to an Fc receptor.
  • an Fc domain variant or a fragment of the Fc domain variant fused to a polypeptide to increase serum half-life of the polypeptide does not induce any immune system-related response.
  • a SIRP ⁇ polypeptide or construct provided herein includes a SIRP ⁇ D1 domain or variant thereof joined to a first Fc domain variant and an antibody variable domain joined to a second Fc domain variant, in which the first and second Fc domain variants combine to form an Fc domain dimer variant (e.g., a heterodimeric Fc domain dimer variant).
  • An Fc domain dimer is the protein structure that is found at the C-terminus of an immunoglobulin.
  • An Fc domain dimer includes two Fc domains that are dimerized by the interaction between the CH3 antibody constant domains.
  • a wild-type Fc domain dimer forms the minimum structure that binds to an Fc receptor, e.g., Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIIIa, Fc ⁇ RIIIb, and Fc ⁇ RIV.
  • the Fc domain dimer is not involved directly in binding an antibody to its target, but can be involved in various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • the Fc domain in a SIRP ⁇ polypeptide or construct of the disclosure comprises amino acid substitutions, additions or insertions, deletions, or any combinations thereof that lead to decreased effector function such as decreased antibody-dependent cell-mediated cytotoxicity (ADCC), decreased complement-dependent cytolysis (CDC), decreased antibody-dependent cell-mediated phagocytosis (ADCP), or any combinations thereof.
  • the SIRP ⁇ polypeptides or constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to a human Fc receptor and decreased binding (e.g., minimal binding or absence of binding) to complement protein C1q.
  • the SIRP ⁇ constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to human Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIB, or any combinations thereof, and C1q.
  • the Fc domains in SIRP ⁇ constructs of the disclosure are of the IgG class and comprise one or more amino acid substitutions at E233, L234, L235, G236, G237, D265, D270, N297, E318, K320, K322, A327, A330, P331, or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))).
  • polypeptide constructs comprising a non-native Fc region described herein exhibit reduced or ablated binding to at least one of Fc ⁇ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a polypeptide construct comprising a native Fc region.
  • the polypeptide constructs described herein exhibit reduced or ablated binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors.
  • CDC refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc domains.
  • polypeptide constructs comprising a non-native Fc region described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-natural Fc domain variants or Fc domain dimer variants as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • the Fc domain variants or Fc domain dimer variants described herein are minimally glycosylated or have reduced glycosylation relative to a wild-type sequence.
  • deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N.
  • the N-Xaa1-Xaa2-Xaa3 motif refers to residues 297-300 as designated according to Kabat et al., 1991.
  • a mutation to any one or more of N, Xaa1, Xaa2, or Xaa3 results in deglycosylation of the Fc domain variant or Fc domain dimer variant.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fc ⁇ receptors or have a reduced capacity to induce phagocytosis.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fc ⁇ receptors and have a reduced capacity to induce phagocytosis.
  • an Fc domain variant is mutated to lack effector functions, typical of a “dead” Fc domain variant.
  • an Fc domain variant includes specific amino acid substitutions that are known to minimize the interaction between the Fc domain dimer and an Fc ⁇ receptor.
  • an Fc domain variant is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al., 1991).
  • one or more additional mutations are included in such IgG1 Fc domain variant.
  • additional mutations for human IgG1 Fc domain variants include E318A and K322A.
  • a human IgG1 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer mutations in total as compared to wild-type human IgG1 sequence.
  • one or more additional deletions are included in such IgG1 Fc domain variant.
  • the C-terminal lysine of the Fc domain IgG1 heavy chain constant region provided in SEQ ID NO: 88 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgG1 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG1 sequence (see, e.g., SEQ ID NO: 161 below).
  • a IgG1 Fc domain variant has a sequence according to any one of SEQ ID NO: 135, SEQ ID NO: 136 or SEQ ID NO: 137.
  • SEQ ID NO: 161 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG
  • an Fc domain variant is from an IgG2 or IgG4 antibody and includes amino acid substitutions A330S, P331S, or both A330S and P331S.
  • the aforementioned amino acid positions are defined according to Kabat, et al. (1991).
  • the Kabat numbering of amino acid residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the Fc domain variant comprises a human IgG2 Fc domain sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • one or more additional mutations are included in such IgG2 Fc domain variants.
  • additional mutations for human IgG2 Fc domain variant include V234A, G237A, P238S, V309L and H268A (as designated according to the EU numbering system per Kabat et al. (1991)).
  • a human IgG2 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 or fewer mutations in total as compared to wild-type human IgG2 sequence.
  • one or more additional deletions are included in such IgG2 Fc domain variant.
  • the C-terminal lysine of the Fc domain IgG2 heavy chain constant region provided in SEQ ID NO: 89 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgG2 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG2 sequence (see, e.g., SEQ ID NO: 162 below).
  • SEQ ID NO: 162 ERKCCVECPPCPAPPVAGPSVFLFPFKPKDTLMISRTPEVTCVVVDVSHE DPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEY KCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNTQKSLSLSPG
  • the Fc domain variant is an IgG4 Fc domain variant
  • such Fc domain variant comprises a S228P mutation (as designated according to Kabat, et al. (1991)).
  • a human IgG4 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation(s) in total as compared to wild-type human IgG4 sequence.
  • the Fc domain variant comprises a human IgG4 Fc sequence comprising one or more of S228P, E233P, F234V, L235A, and delG236 amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • the Fc domain variant comprises a human IgG4 Fc sequence comprising one or more of S228P, E233P, F234V, L235A, delG236, and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • the Fc domain variant includes at least one of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least one of the mutations A330S, P331S or N297A of an IgG2 Fc region. In some embodiments, the Fc domain variant includes at least two of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least two of the mutations A330S, P331S or N297A of an IgG2 Fc region.
  • the Fc domain variant includes at least three of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or consists of the mutations A330S, P331S and N297A of an IgG2 Fc region. In some embodiments, the Fc domain variant consists of the mutations L234A, L235A, G237A and N297A.
  • the Fc domain variant exhibits reduced binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits ablated binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits a reduction of phagocytosis compared to the wild-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits ablated phagocytosis compared to the wild-type human IgG Fc region.
  • SEQ ID NO: 88 and SEQ ID NO: 89 provide amino acid sequences of Fc domain IgG1 and IgG2 heavy chain constant regions.
  • an Fc domain variant is any variant of SEQ ID NOs: 90-95 as shown in Table 7.
  • Antibody-dependent cell-mediated cytotoxicity which is also referred to herein as ADCC, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells and neutrophils) enabling these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell.
  • FcRs Fc receptors
  • Antibody-dependent cell-mediated phagocytosis which is also referred to herein as ADCP, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain phagocytic cells (e.g., macrophages) enabling these phagocytic effector cells to bind specifically to an antigen-bearing target cell and subsequently engulf and digest the target cell.
  • FcRs Fc receptors
  • Ligand-specific high-affinity IgG antibodies directed to the surface of target cells can stimulate the cytotoxic or phagocytic cells and can be used for such killing.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit reduced ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in ADCC or ADCP compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit ablated ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • Complement-directed cytotoxicity which is also referred to herein as CDC, refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc domains.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • Fc domain variants or Fc domain dimer variants herein include those that exhibit reduced binding to an Fc ⁇ receptor compared to the wild-type human IgG Fc region.
  • an Fc domain variant or Fc domain dimer variant exhibits binding to an Fc ⁇ receptor that is less than the binding exhibited by a wild-type human IgG Fc region to an Fc ⁇ receptor, as described in the Examples.
  • an Fc domain variant or Fc domain dimer variant has reduced binding to an Fc ⁇ receptor by a factor of 10%, 20% 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% (fully ablated effector function).
  • the reduced binding is for any one or more Fc ⁇ receptor, e.g., CD16a, CD32a, CD32b, CD32c, or CD64.
  • the Fc domain variants or Fc domain dimer variants disclosed herein exhibit a reduction of phagocytosis compared to its wild-type human IgG Fc region.
  • Such Fc domain variants or Fc domain dimer variants exhibit a reduction in phagocytosis compared to its wild-type human IgG Fc region, wherein the reduction of phagocytosis activity is e.g., by a factor of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%.
  • an Fc domain variant or Fc domain dimer variant exhibits ablated phagocytosis compared to its wild-type human IgG Fc region.
  • the Fc domain variants or Fc domain dimer variants disclosed herein are coupled to one or more fusion partners.
  • the fusion partner is a therapeutic moiety.
  • the fusion partner is selected to enable targeting of an expressed protein, purification, screening, display, and the like.
  • the fusion partner also affects the degree of binding to Fc receptors or the degree of phagocytosis reduction.
  • an Fc domain variant or Fc domain dimer variant when coupled to a fusion partner, it forms a polypeptide construct as described below.
  • fusion partners are linked to the Fc domain variant or Fc domain dimer variant sequence via a linker sequence.
  • the linker sequence generally comprises a small number of amino acids, such as less than ten amino acids, although longer linkers are also utilized.
  • the linker has a length less than 10, 9, 8, 7, 6, or 5 amino acids or shorter.
  • the linker has a length of at least 10, 11, 12, 13, 14, 15, 20, 25, 30, or 35 amino acids or longer.
  • a cleavable linker is employed.
  • a fusion partner is a targeting or signal sequence that directs an Fc domain variant or Fc domain dimer variant protein and any associated fusion partners to a desired cellular location or to the extracellular media.
  • certain signaling sequences target a protein to be either secreted into the growth media, or into the periplasmic space, located between the inner and outer membrane of the cell.
  • a fusion partner is a sequence that encodes a peptide or protein that enables purification or screening.
  • Such fusion partners include, but are not limited to, polyhistidine tags (His-tags) (for example His6 (SEQ ID NO: 223) and His10 (SEQ ID NO: 224)) or other tags for use with Immobilized Metal Affinity Chromatography (IMAC) systems (e.g., Ni+2 affinity columns), GST fusions, MBP fusions, Strep-tag, the BSP biotinylation target sequence of the bacterial enzyme BirA, and epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
  • His-tags polyhistidine tags
  • IMAC Immobilized Metal Affinity Chromatography
  • such tags are useful for purification, for screening, or both.
  • an Fc domain variant or Fc domain dimer variant is purified using a His-tag by immobilizing it to a Ni+2 affinity column, and then after purification the same His-tag is used to immobilize the antibody to a Ni+2 coated plate to perform an ELISA or other binding assay as described elsewhere herein.
  • a fusion partner enables the use of a selection method to screen Fc domain variants or Fc domain dimer variants as described herein.
  • fusion partners that enable a variety of selection methods are available. For example, by fusing the members of an Fc domain variant or Fc domain dimer variant library to the gene III protein, phage display can be employed. In some embodiments, fusion partners Fc domain variants or Fc domain dimer variants to be labeled. Alternatively, in some embodiments, a fusion partner binds to a specific sequence on the expression vector, enabling the fusion partner and associated Fc domain variant or Fc domain dimer variant to be linked covalently or noncovalently with the nucleic acid that encodes them.
  • the therapeutic moiety is, e.g., a peptide, a protein, an antibody, a siRNA, or a small molecule.
  • therapeutic antibodies that are coupled to the Fc domain variants or Fc domain dimer variants of the present disclosure include, but are not limited to antibodies that recognize CD47.
  • therapeutic polypeptides that are coupled to the Fc domain variants or Fc domain dimer variants of the present disclosure include, but are not limited to, CD47 binding polypeptides, including SIRP ⁇ polypeptides. In such instances, the CD47 binding polypeptide is attached or fused to an Fc domain variant or Fc domain dimer variant of the disclosure.
  • CD47 binding polypeptides include, but are not limited to, anti-CD47 antibodies or fragments thereof, and ligands of CD47 such as SIRP ⁇ or a fragment thereof. Additional examples of CD47 binding polypeptides include, but are not limited to naturally-occurring forms of SIRP ⁇ as well as mutants thereof.
  • a polypeptide comprising an Fc domain dimer variant, wherein the Fc domain dimer variant comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc domain variants are identical (i.e., homodimer). In some embodiments, the Fc domain variants are different (i.e., heterodimer). In some embodiments, at least one of the Fc domain variant in an Fc domain dimer is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, at least one of the Fc domain variants in an Fc domain dimer is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A.
  • the Fc domain dimer variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc domain dimer variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc domain dimer variant exhibits ablated or reduced binding to C1q compared to the wild-type version of the human IgG Fc fusion.
  • At least one of the Fc domain variants in an Fc domain dimer variant is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc domain dimer variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to the wild-type human IgG4 Fc region.
  • the Fc domain dimer variant exhibits ablated or reduced binding to CD16a and CD32b Fc ⁇ receptors compared to the wild-type version of its human IgG4 Fc region.
  • the Fc domain dimer variant binds to an Fc ⁇ receptor with a K D greater than about 5 ⁇ 10 ⁇ 6 M.
  • the Fc domain dimer variant further comprises a CD47 binding polypeptide.
  • the Fc domain dimer variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to a wild-type version of a human IgG Fc region.
  • the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans.
  • the CD47 binding polypeptide is a signal-regulatory protein ⁇ (SIRP- ⁇ ) polypeptide or a fragment thereof.
  • SIRP ⁇ polypeptide comprises a SIRP ⁇ D1 domain variant comprising the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 EGX 6 FPR VTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 221), wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is any amino acid other than N; and X 9 is V or I.
  • the SIRP ⁇ polypeptide comprises a SIRP ⁇ D1 domain variant wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is not N; and X 9 is V.
  • a polypeptide comprising: a SIRP ⁇ D1 domain variant, wherein the SIRP ⁇ D1 domain variant is a non-naturally occurring high affinity SIRP ⁇ D1 domain, wherein the SIRP ⁇ D1 domain variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain variant, wherein the Fc domain variant is linked to a second polypeptide comprising a second Fc domain variant to form an Fc domain dimer variant, wherein the Fc domain dimer variant has ablated or reduced effector function.
  • the non-naturally occurring high affinity SIRP ⁇ D1 domain comprises an amino acid mutation at residue 80.
  • a SIRP ⁇ D1 domain variant wherein the SIRP ⁇ D1 domain variant binds CD47 from a first species with a K D less than 250 nM; and wherein the SIRP ⁇ D1 domain variant binds CD47 from a second species with a K D less than 250 nM; and the K D for CD47 from the first species and the K D for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate.
  • the SIRP ⁇ D1 domain variant binds CD47 from at least 3 different species.
  • the non-human primate is cynomolgus monkey.
  • a polypeptide comprising (a) a SIRP ⁇ D1 domain that binds human CD47 with a K D less than 250 nM; and (b) an Fc domain or variant thereof linked to the N-terminus or the C-terminus of the SIRP ⁇ D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates.
  • the polypeptide is a non-naturally occurring variant of a human SIRP- ⁇ .
  • administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration.
  • administration of the polypeptide in humans results in hemoglobin reduction by less than 50% during the first week after administration.
  • the polypeptide further comprises at least one Fc domain dimer variant, wherein the Fc domain dimer variant comprises an Fc domain variant selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Fc domain dimer variant comprises an Fc domain variant selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 F
  • the Fc domain variant is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc domain variant is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A.
  • the SIRP ⁇ constructs of the disclosure include a SIRP ⁇ domain or variant thereof that has its C-terminus joined to the N-terminus of an Fc domain or variant thereof by way of a linker using conventional genetic or chemical means, e.g., chemical conjugation.
  • a linker e.g., a spacer
  • a polypeptide of the disclosure including a SIRP ⁇ D1 domain variant is fused to an Fc domain variant that is incapable of forming a dimer.
  • a polypeptide of the disclosure is fused to an Fc domain or variant thereof that is capable of forming a dimer, e.g., a heterodimer, with another Fc domain or variant thereof.
  • a polypeptide of the invention is fused to an Fc domain or variant thereof and this fusion protein forms a homodimer.
  • a polypeptide of the disclosure is fused to a first Fc domain or variant thereof and a different protein or peptide (e.g., an antibody variable region) is fused to a second Fc domain or variant thereof.
  • a SIRP ⁇ D1 domain or variant thereof is joined to a first Fc domain or variant thereof and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent) is joined to a second Fc domain or variant thereof.
  • a therapeutic protein e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent
  • the first and second Fc domains or variants thereof form a heterodimer.
  • a SIRP ⁇ D1 domain variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc polypeptide or Fc variant polypeptide, such as an Fc domain or variant thereof.
  • Fc polypeptide or Fc variant polypeptide such as an Fc domain or variant thereof.
  • polypeptides comprising a SIRP ⁇ D1 domain variant polypeptide and a fused Fc domain variant polypeptide include, but are not limited to, SEQ ID NOS: 96-137, 214, and 216 shown in Table 8.
  • the polypeptide comprises a SIRP ⁇ D1 variant domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 8.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 98-104, 107-113, 116-122, or 135-137 in Table 8.
  • the polypeptide comprises (a) a signal-regulatory protein a (SIRP- ⁇ ) D1 variant, wherein the SIRP ⁇ D1 domain variant comprises the amino acid sequence, EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGSP DX 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E, or G; X 2 is L, I, or V; X 3 is V, L, or I; X 4 is S, or F; X 5 is L, or S; X 6 is S, or T; X 7 is A, or V
  • the polypeptide comprises a SIRP ⁇ D1 domain variant wherein the SIRP ⁇ D1 domain variant comprises an amino acid sequence according to SEQ ID NO: 47; an Fc domain dimer having two Fc domains, wherein one of the Fc domains is an Fc domain variant comprising a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations.
  • a SIRP ⁇ D1 domain variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to a first Fc domain (e.g., an Fc domain variant) either at the N-terminus or at the C-terminus.
  • the first Fc domain is a variant that is incapable of forming an dimer.
  • the first Fc domain forms a dimer with a second Fc domain.
  • the first and second Fc domains comprise amino acid substitutions that promote heterodimerization between the first and second domain Fc domains.
  • each of the two Fc domains in an Fc domain dimer includes amino acid substitutions that promote the heterodimerization of the two monomers.
  • a SIRP ⁇ construct is formed, for example, from a first subunit including a SIRP ⁇ D1 domain variant polypeptide fused to a first Fc domain and a second subunit including a second Fc domain (e.g., without a SIRP ⁇ D1 domain variant polypeptide or any other polypeptide).
  • a construct has a single SIRP ⁇ D1 domain variant polypeptide linked to an Fc domain dimer (e.g., single arm).
  • a construct has two SIRP ⁇ D1 domain variant polypeptides linked to an Fc domain dimer (e.g., double arm).
  • a SIRP ⁇ D1 domain variant having a K D of about 500 nM is particularly useful in a double arm construct.
  • a SIRP ⁇ D1 domain variant having a K D of about 50 nM is particularly useful in a double arm construct.
  • a SIRP ⁇ D1 domain variant having a K D of about 5 nM is useful in a double arm construct and a single arm construct.
  • a SIRP ⁇ D1 domain variant having a K D of about 500 pM is useful in a double arm construct and a single arm construct.
  • a SIRP ⁇ D1 domain variant having a K D of about 100 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP ⁇ D1 domain variant having a K D of about 50 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP ⁇ D1 domain variant having a K D of about 10 pM is useful in a double arm construct and a single arm construct.
  • heterodimerization of Fc domains is promoted by introducing different, but compatible, substitutions in the two Fc domains, such as “knob-into-hole” residue pairs and charge residue pairs.
  • the knob and hole interaction favors heterodimer formation, whereas the knob-knob and the hole-hole interaction hinder homodimer formation due to steric clash and deletion of favorable interactions.
  • a hole refers to a void that is created when an original amino acid in a protein is replaced with a different amino acid having a smaller side-chain volume.
  • a knob refers to a bump that is created when an original amino acid in a protein is replaced with a different amino acid having a larger side-chain volume.
  • an amino acid being replaced is in the CH3 antibody constant domain of an Fc domain and involved in the dimerization of two Fc domains.
  • a hole in one CH3 antibody constant domain is created to accommodate a knob in another CH3 antibody constant domain, such that the knob and hole amino acids act to promote or favor the heterodimerization of the two Fc domains.
  • a hole in one CH3 antibody constant domain is created to better accommodate an original amino acid in another CH3 antibody constant domain.
  • a knob in one CH3 antibody constant domain is created to form additional interactions with original amino acids in another CH3 antibody constant domain.
  • a hole is constructed by replacing amino acids having larger side chains such as tyrosine or tryptophan with amino acids having smaller side chains such as alanine, valine, or threonine, for example a Y407V mutation in the CH3 antibody constant domain.
  • a knob is constructed by replacing amino acids having smaller side chains with amino acids having larger side chains, for example a T366W mutation in the CH3 antibody constant domain.
  • one Fc domain includes the knob mutation T366W and the other Fc domain includes hole mutations T366S, L358A, and Y407V.
  • a polypeptide of the disclosure including a SIRP ⁇ D1 domain variant is fused to an Fc domain including the knob mutation T366W to limit unwanted knob-knob homodimer formation.
  • knob-into-hole amino acid pairs are included, without limitation, in Table 9 and examples of knob-into-hole Fc domain variants and SIRP ⁇ -Fc fusions are provided in Table 10.
  • electrostatic steering is also used to control the dimerization of Fc domains.
  • Electrostatic steering refers to the utilization of favorable electrostatic interactions between oppositely charged amino acids in peptides, protein domains, and proteins to control the formation of higher ordered protein molecules.
  • one or more amino acid residues that make up the CH3-CH3 interface are replaced with positively- or negatively-charged amino acid residues such that the interaction becomes electrostatically favorable or unfavorable depending on the specific charged amino acids introduced.
  • a positively-charged amino acid in the interface such as lysine, arginine, or histidine, is replaced with a negatively-charged amino acid such as aspartic acid or glutamic acid.
  • a negatively-charged amino acid in the interface is replaced with a positively-charged amino acid.
  • the charged amino acids are introduced to one of the interacting CH3 antibody constant domains, or both.
  • introducing charged amino acids to the interacting CH3 antibody constant domains of the two Fc domains promotes the selective formation of heterodimers of Fc domains as controlled by the electrostatic steering effects resulting from the interaction between charged amino acids. Examples of electrostatic steering amino acid pairs are included, without limitation, in Table 11.
  • a first Fc domain and a second Fc domain each includes one or more of the following amino acid substitutions: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y40
  • an Fc domain comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y40
  • an Fc domain variant comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y
  • the first and second Fc domains include different amino acid substitutions.
  • the first Fc domain includes T366W.
  • the second Fc domain includes T366S, L368A, and Y407V.
  • the first Fc domain includes D399K.
  • the second Fc domain includes K409D.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer comprising two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a linker is used to describe a linkage or connection between polypeptides or protein domains or associated non-protein moieties.
  • a linker is a linkage or connection between an Fc domain (or variant thereof) and a SIRP ⁇ D1 domain variant.
  • the linker connects the C-terminus of the SIRP ⁇ D1 domain variant and the N-terminus of the Fc domain variant, such that the two polypeptides are joined to each other in tandem series.
  • a linker is a simple covalent bond, e.g., a peptide bond, a synthetic polymer, or any kind of bond created from a chemical reaction, e.g. chemical conjugation.
  • a linker is a peptide bond
  • the carboxylic acid group at the C-terminus of one protein domain reacts with the amino group at the N-terminus of another protein domain in a condensation reaction to form a peptide bond.
  • the peptide bond is formed from synthetic means through a conventional organic chemistry reaction, or by natural production from a host cell, wherein a nucleic acid molecule encoding the DNA sequences of both proteins (e.g., an Fc domain variant and a SIRP ⁇ D1 domain variant) in tandem series can be directly transcribed and translated into a contiguous polypeptide encoding both proteins by the necessary molecular machineries (e.g., DNA polymerase and ribosome) in the host cell.
  • a nucleic acid molecule encoding the DNA sequences of both proteins e.g., an Fc domain variant and a SIRP ⁇ D1 domain variant
  • the necessary molecular machineries e.g., DNA polymerase and ribosome
  • a linker is a synthetic polymer
  • the polymer is functionalized with reactive chemical functional groups at each end to react with the terminal amino acids at the connecting ends of two proteins.
  • a linker except peptide bond mentioned above
  • chemical functional groups e.g., amine, carboxylic acid, ester, azide, or other functional groups
  • the two functional groups then react through synthetic chemistry means to form a chemical bond, thus connecting the two proteins together.
  • a linker between an Fc domain monomer and a SIRP ⁇ D1 variant polypeptide of the disclosure is an amino acid spacer including about 1-200 amino acids.
  • Suitable peptide spacers include peptide linkers containing flexible amino acid residues such as glycine and serine. Examples of linker sequences are provided in Table 12.
  • a spacer contains motifs, e.g., multiple or repeating motifs, of GS, GG, GGS, GGG, GGGGS (SEQ ID NO: 163), GGSG (SEQ ID NO: 164), or SGGG (SEQ ID NO: 165).
  • a spacer contains 2 to 12 amino acids including motifs of GS, e.g., GS, GSGS (SEQ ID NO: 166), GSGSGS (SEQ ID NO: 167), GSGSGSGS (SEQ ID NO: 168), GSGSGSGSGS (SEQ ID NO: 169), or GSGSGSGSGSGSGS (SEQ ID NO: 170).
  • a spacer contains 3 to 12 amino acids including motifs of GGS, e.g., GGS, GGSGGS (SEQ ID NO: 171), GGSGGSGGS (SEQ ID NO: 172), and GGSGGSGGSGGS (SEQ ID NO: 173).
  • a spacer contains 4 to 12 amino acids including motifs of GGSG (SEQ ID NO: 164), e.g., GGSG (SEQ ID NO: 164), GGSGGGSG (SEQ ID NO: 174), or GGSGGGSGGGSG (SEQ ID NO: 175).
  • a spacer contains motifs of GGGGS (SEQ ID NO: 163), e.g., GGGGSGGGGSGGGGS (SEQ ID NO: 176).
  • a spacer contains amino acids other than glycine and serine, e.g., AAS (SEQ ID NO: 177), AAAL (SEQ ID NO: 178), AAAK (SEQ ID NO: 179), AAAR (SEQ ID NO: 180), EGKSSGSGSESKST (SEQ ID NO: 181), GSAGSAAGSGEF (SEQ ID NO: 182), AEAAAKEAAAKA (SEQ ID NO: 183), KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), GGGGAGGGG (SEQ ID NO: 185), GENLYFQSGG (SEQ ID NO: 186), SACYCELS (SEQ ID NO: 187), RSIAT (SEQ ID NO: 188), RPACKIPNDLKQKVIVINH (SEQ ID NO: 189), GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 190), AAANSSIDLISVPVDSR (SEQ ID NO:
  • a spacer contains motifs, e.g., multiple or repeating motifs, of EAAAK (SEQ ID NO: 193).
  • a spacer contains motifs, e.g., multiple or repeating motifs, of proline-rich sequences such as (XP)n, in which X is any amino acid (e.g., A, K, or E) and n is from 1-5, and PAPAP (SEQ ID NO: 194).
  • the length of the peptide spacer and the amino acids used is adjusted depending on the two proteins involved and the degree of flexibility desired in the final protein fusion polypeptide. In some embodiments, the length of the spacer is adjusted to ensure proper protein folding and avoid aggregate formation. In some embodiments, a spacer is A or AAAL (SEQ ID NO: 178).
  • polypeptides comprising a signal-regulatory protein a (SIRP- ⁇ ) D1 variant comprising a SIRP ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein a
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the polypeptides of the disclosure are produced from a host cell.
  • a host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and fusion polypeptides described herein from their corresponding nucleic acids.
  • the nucleic acids are included in nucleic acid vectors introduced into the host cell by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc.
  • the choice of nucleic acid vector depends on the host cell to be used.
  • host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.
  • a polypeptide for example a polypeptide construct comprising a SIRP ⁇ D1 domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are produced by culturing a host cell transformed with a nucleic acid, preferably an expression vector, containing a nucleic acid encoding the polypeptide construct (e.g., Fc variant, linker, and fusion partner) under the appropriate conditions to induce or cause expression of the polypeptide construct.
  • the conditions appropriate for expression varies with the expression vector and the host cell chosen.
  • a wide variety of appropriate host cells are used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • mammalian cells including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • a variety of cell lines that find use in the present disclosure are described in the ATCC® cell line catalog, available from the American Type Culture Collection.
  • Fc domain variants of this disclosure are expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, either by genetic engineering of the cell line or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote ( E. coli , etc.), and in some cases, modification of the glycosylation sequence in the Fc is not be needed.
  • a prokaryote E. coli , etc.
  • a nucleic acid sequence encoding the amino acid sequence of a polypeptide of the disclosure can be prepared by a variety of methods. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis.
  • a nucleic acid molecule encoding a polypeptide of the disclosure is obtained using standard techniques, e.g., gene synthesis.
  • a nucleic acid molecule encoding a wild-type SIRP ⁇ D1 domain is mutated to include specific amino acid substitutions using standard techniques, e.g., QuikChangeTM mutagenesis.
  • nucleic acid molecules are synthesized using a nucleotide synthesizer or PCR techniques.
  • the nucleic acids that encode a polypeptide construct for example a polypeptide construct comprising a SIRP ⁇ D1 domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are incorporated into an expression vector in order to express the protein.
  • a variety of expression vectors can be utilized for protein expression.
  • Expression vectors can comprise self-replicating, extra-chromosomal vectors or vectors which integrate into a host genome.
  • a vector can also include various components or elements.
  • the vector components include, but are not limited to, transcriptional and translational regulatory sequences such as a promoter sequence, a ribosomal binding site, a signal sequence, transcriptional start and stop sequences, translational start and stop sequences, 3′ and 5′ untranslated regions (UTRs), and enhancer or activator sequences; an origin of replication; a selection marker gene; and the nucleic acid sequence encoding the polypeptide of interest, and a transcription termination sequence.
  • expression vectors comprise a protein operably linked with control or regulatory sequences, selectable markers, any fusion partners, additional elements, or any combinations thereof.
  • operably linked means that the nucleic acid is placed into a functional relationship with another nucleic acid sequence.
  • these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the Fc variant, and are typically appropriate to the host cell used to express the protein.
  • a selection gene or marker such as, but not limited to, an antibiotic resistance gene or fluorescent protein gene, can be used to select for host cells containing the expression vector, for example by antibiotic or fluorescence expression. Various selection genes are available.
  • the components or elements of a vector are optimized such that expression vectors are compatible with the host cell type.
  • Expression vectors which find use in the present disclosure include, but are not limited to, those which enable protein expression in mammalian cells, bacteria, insect cells, yeast, and in in vitro systems.
  • mammalian cells are used as host cells to produce polypeptides of the disclosure.
  • mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK 293F), Chinese hamster ovary (CHO), HeLa, COS, PC3, Vero, MC3T3, NS0, Sp2/0, VERY, BHK, MDCK, W138, BT483, Hs578T, HTB2, BT20, T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7O3O, and HsS78Bst cells.
  • HEK human embryonic kidney
  • CHO Chinese hamster ovary
  • HeLa HeLa
  • COS CS
  • PC3, Vero Chinese hamster ovary
  • CHO Chinese hamster ovary
  • CHO Chinese hamster ovary
  • HeLa HeLa
  • COS COS
  • E. coli cells are used as host cells to produce polypeptides of the disclosure.
  • E. coli strains include, but are not limited to, E. coli 294 (ATCC® 31,446), E. coli ⁇ 1776 (ATCC® 31,537, E. coli BL21 (DE3) (ATCC® BAA-1025), and E. coli RV308 (ATCC® 31,608).
  • Different host cells have characteristic and specific mechanisms for the posttranslational processing and modification of protein products (e.g., glycosylation).
  • appropriate cell lines or host systems are chosen to ensure the correct modification and processing of the polypeptide expressed.
  • a polypeptide construct for example a polypeptide construct comprising a SIRP ⁇ D1 domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are expressed in mammalian expression systems, including systems in which the expression constructs are introduced into the mammalian cells using virus such as retrovirus or adenovirus.
  • virus such as retrovirus or adenovirus.
  • human, mouse, rat, hamster, or primate cells are utilized. Suitable cells also include known research cells, including but not limited to Jurkat T cells, NIH3T3, CHO, COS, and 293 cells. Alternately, in some embodiments, proteins are expressed in bacterial cells.
  • Bacterial expression systems are well known in the art, and include Escherichia coli ( E. coli ), Bacillus subtilis, Streptococcus cremoris , and Streptococcus lividans .
  • polypeptide constructs comprising Fc domain variants are produced in insect cells such as but not limited to Sf9 and Sf21 cells or yeast cells such as but not limited to organisms from the genera Saccharomyces, Pichia, Kluyveromyces, Hansenula and Yarrowia .
  • polypeptide constructs comprising Fc domain variants are expressed in vitro using cell free translation systems. In vitro translation systems derived from both prokaryotic (e.g., E.
  • the Fc domain variants are produced by chemical synthesis methods such as, but not limited to, liquid-phase peptide synthesis and solid-phase peptide synthesis. In the case of in vitro transcription using a non-glycosylating system such as bacterial extracts, the Fc will not be glycosylated even in presence of the natural glycosylation site and therefore inactivation of the Fc will be equivalently obtained.
  • a polypeptide construct includes non-natural amino acids, amino acid analogues, amino acid mimetics, or any combinations thereof that function in a manner similar to the naturally occurring amino acids.
  • Naturally encoded amino acids generally refer to the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
  • such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but generally retain the same basic chemical structure as a naturally occurring amino acid.
  • host cells used to produce polypeptides of the disclosure are grown in media suitable for culturing of the selected host cells.
  • suitable media for mammalian host cells include Minimal Essential Medium (MEM), Dulbecco's Modified Eagle's Medium (DMEM), Expi293TM Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-1640.
  • suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicillin.
  • host cells are cultured at suitable temperatures, such as from about 20° C. to about 39° C., e.g., from about 25° C.
  • the pH of the medium is from about pH 6.8 to pH 7.4, e.g., pH 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector, protein expression can be induced under conditions suitable for the activation of the promoter.
  • protein recovery involves disrupting the host cell, for example by osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris is removed by centrifugation or filtration. The proteins can then be further purified.
  • a polypeptide of the disclosure is purified by various methods of protein purification, for example, by chromatography (e.g., ion exchange chromatography, affinity chromatography, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the protein is isolated and purified by appropriately selecting and combining affinity columns such as Protein A column (e.g., POROS Protein A chromatography) with chromatography columns (e.g., POROS HS-50 cation exchange chromatography), filtration, ultra-filtration, de-salting and dialysis procedures.
  • a polypeptide is conjugated to marker sequences, such as a peptide to facilitate purification.
  • marker amino acid sequence is a hexa-histidine peptide (His6-tag (SEQ ID NO: 223)), which can bind to a nickel-functionalized agarose affinity column with micromolar affinity.
  • a hemagglutinin “HA” tag which corresponds to an epitope derived from the influenza hemagglutinin protein can be used.
  • polypeptides of the disclosure for example a polypeptide construct comprising a SIRP ⁇ D1 domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are produced by the cells of a subject (e.g., a human), e.g., in the context of gene therapy, by administrating a vector such as a viral vector (e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vector, and alphaviral vector) containing a nucleic acid molecule encoding a polypeptide of the disclosure.
  • a viral vector e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)
  • the vector once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc.) can be used for the expression of a polypeptide disclosed herein.
  • the polypeptide is secreted from the cell.
  • treatment of a disease or disorder is the desired outcome, no further action is required.
  • collection of the protein is desired, blood is collected from the subject and the protein purified from the blood by various methods.
  • kits for treating cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) a chemotherapy agent (e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents).
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • a chemotherapy agent e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents.
  • a method of treating cancer in an individual that comprises administering to the individual an effective amount of (a) a polypeptide comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) and (b) a chemotherapy agent (e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents).
  • the method further comprises administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies).
  • the method further comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents). Additionally or alternatively, in some embodiments, the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • an immunotherapeutic agent e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents.
  • the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • Exemplary chemotherapy agent(s) that can be used in a method of treating cancer described herein include, without limitation, e.g., methotrexate (RHEUMATREX®, Amethopterin), cyclophosphamide (CYTOXAN®), abiraterone, abemaciclib, altretamine, thalidomide (THALIDOMID®), acridine carboxamide, Actimid®, actinomycin, actinomycin-D, afatinib, 17-N-allylamino-17-demethoxygeldanamycin, alectinib, alpelisib, aminopterin, amsacrine, anlotinib, anthracycline, antineoplastic, antineoplaston, apartinib, 5-azacitidine, 6-mercaptopurine, 6-thioguanine, arabinosylcytosine, axitinib, azacitidine, azathioprine, BL22
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with chemotherapeutic agent(s)s of a particular class.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is a polypeptide described herein (e.g., a fusion polypeptide comprising a SIRP ⁇ d1 domain variant and an Fc variant; a fusion polypeptide comprising a SIRP ⁇ variant, a SIRP ⁇ 1 variant, or a SIRP ⁇ 2 variant and an Fc variant).
  • the method of treating cancer comprises administering a polypeptide (e.g.
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an anthracycline (including, but not limited to anthracyclines described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an alkylating agent (including, but not limited to alkylating agents described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an androgen inhibitor (including, but not limited to androgen inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an antimetabolite, e.g., a purine analog, (including, but not limited to antimetabolites, e.g., purine analogs, described herein).
  • an antimetabolite e.g., a purine analog
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an antitumor antibiotic (including, but not limited to antitumor antibiotics described herein.
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a BLC-2 inhibitor (including, but not limited to BLC-2 inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a BTK inhibitor (including, but not limited to BTK inhibitors described herein. In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a CDK 4/6 inhibitor (including, but not limited to CDK 4/6 inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a colony stimulating factor (including, but not limited to colony stimulating factors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a corticosteroid (including, but not limited to corticosteroids described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an EGFR inhibitor (including, but not limited to EGFR inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a gonadotropin releasing hormone (GnRH) agonist (including, but not limited to GnRH agonists described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a mitotic inhibitor/microtubule inhibitor (including, but not limited to mitotic inhibitors/microtubule inhibitors described herein).
  • GnRH gonadotropin releasing hormone
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a mitotic inhibitor/microtubule inhibitor (including, but not limited to mitotic inhibitors/microtubule inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an mTOR kinase inhibitor (including, but not limited to mTOR kinase inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a proteasome inhibitor (including, but not limited to proteasome inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a signal transduction inhibitor, e.g., a protein-tyrosine kinase inhibitor, a PAK4 inhibitor, a PI3K inhibitor, (including, but not limited to signal transduction inhibitors described herein).
  • a signal transduction inhibitor e.g., a protein-tyrosine kinase inhibitor, a PAK4 inhibitor, a PI3K inhibitor, (including, but not limited to signal transduction inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a topoisomerase inhibitor, (including, but not limited to topoisomerase inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a tyrosine kinase inhibitor, (including, but not limited to tyrosine kinase inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a VEGF inhibitor, such as a VEGF1 inhibitor, a VEGF2 inhibitor, and/or a VEGF3 inhibitor (including, but not limited to VEGF inhibitors described herein.
  • a VEGF inhibitor such as a VEGF1 inhibitor, a VEGF2 inhibitor, and/or a VEGF3 inhibitor (including, but not limited to VEGF inhibitors described herein.
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an agent that modulates apoptosis, e.g., by modulating the activity of Bcl-2, Mcl1, Bcl-lx, etc., (including, but not limited to agents that modulate apoptosis, e.g., by modulating the activity of Bcl-2, Mcl1, Bcl-lx, etc., described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a platinum-based agent, (including, but not limited to platinum-based agents described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an inhibitor of NTRK1, NTRK2, and/or NTRK3, an ALK inhibitor, a ROS inhibitor, a FLT3 inhibitor, a BRAF inhibitor, an inhibitor of MEK1 and/or MEK2, an inhibitor of HER2, HER3, and/or HER 4, an inhibitor of RET/PTC, an inhibitor of BCR-ABL, a c-KIT inhibitor, an inhibitor of PDGFR-alpha and/or PDGFR-beta, an inhibitor of FGFR1, FGFR2, FGFR3, and/or FGFR4, an Smoothened inhibitor and/or an inhibitor of PARP1, PARP2, and/or PARP3 (including, but not limited to inhibitors described herein).
  • the inhibitor is an antisense polynucleotide (such as an siRNA or an RNAi).
  • the inhibitor is a small molecule inhibitor, as described in further detail below.
  • the chemotherapeutic agent is a small molecule anti-cancer agent (such as a small molecule inhibitor).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a small molecule inhibitor of VEGFR and/or PDGFR, a small molecule EGFR inhibitor, a small molecule ALK inhibitor, a small molecule CDK4/6 inhibitor, a small molecule PARP inhibitor, a small molecule PAK4 inhibitor, a small molecule mTOR inhibitor, a small molecule KRAS inhibitor, a small molecule TRK inhibitor, a small molecule BCL2 inhibitor, a small molecule B-raf inhibitor, a small molecule IDH inhibitor, a small molecule PI3K inhibitor, a small molecule DDR (DNA damage response) inhibitor, or a small molecule hypomethylation agent.
  • a small molecule inhibitor of VEGFR and/or PDGFR a small molecule EGFR inhibitor, a small molecule ALK inhibitor, a small molecule CD
  • the targeted small molecule modulates a cellular signaling pathway of the cell expressing CD47, e.g., an IDO/TDO inhibitor, AhR inhibitor, arginase inhibitor, A2a R inhibitor, TLR agonists, STING agonist, or Rig-1 agonist.
  • a cellular signaling pathway of the cell expressing CD47 e.g., an IDO/TDO inhibitor, AhR inhibitor, arginase inhibitor, A2a R inhibitor, TLR agonists, STING agonist, or Rig-1 agonist.
  • the method of treating cancer comprises administering a polypeptide described herein (e.g., a fusion polypeptide comprising a SIRP ⁇ d1 domain variant and an Fc variant) in combination with at least one, at least two, at least three, or at least four chemotherapeutic agents.
  • a polypeptide described herein e.g., a fusion polypeptide comprising a SIRP ⁇ d1 domain variant and an Fc variant
  • the two or more chemotherapeutic agents are from different classes (as described above) and/or exert their anti-cancer effects via different mechanisms of action.
  • a method of treating cancer comprises administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies), i.e., in combination with agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., a fusion polypeptide described herein) and a chemotherapeutic agent described herein (e.g., at least one chemotherapeutic agent, such as at least two, at least three, or at least four chemotherapeutic agents).
  • the therapeutic antibody is conjugated to a drug (i.e., an antibody-drug conjugate, or “ADC”).
  • Exemplary therapeutic antibodies for use in a method herein include, but are not limited to, e.g., 3F8, 8H9, Abagovomab, Abciximab, Abituzumab, Abrilumab, Actoxumab, Adalimumab, Adecatumumab, Aducanumab, Afelimomab, Afutuzumab, Alacizumab pegol, ALD518, Alemtuzumab, Alirocumab, Altumomab pentetate, Amatuximab, Anatumomab mafenatox, Anetumab ravtansine, Anifrolumab, Anrukinzumab (IMA-638), Apolizumab, Arcitumomab, Ascrinvacumab, Aselizumab, Atezolizumab, Atinumab, Atlizuma
  • an antibody include, but are not limited to, e.g., an anti-CD20 antibody, an anti-EGFR antibody, an anti-Her2/Neu (ERBB2) antibody, an anti-EPCAM antibody, an anti-GL2 antibody, anti-GD2, anti-GD3, anti-CD2, anti-CD3, anti-CD4, anti-CD8, anti-CD I 9, anti-CD22, anti-CD30, anti-CD33, anti-CD39, anti-CD45, anti-CD47, anti-CD52, anti-CD56, anti-CD70, anti-CD73, anti-CD117, an anti-SIRP ⁇ antibody, an anti-LILRB1, an anti-LILRB2, an anti-LILRB4 antibody, an anti-PD-1 antibody (e.g., an anti PD-1 antagonist antibody), an anti-PD-L1 antibody (e.g., an anti PD-L1 antagonist antibody), an anti-PD-L2 antibody, or
  • the therapeutic antibody used in a method herein is an antibody that binds to, e.g., CS1/SLAMF7, Trop-2, VWF, vimentin, VEGFR2, VEGFR-1, VEGF, VEGF-A, TYRP1 (glycoprotein 75), TWEAK receptor, tumor specific glycosylation of MUC1, tumor antigen CTAA16.88, TRAIL-R2, TRAIL-R1, TNF-alpha, TGF-beta, TGF beta 2, TGF beta 1, TFPI, tenascin C, TEM1, TAG-72, T-cell receptor, STEAP1, sphingosine-1-phosphate, SOST, SLAMF7, BCL-2, selectin P, SDC1, sclerostin, RTN4, RON, Rhesus factor, RHD, respiratory syncytial virus, RANKL, rabies virus glycoprotein, platelet-derived growth factor receptor beta, phosphatidylserine,
  • coli shiga toxin type-2 E. coli shiga toxin type-I, DRS, DPP4, DLL4, dabigatran, cytomegalovirus glycoprotein B, CTLA-4, CSF2, CSF1R, clumping factor A, CLDN18.2, ch4DS, CFD, CEA-related antigen, CEA, CD80, CD79B, CD74, CD73, CD70, CD6, CD56, CD52, CD51, CD5, CD44 v6, CD41, CD40 ligand, CD40, CD4, CD39, CD38, CD37, CD33, CD30 (TNFRSF8), CD123, CD138, CD3 epsilon, CD3, CD28, CD274, CD27, CD2S (a chain of IL-2 receptor), CD23 (IgE receptor), CD221, CD22, CD200, CD20, CD2, CD19, CD137, CD154, CD152, CD15, CD147 (basigin), CD140a, CD125, CD11, CD-18, CCR5,
  • the therapeutic antibody used in a method herein binds to an antigen expressed by a cancer cell (e.g., expressed on the surface of a cancer cell).
  • exemplary antigens expressed by cancers are known in the art and include, without limitation, e.g., CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, BCMA, Mucin 1, Mucin 16, PTK7, PD-L1, STEAP1, Endothelin B Receptor, mesothelin, EGFRvIII, ENPP3, SLC44A4, GNMB, nectin 4, NaPi 2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin aVf33, integrin ⁇ 501, MET, IGF1R, TRAILR
  • an polypeptide described herein is administered in combination with a chemotherapeutic agent (e.g., at least one chemotherapeutic agent) and a monoclonal antibody that binds CD123 (also known as IL-3 receptor alpha), such as talacotuzumab (also known as CSL362 and JNJ-56022473).
  • a chemotherapeutic agent e.g., at least one chemotherapeutic agent
  • a monoclonal antibody that binds CD123 also known as IL-3 receptor alpha
  • talacotuzumab also known as CSL362 and JNJ-56022473
  • the therapeutic antibody used in a method herein is an antibody that binds an antigen expressed by an NK cell.
  • exemplary antigens expressed by an NK cell include, without limitation, NKR-P1A (KLRB1), CD94 (NKG2A), KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94 (NKG2C/E), NKG2D, CD160 (BY55), CD16 (Fc ⁇ RIIIA), NKp46 (NCR1), NKp30 (NCR3), NKp44 (NCR2), DNAM1 (CD226), CRTAM, CD27, NTB-A (SLAMF6), PSGL1, CD96 (Tactile), CD100 (SEMA4D), NKp80 (KLRF
  • a method of treating cancer comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents), i.e., in combination with an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., a polypeptide described herein) and a chemotherapeutic agent described herein (e.g., at least one chemotherapeutic agent, such as at least two, at least three, or at least four chemotherapeutic agents).
  • an immunotherapeutic agent e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents
  • an immunotherapeutic agent refers to any therapeutic that targets the immune system and promotes a therapeutic redirection of the immune system, such as a modulator of a costimulatory pathway, cancer vaccine, recombinantly modified immune cell, etc. Exemplary and non-limiting immunotherapeutic agents are described infra.
  • the immunotherapeutic agent is or comprises an antibody.
  • Exemplary targets of immunotherapeutic antibodies include, without limitation, BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-10, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD24, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF- ⁇ RI, TGF- ⁇ RH, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11 c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28,
  • Immunotherapeutic agents that are approved or in late-stage clinical testing include, without limitation, ipilimumab, pembrolizumab, nivolumab, atezolizumab, avelumab, durvalumab, and the like.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ (such as a polypeptide described herein) is administered in combination with an inhibitor of the PD-L1/PD-1 pathway, e.g., an antibody, a small molecule, or polypeptide that blocks the interaction between PD-L1 and PD-1 (e.g., by binding to PD-1 or PD-L1).
  • the inhibitor of the PD-L1/PD-1 pathway is an antisense polynucleotide.
  • the inhibitor of the PD-L1/PD-1 pathway is an anti-PD-L1 or anti-PD-1 antagonist antibody (e.g., an anti-PD-1 or anti-PD-L1 antagonist antibody described elsewhere herein).
  • an agent that blocks the interaction between CD47 and SIRP ⁇ such as a polypeptide described herein
  • an inhibitor of the PD-L1/PD-1 pathway can result in synergistic anti-tumor activity.
  • the immunotherapeutic agent is or comprises a vaccine, oncolytic virus, adoptive cell therapy, cytokine, or small molecule immunotherapeutic agent.
  • adoptive cell therapies and therapeutics can include without limitation chimeric antigen receptor T-cell therapy (CAR-T), tumor infiltrating lymphocytes (TILs), TCR engineered T cells, TCR engineered NK cell, and macrophage cell products.
  • Vaccines can include without limitation polynucleotide vaccines, polypeptide vaccines, or cell-based (e.g., tumor or dendritic cell-based) vaccines.
  • Various cytokines useful for the treatment of cancer are known and include without limitation IL-2, IL-15, IL-7, IL-10, IL-12, IL21, TNFa, IFNs, GM-CSF, and engineered cytokine mutants.
  • Small molecule immunotherapeutic agents can include without limitation IDO/TDO inhibitors, AhR inhibitors, arginase inhibitors, A2a R inhibitors, TLR agonists, STING agonists, and Rig-1 agonists.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ such as a polypeptide described herein
  • the chemotherapeutic agent e.g., at least one chemotherapeutic agent
  • the further agent(s) described herein e.g., therapeutic antibodies, small molecule inhibitors, immunotherapeutic agents, etc.
  • the further agent(s) are from different classes and/or exert their anti-cancer effects via different mechanisms of action.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 and SIRP ⁇ (such as a polypeptide described herein) in combination with a chemotherapeutic agent (including, but not limited to those described herein) and a therapeutic antibody (including, but not limited to those described herein, e.g., an anti-HER2 antibody).
  • a chemotherapeutic agent including, but not limited to those described herein
  • a therapeutic antibody including, but not limited to those described herein, e.g., an anti-HER2 antibody
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is administered in combination with a chemotherapeutic agent (including, but not limited to those described herein) and a small molecule inhibitor (including, but not limited to those described herein).
  • chemotherapeutic agent including, but not limited to those described herein
  • a small molecule inhibitor including, but not limited to those described herein.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ (such as a polypeptide described herein) is administered in combination with one or more agents including, without limitation, e.g., anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agent.
  • agents including, without limitation, e.g., anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agent.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is administered in combination with at least one chemotherapy agent and one or more additional modes of therapy.
  • the one or more additional modes therapy comprises radiotherapy (e.g., gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells, microwaves, UV radiation, or gene therapy.
  • radiotherapy e.g., gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells, microwaves, UV radiation, or gene therapy.
  • therapeutic genes for gene therapy include, but are not limited to, an antisense version of an inducer of cellular proliferation (oncogene), an inhibitor of cellular proliferation (tumor suppressor), or an inducer of programmed cell death (pro-apoptotic gene).
  • any one or more of the combination therapies described herein are administered in conjunction with a surgery (e.g., resection).
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with nivolumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, iri
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with pembrolizumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, irinote
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with trastuzumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, irinote
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with bevacizumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, irinote
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with rituximab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, iri
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with pertuzumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, irinote
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) in combination with denosumab and one or agents selected from: lenalidomide, ibrutinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxel, estramustine, paclitaxel, vinblastine, etoposide, irinotecan
  • the cancer treated by a method provided herein is breast cancer, lung cancer, adenocarcinoma of the lung, squamous cell lung cancer, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), head and neck cancer, mesothelioma, brain cancer, brain tumor, abdominal cancer, colon cancer, colorectal cancer, esophageal cancer, parapharyngeal cancer, gastrointestinal cancer, glioma, liver cancer, gastric cancer, oral cancer, tongue cancer, neuroblastoma, osteosarcoma, ovarian cancer, renal cancer, urinary bladder cancer, urinary tract cancer, pancreatic cancer, retinoblastoma, cervical cancer, uterine cancer, Wilm's tumor, multiple myeloma, skin cancer, lymphoma, leukemia, blood cancer, thyroid cancer, bone cancer, adenocystic tumor, chondrosar-coma, pancreatic islet cell tumor, neuroendocrine tumor, prostate cancer,
  • SCLC
  • the cancer treated by a method provided herein is a hematological cancer.
  • the hematological cancer is multiple myeloma, or a leukemia, including, but not limited to, e.g., acute or chronic myelogenous leukemia acute or chronic lymphoblastic leukemia, acute lymphocytic leukemia (ALL) chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myeloid leukemia (CIVIL), hairy cell leukemia, chronic myelomonocytic leukemia (CMML), Juvenile myelomonocytic leukemia (JMML), large granular lymphocytic (LGL) leukemia, plasmacytoma, blastic plasmacytoid dendritic cell neoplasm (BPDCN), B-cell prolymphocytic
  • ALL acute lymphoc
  • leukemia e.g., acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myeloid leukemia (CIVIL), hairy cell leukemia, chronic myelomonocytic leukemia (CMML), Juvenile myelomonocytic leukemia (JMML), large granular lymphocytic (LGL) leukemia, blastic plasmacytoid dendritic cell neoplasm (BPDCN), B-cell prolymphocytic leukemia (B-PLL), T-cell prolymphocytic leukemia (T-PLL), multiple myeloma (MM), and Non-Hodgkin lymphomas (such as diffuse large B-cell lymphoma (DLBCL), Burkitt lymphoma
  • the Bcl2 inhibitor is venetoclax (also known as ABT-199), ABT-737, navitoclax (also known as ABT-263), BCL201, or AZD-0466.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide) and the Bcl2 inhibitor (e.g., venetoclax) are administered simultaneously, concurrently, or sequentially.
  • Bcl2 inhibitors are a class of anticancer drugs that are believed to exert their cytotoxic effects by competing with proapoptotic Bcl2s to occupy BH3 docking grooves on the surfaces of antiapoptotic family members. By binding to one or more Bcl2 family members, these inhibitors induce apoptosis by mimicking the activity of natural antagonists of BCL-2 and other related proteins and restore apoptosis in tumor cells.
  • Venetoclax (also known as GDC-0199, ABT-199, and RG7601) is an exemplary selective Bcl2 inhibitor used in the methods described herein. Venetoclax is a light yellow to dark yellow solid with the empirical formula C 45 H 50 ClN 7 O 7 S and a molecular weight of 868.44 g/mol. Venetoclax has very low aqueous solubility.
  • Venetoclax is described chemically as 4-(4- ⁇ [2-(4-chlorophenyl)-4,4dimethylcyclohex-1-en-1-yl]methyl ⁇ piperazin-1-yl)-N-( ⁇ 3-nitro-4-[(tetrahydro-2H-pyran-4ylmethyl)amino]phenyl ⁇ sulfonyl)-2-(1H-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide) and has the following chemical structure:
  • Venetoclax is administered orally and is sold under the trade names Venclexta and Venclyxto.
  • Complete information about venetoclax preparation, dispensing, dosage, and administration schedule can be found in the local package insert (for the United States, see, e.g., www(dot)accessdata(dot)fda(dot)gov/drugsatfda_docs/label/2017/208573s000lbl(dot)pdf; for Europe, see, e.g., www(dot)ema(dot)europa(dot)eu/en/medicines/human/EPAR/venclyxto#product-information-section).
  • the venetoclax is administered in accordance with the dosing and frequency recommended in the local package insert.
  • ABT-737 is another exemplary selective Bcl2 inhibitor used in the methods described herein.
  • ABT-737 which inhibits both Bcl2 and Bcl-xL, has the empirical formula C 42 H 45 ClN 6 O 5 S 2 and a molecular weight of 813.43 g/mol.
  • the CAS Registry Number for ABT-737 is 852-808-04-9.
  • ABT-737 is described chemically as 4- ⁇ 4-[(4′-Chloro-2-biphenylyl)methyl]-1-piperazinyl ⁇ -N-[(4- ⁇ [(2R)-4-(dimethylamino)-1-(phenylsulfanyl)-2-butanyl]amino ⁇ -3-nitrophenyl)sulfonyl]b enzamide and has the following chemical structure:
  • navitoclax also known as ABT-263.
  • Navitoclax which inhibits both Bcl2, Bcl-xL, and Bcl-w, has the empirical formula C 47 H 55 ClF 3 N 5 O 6 S 3 and a molecular weight of 974.6 g/mol.
  • the CAS Registry Number for navitoclax is 923564-51-6.
  • ABT-737 is described chemically as 4-[4-[[2-(4-chlorophenyl)-5,5-dimethylcyclohexen-1-yl]methyl]piperazin-1-yl]-N-[4-[[(2R)-4-morpholin-4-yl-1-phenylsulfanylbutan-2-yl]amino]-3-(trifluoromethylsulfonyl) phenyl]sulfonylbenzamide and has the chemical structure provided below. Additional details regarding navitoclax are provided in, e.g., Tse et al. (2008) Cancer Res. 68(9): 3421-3429.
  • S55746 (also known as BCL201 and Servier-1).
  • S55746 occupies the hydrophobic groove of BCL-2. Its selectivity profile demonstrates no significant binding to MCL-1, BFL-1 S55746 occupies the hydrophobic groove of BCL-2. Its selectivity profile demonstrates no significant binding to MCL-1, BFL-1 (BCL2A1/A1) and poor affinity for BCL-XL.
  • S55746 has no cytotoxic activity on BCL-XL-dependent cells, such as platelets (see, e.g., Casara et al. (2008) Oncotarget. 9(28): 29975-20088).
  • S55746 has the empirical formula C 43 H 42 N 4 O 6 and a molecular weight of 710.82 g/mol.
  • the CAS Registry Number for S55746 is 1448584-12-0.
  • S55746 is described chemically as (S)-N-(4-hydroxyphenyl)-3-(6-(3-(morpholinomethyl)-1,2,3,4-tetrahydroisoquinoline-2-carbonyl)benzo[d][1,3]dioxol-5-yl)-N-phenyl-5,6,7,8-tetrahydroindolizine-1-carboxamide and has the following chemical structure:
  • a method of treating solid tumor in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) a platinum-based chemotherapy agent.
  • the solid tumor is colon cancer (e.g., colon carcinoma), lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, and/or satraplatin.
  • the platinum-based chemotherapy agent is cisplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide) and the platinum-based chemotherapy agent (e.g., cisplatin) are administered simultaneously, concurrently, or sequentially.
  • the platinum-based chemotherapy agent e.g., cisplatin
  • Platinum agents are widely used antitumor drugs that cause crosslinking of DNA as monoadduct, interstrand crosslinks, intrastrand crosslinks or DNA protein crosslinks. Platinum agents typically act on the adjacent N-7 position of guanine, forming a 1, 2 intrastrand crosslink (Poklar et al. (1996). Proc. Natl . Acad. Sci. U.S.A. 93 (15): 7606-11; Rudd et al. (1995). Cancer Chemother. Pharmacol. 35 (4): 323-6). The resultant crosslinking inhibits DNA repair and/or DNA synthesis in cancer cells.
  • Cisplatin is an exemplary platinum coordination compound used in the methods described herein.
  • the chemical name for cisplatin is dichloroplatinum diammoniate, and cisplatin has the following structural formula:
  • Cisplatin is an inorganic and water-soluble platinum complex with the molecular formula of Pt(NH 3 ) 2 Cl 2 and a molecular weight of 300.046. After undergoing hydrolysis, it reacts with DNA to produce both intra and interstrand crosslinks. These crosslinks appear to impair replication and transcription of DNA. The cytotoxicity of cisplatin correlates with cellular arrest in the G2 phase of the cell cycle. Cisplatin, which has been assigned the CAS Registry No.
  • PLATINOL® is commercially available as PLATINOL®, PLATINOL®-AQ, CDDP, CISPLAN, CISPLAT, PLATIKEM, PLATIONCO, PRACTICIS, PLATICIS, BLASTOLEM, CISMAX, CISPLAN, CISPLATINUM, CISTEEN, DUPLAT, KEMOPLAT, ONCOPLATIN-AQ, PLATINEX, PLATIN, TEVAPLATIN, and others.
  • cisplatin preparation, dispensing, dosage, and administration schedule can be found in local package insert (for the United States, see, e.g., www(dot)accessdata(dot)fda(dot)gov/drugsatfda_docs/label/2011/018057s080lbl(dot)pdf and www(dot)accessdata(dot)fda(dot)gov/drugsatfda_docs/label/2015/018057s083lbl(dot)pdf).
  • the cisplatin is administered in accordance with the dosing and frequency recommended in the local package insert.
  • Carboplatin is another exemplary platinum coordination compound used in the methods described herein.
  • the chemical name for carboplatin is platinum, diammine [1,1cyclobutane-dicarboxylato(2-)-0,0]-,(SP-4-2), and carboplatin has the following structural formula:
  • Carboplatin is a water-soluble platinum complex with the molecular formula of C 6 H 12 N 2 O 4 Pt and a molecular weight of 373.26. Carboplatin has been assigned the CAS Registration Number 41575-94-4, and its mechanism of action is similar to that of cisplatin. Carboplatin is typically prescribed more commonly than cisplatin. Carboplatin is commercially available as PARAPLATIN®, BLASTOCARB®, BLASTOPLATIN®, CARBOKEM®, CARBOMAX®, PARAPLATIN®, CARBOPA®, KARPLAT®, and others.
  • carboplatin preparation, dispensing, dosage, and administration schedule can be found in local package insert (for the United States, see, e.g., www(dot)accessdata(dot)fda(dot)gov/drugsatfda_docs/label/2010/020452s005lbl(dot)pdf and www(dot)accessdata.fda(dot)gov/drugsatfda_docs/label/2012/077139Orig1s016lbl(dot)pdf).
  • the carboplatin is administered in accordance with the dosing and frequency recommended in the local package insert.
  • a method of treating solid tumor in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), (b) an anti-HER 2 antibody, and (c) an anti-PDL1 antibody.
  • the anti-HER2 antibody is trastuzumab (CAS Registry No. 180288-69-1).
  • the anti-PDL1 antibody is atezolizumab (CAS Registry No. 1380723-44-3), avelumab (CAS Registry No. 1537032-82-8), or durvalumab (CAS Registry No.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), the anti-HER2 antibody, the anti-PD-L1 antibody (e.g., an anti PD-L1 antagonist antibody) are administered simultaneously, concurrently, or sequentially.
  • the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the solid tumor is HER2 + solid tumor.
  • the solid tumor is colon cancer (e.g., HER2 + colon cancer).
  • a method of treating gastric cancer or gastroesophageal junction (GEJ) cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), (b) an anti-HER 2 antibody, (c) an anti-VEGFR2 antibody, and (d) paclitaxel.
  • the anti-HER2 antibody is trastuzumab (CAS Registry No. 180288-69-1).
  • the anti-VEGFR2 antibody is ramucirumab (CAS Registry No. 947687-13-0).
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), the anti-HER2 antibody, the anti-VEGFR2 antibody, and the paclitaxel are administered simultaneously, concurrently, or sequentially. In some embodiments, the polypeptide (e.g. fusion polypeptide) is administered to the individual at a dose of 10 mg/kg once a week or 15 mg/kg once a week.
  • the individual receiving treatment has gastric or GEJ adenocarcinoma.
  • the individual receiving treatment has HER2 + gastric cancer or HER2 + GEJ cancer (e.g., a HER2-overexpessing gastric or GEJ cancer).
  • the HER2 + gastric cancer or HER2 + GEJ cancer is advanced and/or metastatic.
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatment(s) comprising anti-HER2 antibody (e.g., trastuzumab).
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatment(s) comprising anti-HER2 antibody (e.g., trastuzumab) and a fluoropyrimidine. In some embodiments, the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatments(s) comprising anti-HER2 antibody (e.g., trastuzumab) and a platinum-based chemotherapeutic agent.
  • anti-HER2 antibody e.g., trastuzumab
  • a fluoropyrimidine e.g., trastuzumab
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatments(s) comprising anti-HER2 antibody (e.g., trastuzumab) and a platinum-based chemotherapeutic agent.
  • the individual receiving treatment has gastric or GEJ cancer (e.g., HER2 + gastric cancer or GEJ cancer) that has progressed during or after prior treatment(s) comprising anti-HER2 antibody (e.g., trastuzumab) and/or a fluoropyrimidine, and/or a platinum-based chemotherapeutic agent.
  • anti-HER2 antibody e.g., trastuzumab
  • fluoropyrimidine e.g., trastuzumab
  • platinum-based chemotherapeutic agent e.g., trastuzumab
  • the individual failed (e.g., relapsed after or did not respond to) prior therapy with an anti-HER2 antibody, with an anti-HER2 antibody and a fluoropyrimidine, or with an anti-HER2 antibody and a platinum-based chemotherapy agent.
  • the fluoropyrimidine was fluorouracil (also known as 5-fluorouracil).
  • treatment with the polypeptide, the anti-HER2 antibody, the anti-VEGFR2 antibody, and the paclitaxel does not result in adverse effects.
  • treatment with the polypeptide, the anti-HER2 antibody, the anti-VEGFR2 antibody, and the paclitaxel results in only low grade adverse effects.
  • a method of treating gastric cancer or gastroesophageal junction (GEJ) cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), (b) an anti-PD-1 antibody (e.g., an anti-PD-1 antagonist antibody), (c) an anti-HER2 antibody, (d) 5-fluorouracil and (e) a platinum-based chemotherapeutic agent.
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRP ⁇ e.g., hSIRP ⁇
  • an anti-PD-1 antibody e.g., an anti-PD-1 antagonist antibody
  • an anti-HER2 antibody e.g., 5-fluorouracil
  • 5-fluorouracil e.g., 5-fluorouracil
  • platinum-based chemotherapeutic agent e.g., a platinum-based
  • a method of treating gastric cancer or gastroesophageal junction (GEJ) cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), (b) an anti-PD-1 antibody (e.g., an anti-PD-1 antagonist antibody), (c) an anti-HER2 antibody, (d) capecitabine, and (e) a platinum-based chemotherapeutic agent.
  • the anti-PD-1 antibody is pembrolizumab (CAS Registry No. 1374853-91-4).
  • the anti-HER2 antibody is trastuzumab (CAS Registry No. 180288-69-1).
  • the platinum-based chemotherapeutic agent is cisplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), the anti-PD-1 antibody, the anti-HER2 antibody, the 5-fluorouracil, and the platinum-based chemotherapeutic agent are administered simultaneously, concurrently, or sequentially.
  • the polypeptide e.g., fusion polypeptide
  • the anti-PD-1 antibody e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., the capecitabine
  • the platinum-based chemotherapeutic agent are administered simultaneously, concurrently, or sequentially.
  • the individual receiving treatment has HER2-overexpressing gastric cancer or HER2-overexpressing GEJ cancer.
  • the gastric cancer or the GEJ cancer is advanced and/or metastatic.
  • the individual has not received prior treatment for gastric cancer or the GEJ cancer.
  • a method of treating head and neck cancer e.g., head and neck cancer squamous cell carcinoma or HNSCC
  • an individual e.g., a human individual
  • administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ), (b) a PD-1 inhibitor, (c) an antimetabolite, and (d) a platinum-based agent.
  • the PD-1 inhibitor is a small molecule inhibitor, an antisense nucleotide, or a peptide.
  • the PD-1 inhibitor is an anti-PD-1 antibody.
  • the anti-PD-1 antibody is pembrolizumab, nivolumab, pidilizumab, cemiplimab, or BMS-936559. In some embodiments, the anti-PD-1 antibody is pembrolizumab (CAS Registry No. 1374853-91-4).
  • the antimetabolite is 5-fluorouracil, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate. In some embodiments, the antimetabolite is 5-fluorouracil.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), the PD-1 inhibitor (e.g., an anti-PD-1 antibody, e.g., pembrolizumab), the antimetabolite (e.g., 5-fluorouracil), and the platinum-based chemotherapeutic agent (e.g., cisplatin or carboplatin) are administered simultaneously, concurrently, or sequentially.
  • the PD-1 inhibitor e.g., an anti-PD-1 antibody, e.g., pembrolizumab
  • the antimetabolite e.g., 5-fluorouracil
  • platinum-based chemotherapeutic agent e.g., cisplatin or carb
  • the polypeptide (e.g. fusion polypeptide) is administered to the individual at a dose of 10 mg/kg once a week or 15 mg/kg once a week.
  • the individual receiving treatment has HNSCC.
  • the HNSCC is advanced and/or metastatic HNSCC.
  • the HNSCC is unresectable and/or recurrent.
  • the individual has not received prior treatment for head and neck cancer (e.g., HNSCC).
  • treatment with the polypeptide, the PD-1 inhibitor (e.g., pembrolizumab), the antimetabolite (e.g., 5-fluorouracil), and the platinum-based chemotherapeutic agent (e.g., cisplatin or carboplatin) does not result in adverse effects.
  • treatment with the polypeptide, the PD-1 inhibitor (e.g., pembrolizumab), the antimetabolite (e.g., 5-fluorouracil), and the platinum-based chemotherapeutic agent (e.g., cisplatin or carboplatin) results in only low grade adverse effects.
  • a method of treating cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) an anti-TROP2 antibody.
  • the anti-TROP2 antibody is RS7, which is described in U.S. Pat. No. 10,179,171, the contents of which are incorporated herein in their entirety.
  • the anti-TROP2 antibody is conjugated to a drug (i.e., an antibody-drug conjugate or “ADC”).
  • the anti-TROP2 ADC is Sacituzumab govitecan (also known as hRS7-SN38 or IMMU-132), which is described in US 2017/0281791, the contents of which are incorporated herein by reference in their entirety.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), and the anti-TROP2 antibody are administered simultaneously, concurrently, or sequentially.
  • the cancer is solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma.
  • the cancer is characterized by the overexpression of TROP2. In some embodiments, the cancer is not characterized by the overexpression of TROP2.
  • a method of increasing phagocytosis of a target cell that comprises contacting the target cell with (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) an anti-TROP2 antibody.
  • the anti-TROP2 antibody is RS7, which is described in U.S. Pat. No. 10,179,171, the contents of which are incorporated herein in their entirety.
  • the anti-TROP2 antibody is conjugated to a drug (i.e., an antibody-drug conjugate or “ADC”).
  • the anti-TROP2 ADC is Sacituzumab govitecan (also known as hRS7-SN38 or IMMU-132), which is described in US 2017/0281791, the contents of which are incorporated herein by reference in their entirety.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the target cell is a cancer cell.
  • the cancer cell is a solid tumor cell, a gastric cancer cell, a nasopharyngeal cancer cell, a gallbladder cancer cell, a cervical cancer cell, an extranodal NK/T cell lymphoma cell, a lung cancer cell, a laryngeal squamous cell cancer cell, a colon cancer cell, a Hilar Cholangiocarcinoma cell, a pancreatic cancer cell, a squamous cell carcinoma cell of the oral cavity, an endometrioid endometrial carcinoma cell, or an ovarian carcinoma cell.
  • a method of increasing phagocytosis of a target cell comprising contacting the target cell with (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRP ⁇ (e.g., hSIRP ⁇ ) and (b) a second agent that is capable of enhancing phagocytosis.
  • the agent that blocks the interaction between CD47 and SIRP ⁇ is a polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRP ⁇ D1 domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the second agent enhances phagocytosis, e.g., by blocking “don't eat me” signals.
  • Exemplary agents include, but are not limited to, e.g., an anti-LILRB2 antibody, an anti-LILRB1 antibody, an anti-SIGLEC-10 antibody, an anti-CD24 antibody, an anti-SIRP ⁇ antibody, an anti-PD1 antibody (e.g., an anti PD1 antagonist antibody), and an anti-PD-L1 antibody (e.g., an anti PD-L1 antagonist antibody).
  • the second agent enhances phagocytosis, e.g., by enhancing “eat me” signals.
  • Exemplary agents include, but are not limited to, e.g., BTK activators, TLR agonists, agents that promote the interaction between Mac-1 and SLAMF7, and agents that agents that promote the interaction between calreticulin and LRP1.
  • Additional exemplary agents that enhance phagocytosis include, but are not limited to, e.g., agents that modulate podosome adhesions, agents that modulate the expression level of lamin A, activators of the SHP-1 phosphatase activity, and activators of myosin Ha assembly.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) and (b) and an anti-LILBR2 antibody, an anti-CD24 antibody, or an anti-SIGLEC-10 antibody.
  • the method comprise contacting the target cell with (a) the fusion polypeptide and (b) a BTK activator.
  • the method comprises contacting the target cell with (a) the fusion polypeptide and (b) a TLR agonist.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) and (b) two or more agents that are capable of enhancing phagocytosis (e.g., including, but not limited to, two or more agents described herein).
  • the polypeptide e.g., fusion polypeptide
  • a SIRP ⁇ D1 domain variant e.g., a SIRP ⁇ D1 domain variant described herein
  • Fc domain variant e.g., an Fc domain variant described herein
  • two or more agents that are capable of enhancing phagocytosis e.g., including, but not limited to, two or more agents described herein.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein), (b) and an anti-LILBR2 antibody, an anti-CD24 antibody, or an anti-SIGLEC-10 antibody, and (c) an anti-PD1 antibody (e.g., an anti-PD-1 antagonist antibody) or an anti-PD-L1 antibody (e.g., an anti-PD-L1 antagonist antibody).
  • a the polypeptide.g., fusion polypeptide
  • a SIRP ⁇ D1 domain variant e.g., a SIRP ⁇ D1 domain variant described herein
  • an Fc domain variant e.g., an Fc domain variant described herein
  • an anti-PD1 antibody e.g., an anti-PD-1 antagonist antibody
  • the method comprises contacting the target cell with (a) the fusion polypeptide, (b) an anti-LILBR2 antibody, and (c) an anti-PD1 antibody (e.g., anti-PD-1 antagonist antibody). In some embodiments, the method comprises contacting the target cell with (a) the fusion polypeptide, (b) an anti-LILBR2 antibody, and (c) an anti-PD-L1 antibody (e.g. an anti-PD-L1 antagonist antibody).
  • the contacting is performed in vitro. In some embodiments, the contacting is performed in vivo. In some embodiments, the target cell is a cancer cell. In some embodiments, contacting the target cell with (a) the polypeptide comprising a SIRP ⁇ D1 domain variant (e.g., a SIRP ⁇ D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) and (b) one or more agents that are capable of enhancing phagocytosis increases phagocytosis of target cells by at least any one of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more than 99% as compared contacting the target cell with one or more agents that are capable of enhancing phagocytosis (i.e., in the absence of the polypeptide comprising a SIRP ⁇ D1 domain variant (e
  • an article of manufacture or a kit comprising a polypeptide (e.g., a fusion polypeptide described herein) comprising a SIRP ⁇ D1 domain variant and an Fc domain variant.
  • the SIRP ⁇ D1 domain variant comprises the amino acid sequence selected from the group consisting of: SEQ ID NO: 81 and SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the Fc domain variant comprises the amino acid sequence of SEQ ID NO: 91.
  • the polypeptide comprises the amino acid sequence of SEQ ID NO: 135 or SEQ ID NO: 136.
  • the kit or article of manufacture is for use according to a method of treatment provided herein.
  • the kit or article of manufacture further comprises a BCL2 inhibitor.
  • the BCL2 inhibitor is venetoclax.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the BCL2 inhibitor (e.g., venetoclax) to treat or delay progression of cancer (e.g., leukemia, including, but not limited to acute or chronic lymphoblastic leukemia, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myeloid leukemia (CIVIL), hairy cell leukemia, Chronic myelomonocytic leukemia (CMML), Juvenile myelomonocytic leukemia (JMML), Large granular lymphocytic (LGL) leuk
  • ALL acute lymphocytic le
  • the kit or article of manufacture further comprises a platinum-based chemotherapy agent.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the platinum-based chemotherapy agent (e.g., cisplatin) to treat or delay progression of solid tumor (e.g., colon cancer, colon carcinoma, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, brain tumor, mesothelioma, or neuroblastoma) in an individual (such as a human individual).
  • the platinum-based chemotherapy agent e.g., cisplatin
  • the kit or article of manufacture further comprises an anti-HER2 antibody (e.g., trastuzumab), and a PD-L1 inhibitor (e.g., an anti-PD-L1 antibody such as atezolizumab, avelumab, or durvalumab.
  • an anti-HER2 antibody e.g., trastuzumab
  • a PD-L1 inhibitor e.g., an anti-PD-L1 antibody such as atezolizumab, avelumab, or durvalumab.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-L1 inhibitor (e.g., atezolizumab, avelumab, or durvalumab) to treat or delay progression of cancer (e.g., solid tumor) in an individual (such as a human individual).
  • the polypeptide e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., trastuzumab
  • the PD-L1 inhibitor e.g., atezolizumab, avelumab, or durvalumab
  • the cancer e.g., solid tumor
  • the cancer is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the cancer e.g., solid tumor
  • the cancer is HER2 + cancer.
  • the cancer is colon cancer (e.g., HER2 + colon cancer).
  • the kit or article of manufacture further comprises an anti-HER2 antibody (e.g., trastuzumab), an anti-VEGFR2 antibody (e.g., ramucirumab), and paclitaxel.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the anti-VEGFR2 antibody (e.g., ramucirumab), and the paclitaxel to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer in an individual (such as a human individual), e.g., according to a method described herein.
  • GEJ gastroesophageal junction
  • the kit or article of manufacture further comprises an anti-HER2 antibody (e.g., trastuzumab), a PD-1 inhibitor (e.g., an anti-PD-1 antibody such as pembrolizumab), 5-fluorouracil, and a platinum-based agent (e.g., cisplatin or carboplatin).
  • an anti-HER2 antibody e.g., trastuzumab
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody such as pembrolizumab
  • 5-fluorouracil e.g., 5-fluorouracil
  • platinum-based agent e.g., cisplatin or carboplatin
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-1 inhibitor (e.g., pembrolizumab), the 5-fluorouracil, and the platinum-based agent (e.g., cisplatin or carboplatin) to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer in an individual (such as a human individual).
  • the polypeptide e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., trastuzumab
  • the PD-1 inhibitor e.g., pembrolizumab
  • 5-fluorouracil e.g., 5-fluorouracil
  • platinum-based agent e.g., cisplatin or carboplatin
  • the kit or article of manufacture further comprises an anti-HER2 antibody (e.g., trastuzumab), a PD-1 inhibitor (e.g., an anti-PD-1 antibody such as pembrolizumab), capecitabine, and a platinum-based agent (e.g., cisplatin or carboplatin).
  • an anti-HER2 antibody e.g., trastuzumab
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody such as pembrolizumab
  • capecitabine e.g., a platinum-based agent
  • platinum-based agent e.g., cisplatin or carboplatin
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-1 inhibitor (e.g., pembrolizumab), the capecitabine, and the platinum-based agent (e.g., cisplatin or carboplatin) to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer in an individual (such as a human individual).
  • the polypeptide e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., trastuzumab
  • the PD-1 inhibitor e.g., pembrolizumab
  • the capecitabine e.g., the platinum-based agent
  • the platinum-based agent e.g., cisplatin or carboplatin
  • the kit or article of manufacture further comprises a PD-1 inhibitor (e.g., an anti-PD-1 antibody such as pembrolizumab, nivolumab, pidilizumab, cemiplimab, or BMS936559), an antimetabolite (e.g., 5-fluorouracil, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate) and a platinum-based agent (e.g., cisplatin, carboplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin).
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody such as pembrolizumab, nivolumab, pidilizumab, cemi
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the PD-1 inhibitor (e.g., pembrolizumab, nivolumab, pidilizumab, cemiplimab, or BMS936559), the antimetabolite (e.g., 5-fluorouracil, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate), and the platinum-based agent (e.g., cisplatin, carboplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin) to treat or delay progression of head and neck cancer (e.g., head and neck squamous cell carcinoma) in an individual
  • the kit or article of manufacture further comprises a therapeutic anti-TROP2 antibody.
  • the anti-TROP2 antibody is RS7 (see, e.g., U.S. Pat. No. 10,179,171) or sacituzumab govitecan.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with anti-TROP2 antibody (e.g., cisplatin) to treat or delay progression of a TROP2 + cancer (e.g., solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma) in an individual (such as a human individual).
  • a TROP2 + cancer e.g., solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squa
  • the polypeptide (e.g., fusion polypeptide) and the one or more additional anti-cancer agents are provided together in the kit.
  • the polypeptide (e.g., fusion polypeptide) and the one or more additional anti-cancer agents are provided in the same container or separate containers.
  • Suitable containers include, for example, bottles, vials, bags and syringes.
  • the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or polyolefin), or metal alloy (such as stainless steel or hastelloy).
  • the container holds the formulation and the label on, or associated with, the container may indicate directions for use.
  • the article of manufacture or kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • the article of manufacture further includes one or more of another agent (e.g., a chemotherapeutic agent, an anti-neoplastic agent, a therapeutic antibody, etc.).
  • Suitable containers for the one or more agents include, for example, bottles, vials, bags and syringes.
  • Example 1A Anti-Tumor Activity of Drug a in Combination with Venetoclax in an Acute Leukemia Model
  • the anti-tumor activity of Drug A i.e., an exemplary polypeptide comprising a SIRP ⁇ d1 domain variant and an Fc variant, in combination with venetoclax was assessed in a RS4; 11 xenograft model.
  • the RS4; 11 cells (described in Stong et al. (1985) Blood. 65(1): 21-31) was injected into the right flank of NOD-SCID female mice at a concentration of 5 ⁇ 10 6 cells per mouse using a 1:1 matrigel (Corning) and RPMI 1640 ratio. Tumors were monitored until the average size of all tumors reached 190 mm 3 . Mice were randomized into PBS control, Venetoclax (Selleckchem), Drug A, and Venetoclax/Drug A combination cohorts, with 10 mice per cohort.
  • Venetoclax was a ratio of DMSO:ethanol:Cremophor EL:dextrose 5% in water (D5W) was 2.5:5:10:20:67.5, by volume.
  • Venetoclax-treated mice were dosed with 250 ⁇ g of Venetoclax by oral gavage 2 times total, 3 days apart.
  • Drug A-treated mice were dosed IP at 10 mg/kg, 4 times total, 3-4 days apart.
  • Venetoclax/Drug A-treated mice were dosed with 250 ⁇ g of Venetoclax by oral gavage 2 times total, 3 days apart, and with Drug A 1 day post Venetoclax dosage at 10 mg/kg, 4 times total, 3-4 days apart.
  • Tumors were measured in two dimensions with calipers, and tumor volume was calculated as: length ⁇ width ⁇ width ⁇ 0.5, where length was the larger of the two measurements.
  • FIG. 1B in mice who had received prior Venetoclax, treatment with Venetoclax in combination with Drug A inhibited tumor growth to a greater extent that re-treatment with Venetoclax alone.
  • the average tumor volume at Day 65 of mice re-treated with Venetoclax was about 1685 mm 3
  • the average tumor volume at Day 65 of mice treated with the combination was about 970 mm 3 .
  • the mouse that demonstrated tumor regression when treated with single-agent Venetoclax received single agent Venetoclax on Day 45. Notably, tumor regrowth was observed in this mouse.
  • CD14 + monocytes were purified by negative selection using the Classical Monocytes Isolation Kit, human (Miltenyi Biotec) and LS columns (Miltenyi Biotec) according to the manufacturer's protocol.
  • CD14 + monocytes were seeded into 150 mm tissue culture dishes (Corning) at 6 million cells per dish in 25 mL medium comprised of RPMI complete media, supplemented with 50 ng/mL M-CSF (Miltenyi Biotec), 10% human FBS serum (Thermo Fisher Scientific), 1% penicillin/streptomycin, and 1% GlutaMAX. Cells were cultured for seven to eleven days.
  • HL60 and OCI-AML3 cells were washed once in PBS and labeled with the Celltrace CFSE Cell Proliferation kit (Thermo Fisher Scientific) in suspension with 300 nM CFSE (carboxyfluorescein succinimidyl ester) according to the manufacturer's instructions and resuspended in RPMI complete media.
  • Target cells were incubated overnight with two-fold serial dilutions of venetoclax between 39 nM to 2.5 ⁇ M in RPMI complete media.
  • Prior to incubation with macrophages cells were resuspended in RPMI. Macrophages were detached from culture plates by washing once with PBS and incubation in TrypLE Select for 20 minutes at 37° C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in RPMI.
  • CFSE-labeled target cells treated with venetoclax for 48 hours were spun and added to ultra-low attachment U-bottom 96 well plates (Corning) at 100,000 cells per well. Drug A was then added. Plates were incubated 30 minutes at 37° C. in a humidified incubator with 5% carbon dioxide, then 50,000 macrophages were added. Plates were incubated two hours at 37° C. in a humidified incubator with 5% carbon dioxide. Cells were pelleted by centrifugation for five minutes at 400 ⁇ g and stained at 4° C. for 30 minutes in Fixable Viability Dye eFluor 780 (ebioscience) diluted 1:4000 in PBS.
  • HL60 cells and OCI-AML3 cells were labeled with CFSE (carboxyfluorescein succinimidyl ester) and treated with venetoclax for 48 hours.
  • the target cells were then spun and added to wells of 96 well plates at 100,000 cells per well. Drug A was then added. Untreated control target cells, as well as control target cells that treated only with venetoclax or only with Drug A, were prepared in parallel. Macrophages were added to the wells, and the plates were incubated two hours at 37° C. Macrophage cells were pelleted, stained, and analyzed via flow cytometry. Dead cells were excluded by gating on the e780-negative population. Macrophages were identified as cell positive for the lineage markers CD33, CD11b and CD14. Of this population, macrophages that had phagocytosed tumor cells were identified as cells positive for CFSE.
  • CFSE carboxyfluorescein succinimidyl ester
  • venetoclax as a single agent stimulated macrophage-mediated phagocytosis of HL60 cells, whereas Drug A as a single agent had little effect phagocytosis.
  • Compare Drug A treated cells to that of untreated cells. The combination of 20 nM Drug A and 125 nM venetoclax stimulated phagocytosis of HL60 cells by macrophages to a greater degree than either Drug A alone or venetoclax alone. Similar results were observed using 20 nM Drug A and 1 ⁇ M venetoclax in OCI-AML3 cells. See FIG. 5B .
  • IP intraperitoneally
  • Cisplatin was administered IP according to one of two regimens: once at a dose of 10 mpk or twice at a dose of 5 mpk. The two 5 mpk cisplatin doses were given 10 days apart. Mice receiving both cisplatin and Drug were administered with cisplatin (IP) according to one of the regimens described above, and with Drug A as described above. In mice receiving combination treatment, Drug A was administered one day after cisplatin. Tumors were measured in two dimensions with calipers, and tumor volume was calculated as: length ⁇ width ⁇ width ⁇ 0.5, where length was the larger of the two measurements.
  • mice treated with single agent cisplatin two 5 mpk doses, each given 10 days apart
  • Drug A did not have an appreciable effect of tumor growth.
  • Treatment with cisplatin in combination with Drug A delayed CT26 tumor growth in mice to a greater degree than either drug alone.
  • mice treated with cisplatin in combination with Drug A gained more weight during the course of treatment than mice given cisplatin alone.
  • mice in each of the PBS control, cisplatin, and Drug A treatment groups found to have a tumor volume ⁇ 500 mm 3
  • 33% of the mice in the cisplatin+Drug A treatment groups had tumors ⁇ 500 mm 3 in volume.
  • DLD-1 cells were washed twice with 20 ml PBS and incubated in 10 ml TRYPLETM Select (Gibco) cell-dissociation enzymes for 10 minutes at 37° C. in order to detach the cells from the culture plates. The detached cells were then centrifuged, washed in PBS, and resuspended in medium. Cells were labeled with the fluorescent label provided with the CELLTRACETM CFSE Cell Proliferation kit (Thermo Fisher) according to the manufacturer's instructions and resuspended in IMDM (Iscove's Modified Dulbecco Medium).
  • TRYPLETM Select Gabco
  • Macrophages were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TRYPLETM Select (Gibco) cell-dissociation enzymes for 20 minutes at 37° C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in IMDM.
  • Phagocytosis assays were assembled in ultra-low attachment U-bottom 96 well plates (Corning) containing 100,000 DLD-1, 50,000 macrophages, five-fold serial dilutions of Drug A or negative control antibody from 100 nM to 6.4 pM, and anti-TROP2 antibody at 0.01 ⁇ g/ml. The plates were incubated two hours at 37° C. in a humidified incubator with 5 percent carbon dioxide. Cells were then pelleted by centrifugation for five minutes at 400 ⁇ g and washed in 250 ⁇ l FACS buffer.
  • Macrophages were stained on ice for 15 minutes in 50 ⁇ l FACS buffer containing 10 ⁇ l human FcR Blocking Reagent (Miltenyi Biotec), 0.50 anti-CD33 Ab conjugated to BV421 label (Biolegend), and 0.5 ⁇ l anti-CD206 conjugated to Allophycocyanin-Cy7 label (Biolegend).
  • the cells were washed in 200 ⁇ l FACS buffer, washed in 250 ⁇ l PBS, and stained on ice for 30 minutes in 50 ⁇ l Fixable Viability Dye EFLUORTM 506 (ebioscience) viability dye diluted 1:1000 in PBS. Cells were then washed twice in 2500 FACS buffer and fixed overnight in 0.5% paraformaldehyde.
  • the fixed cells were analyzed on a FACS CANTO IITM (BD Biosciences) fluorescence-activated cell sorting analyzer, with subsequent data analysis by FlowJo 10.7 (Treestar) flow cytometry software. Dead cells were excluded by gating on the e506-negative population. Macrophages that had phagocytosed tumor cells were identified as cells positive for CD33, CD206, and CFSE (i.e., carboxyfluorescein succinimidyl ester).
  • FACS CANTO IITM BD Biosciences fluorescence-activated cell sorting analyzer, with subsequent data analysis by FlowJo 10.7 (Treestar) flow cytometry software. Dead cells were excluded by gating on the e506-negative population. Macrophages that had phagocytosed tumor cells were identified as cells positive for CD33, CD206, and CFSE (i.e., carboxyfluorescein succinimidyl ester).
  • the percent of macrophages that phagocytosed CFSE-labeled tumor cells is indicated on the y-axis. Macrophages were incubated with the indicated concentration of Drug A and 10 ng/mL anti-TROP2 antibody. Cells were also incubated with 10 ng/mL anti-TROP2 antibody alone, with negative control human IgG antibody in combination with anti-TROP2 antibody, and in media only. Phagocytosis of CFSE-labeled DLD-1 tumor cells by human monocyte-derived macrophages was enhanced in the presence of Drug A in combination of anti-TROP2 antibody. See FIG. 3 .
  • Example 4 Anti-Tumor Activity of Drug a in Combination with Trastuzumab and an Anti-PD1 Antibody in a Colon Cancer Model
  • MC38 m/h HER2 cells were generated by infecting MC38 murine colon adenocarcinoma cells with a lentivirus vector encoding a chimera of mouse and human HER2 transmembrane and extracellular domains.
  • MC38 m/h HER2 cells were maintained in DMEM (Thermo Fisher Scientific 11965092) supplemented with 10% FBS, 1% Penicillin-Streptomycin, 1% GlutaMAX and 1 mM Sodium Pyruvate (Thermo Fisher Scientific 11360070) at 37° C., 5% CO2 incubator. All tissue culture was performed under aseptic conditions.
  • a master cell bank of each cell line was generated to assure that cells used in subsequent experiments were of the same passage number.
  • Cells were harvested and washed two times in 50 mL cold PBS (Life Technologies 10010072). After the final wash, cells were resuspended in PBS or RPMI at 5 ⁇ 10 6 cells/mL for MC38 m/h HER2 cell line. 100 ⁇ L of cell suspension were subcutaneously injected into the right flank of C57BL/6 mice for MC38 m/h HER2. When tumor size reached an average of 65-69 mm 3 for MC38 m/h HER2 tumors, the animals were randomized into 8 groups of 10 mice. Each group was assigned to a treatment group outlined in Table A:
  • Chimeric m/h HER2 with the extracellular domain from human HER2 and intracellular domain from mouse HER2, was expressed on MC38 colon cells to permit evaluation of trastuzumab's activity against MC38 murine tumors.
  • Monotherapy with trastuzumab had no effect on tumor growth, while Drug A monotherapy and anti-PD-L1 antibody monotherapy each had a moderate effect on tumor growth.
  • Treatment with the Drug A+anti-PD-L1 antibody doublet or the trastuzumab+anti-PD-L1 antibody doublet showed improved tumor growth inhibition as compared to monotherapy alone.
  • Treatment with the Drug A+anti-PD-L1+trastuzumab triple combination showed improved tumor inhibition when compared to each doublet.
  • Example 5A Exemplary Clinical Trials to Assess the Anti-Tumor Activity of Drug a Combination Therapies in Human Patients
  • a clinical trial is performed to assess the safety, tolerability, and efficacy of the combination of Drug A, trastuzumab, ramucirumab, and paclitaxel in patients with HER2 + overexpressing advanced or metastatic gastric or GEJ adenocarcinoma that has progressed during or after prior therapy with trastuzumab and fluoropyrimidine-containing chemotherapy (e.g., fluorouracil); during or after prior therapy with trastuzumab and platinum-containing chemotherapy; or during or after prior therapy with trastuzumab, fluoropyrimidine-containing chemotherapy (e.g., fluorouracil), and platinum-containing chemotherapy.
  • the patients enrolled in the trial are suitable for treatment with trastuzumab.
  • the patients have not received prior therapy with an anti-CD47 agent or an anti-SIRP ⁇ agent.
  • a clinical trial is performed to assess the safety, tolerability, and efficacy of the combination of Drug A, pembrolizumab, cisplatin, and either 5-fluorouracil or capecitabine in patients with gastric or GEJ adenocarcinoma (e.g., HER2 + overexpressing gastric or GEJ adenocarcinoma).
  • gastric or GEJ adenocarcinoma e.g., HER2 + overexpressing gastric or GEJ adenocarcinoma.
  • the patients enrolled in the trial have not received prior therapy with an anti-CD47 agent or an anti-SIRP ⁇ agent. Patients have adequate organ function and hemoglobin is greater or equal to 9 g/dL.
  • HNSCC Head and Neck Squamous Cell Carcinoma
  • a clinical trial is performed to assess the safety, tolerability, and efficacy of the combination of Drug A, pembrolizumab, 5-fluorouracil, and either carboplatin or cisplatin in patients with metastatic or with unresectable, recurrent HNSCC who have not yet been treated for their advanced disease.
  • Example 5B Preliminary Safety Results from the Exemplary Clinical Trials Described in Example 5A
  • Drug A 10 mg/kg IV QW
  • pembrolizumab 200 mg IV Q3W
  • 5-fluorouracil 1,000 mg/m 2 per day on days 1, 2, 3, 4 Q3W ⁇ 6
  • cisplatin 100 mg/m 2 Q3Wx 6
  • trastuzumab Three additional patients with HER2-positive gastric/gastroesophageal cancer who progressed on prior treatment(s) with trastuzumab, fluorouracil, and a platinum agent received treatment with Drug A (15 mg/kg IV QW), trastuzumab (8 mg/kg IV for the initial dose, followed by 6 mg/kg Q3W), ramucirumab (8 mg/kg on Days 1 and 15 Q4W), and paclitaxel (80 mg/m2 on Days 1, 8, and 15 Q4W).
  • Drug A 15 mg/kg IV QW
  • trastuzumab 8 mg/kg IV for the initial dose, followed by 6 mg/kg Q3W
  • ramucirumab 8 mg/kg on Days 1 and 15 Q4W
  • paclitaxel 80 mg/m2 on Days 1, 8, and 15 Q4W.
  • Treatment related adverse events (TRAE ⁇ Grade 3) reported in patients treated with Drug A+pembrolizumab+fluorouracil+carboplatin or Drug A+trastuzumab+ramucirumab+paclitaxel.
  • Example 5C Preliminary Efficacy Results from the Exemplary Clinical Trials Described in Example 5A
  • the patient with untreated advanced head and neck squamous cell carcinoma who received treatment with Drug A, pembrolizumab, 5-fluorouracil, and a platinum agent at the dosages and administration schedule described in Example 5B achieved partial response (PR) based on investigator-assessed response using RECIST v1.1 criteria.
  • Drug A in combination with pembrolizumab, 5-fluorouracil, and a platinum agent showed clinical activity in the treatment of advanced 1L HNSCC (i.e., as a first treatment in patients with advanced HNSCC who have not received prior therapy for HNSCC.)
  • Drug A in combination with trastuzumab, ramucirumab, and paclitaxel showed clinical activity in the treatment of advanced ⁇ 2L gastric/gastroesophageal cancer (i.e., as a treatment in patients who have received at least one prior therapy for gastric or GEJ cancer).
  • Example 5D Additional Results from the Exemplary Clinical Trials Described in Example 5A
  • CD47 is a myeloid checkpoint up-regulated by tumors to evade the anticancer immune response.
  • Drug A is an exemplary high affinity CD47-blocking fusion protein with an inactive Fc region designed to safely enhance anticancer therapeutics (Kauder et al. (2016) PLoS ONE. 13(8): e0201832: Chow et al. (2020) Journal of Clinical Oncology. 38:15 suppl, 3056-3056).
  • Drug A in combination with standard chemotherapy and antibody regimens was evaluated in patients with advanced HER2-positive gastric cancer (GC) or with head and neck squamous cell carcinoma (HNSCC).
  • GC HER2-positive gastric cancer
  • HNSCC head and neck squamous cell carcinoma
  • Drug A 10 mg/kg QW or 15 mg/kg QW in combination with trastuzumab (T)+ramucirumab (ram)+paclitaxel (pac) as 2nd or later-line treatment.
  • the GC patients had progressed during or following a prior fluoropyrimidine therapy (or a fluoropyrimidine-containing therapy).
  • GC patients who had progressed during or following a prior therapy with trastuzumab and/or a platinum-based chemotherapeutic agent were included.
  • Drug A 10 mg/kg QW or 15 mg/kg QW in combination with pembrolizumab (P)+5FU+platinum (cisplatin or carboplatin) as 1st line therapy.
  • P pembrolizumab
  • P palladium phosphate
  • P cisplatin or carboplatin
  • the primary endpoint was dose limiting toxicity (DLT).
  • DLT dose limiting toxicity
  • Tumor response, PK), and pharmacodynamic (PD) markers were assessed in all patients.
  • TRAE treatment-related adverse events
  • HNSCC patient who received Drug A at 15 mg/kg qw+pembrolizumab+5-fluorouracil+a platinum-based chemotherapeutic agent was CPI naive and demonstrated partial response.
  • Drug A at 10 mg/kg qw+pembrolizumab+5-fluorouracil+a platinum-based chemotherapeutic agent all were CPI na ⁇ ve.
  • Initial Drug A combination PK and CD47 target occupancy are similar to that of single agent administration. Near complete (80%-100%) CD47 target occupancy is maintained throughout Drug A dosing interval when combined with chemotherapy-containing regimens. Circulating immune cell profiles (CD4 + T cells, CD8 + T cells, CD19 + B cells, and CD16 + CD56 + NK cells) are generally unchanged following Drug A combined with chemotherapy-containing regimens. Drug A PK following combination therapies with pembrolizumab or trastuzumab is comparable, with and without chemotherapy.
  • Drug A demonstrates initial ORR of 64% in patients with ⁇ 2L HER2 positive GC in combination with trastuzumab and ramucirumab+paclitaxel that compares favorably with the clinical experience of ramucirumab+paclitaxel in patients whose disease has progressed upon prior trastuzumab-containing regimens.
  • Drug A demonstrates initial anti-cancer activity including complete and partial objective responses in combination with pembrolizumab+5FU+platinum in patients who have not received prior treatment for their advanced HNSCC.
  • the C-terminus of the SIRP ⁇ variant of Drug A is fused to the N-terminus of an Fc variant with ablated effector function.
  • Drug B is a fusion polypeptide comprising the SIRP ⁇ variant of Drug A whose C-terminus is fused to the N-terminus of a WT Fc (i.e., the WT Fc from which the Fc variant of Drug A was derived).
  • Drug C is a fusion polypeptide comprising a SIRP ⁇ variant that binds hCD47 with a K D of ⁇ 3 nM whose C-terminus is fused to the N-terminus of the Fc variant of Drug A.
  • spleens were harvested an analyzed for up-regulation of CD86, a cell-surface marker that indicates dendritic cell activation.
  • CD86 a cell-surface marker that indicates dendritic cell activation.
  • FIGS. 6A, 6B, 7A , and 7 B CD8 + and CD8 ⁇ dendritic cells were activated in spleens of mice that were administered with Drug A.
  • the level of CD8 + dendritic cell activation FIG. 6A
  • CD8 ⁇ dendritic cell activation FIG.
  • a therapeutic agent comprising a CD47 binding moiety (e.g., a SIRP ⁇ variant) that has an affinity for hCD47 that is better than about 10 nM and/or an Fc variant with ablated effector function leads to higher CD8 + and CD8 ⁇ DC activation than administration of a therapeutic agent that comprises a CD47 binding moiety (e.g., a SIRP ⁇ variant) that has an affinity for CD47 (e.g., hCD47) that is higher than 10 nM and/or a WT Fc domain.
  • a CD47 binding moiety e.g., a SIRP ⁇ variant
  • a therapeutic agent that binds CD47 and comprises an Fc domain with ablated effector function demonstrates improved safety following administration as compared to a therapeutic agent that binds CD47 and comprises a WT Fc domain. See, e.g., Kauder et al. (2016) PLoS ONE 13(8): e0201832.
  • Drug A is a fusion polypeptide comprising a SIRP ⁇ variant that binds hCD47 with a K D of ⁇ 140 pM whose C-terminus is fused to the N-terminus of an Fc variant with ablated effector function.
  • F59/magrolimab is a therapeutic anti-CD47 antibody comprising a human IgG4 Fc domain with WT effector function.
  • TTI-621 is a therapeutic fusion polypeptide comprising the CD47 binding domain of human SIRP ⁇ linked to a human IgG1 Fc domain with WT effector function.
  • TTI-622 is a therapeutic fusion polypeptide comprising the CD47 binding domain of human SIRP ⁇ linked to a to a human IgG4 Fc domain with WT effector function.
  • the affinities of Drug A, F59/magrolimab, TTI-621, and TTI-622 for hCD47 are shown in Table D below.
  • Drug A exhibited about 100% receptor occupancy at a concentration of ⁇ 1 nM.
  • F59/magrolimab exhibited about 90% receptor occupancy at a concentration of ⁇ 1 nM.
  • Agents 2 and 3 exhibited about 40% receptor occupancy at a concentration of ⁇ 1 ⁇ M.
  • a validated SIRP ⁇ signaling assay (PathHunter SIRP ⁇ Signaling Bioassay from DiscoverX) was used to assess the degree to which Drug A, F59/magrolimab, TTI-621, and TTI-622 inhibit the interaction between hSIRP ⁇ and hCD47.
  • the EC50 values of Drug A, F59/magrolimab, TTI-621, and TTI-622 for hCD47 are shown in Table E below.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Inorganic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • Hematology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
US17/105,353 2019-11-27 2020-11-25 Combination therapies for treating cancer Abandoned US20210154269A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US17/105,353 US20210154269A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer
US18/154,380 US12527838B2 (en) 2019-11-27 2023-01-13 Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US18/342,331 US20240075101A1 (en) 2019-11-27 2023-06-27 Combination therapies for treating cancer

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201962941390P 2019-11-27 2019-11-27
US202063022998P 2020-05-11 2020-05-11
US202063030686P 2020-05-27 2020-05-27
US202063106225P 2020-10-27 2020-10-27
US202063109044P 2020-11-03 2020-11-03
US17/105,353 US20210154269A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US18/154,380 Division US12527838B2 (en) 2019-11-27 2023-01-13 Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US18/342,331 Continuation US20240075101A1 (en) 2019-11-27 2023-06-27 Combination therapies for treating cancer

Publications (1)

Publication Number Publication Date
US20210154269A1 true US20210154269A1 (en) 2021-05-27

Family

ID=73854963

Family Applications (3)

Application Number Title Priority Date Filing Date
US17/105,353 Abandoned US20210154269A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer
US18/154,380 Active 2041-05-18 US12527838B2 (en) 2019-11-27 2023-01-13 Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US18/342,331 Abandoned US20240075101A1 (en) 2019-11-27 2023-06-27 Combination therapies for treating cancer

Family Applications After (2)

Application Number Title Priority Date Filing Date
US18/154,380 Active 2041-05-18 US12527838B2 (en) 2019-11-27 2023-01-13 Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US18/342,331 Abandoned US20240075101A1 (en) 2019-11-27 2023-06-27 Combination therapies for treating cancer

Country Status (11)

Country Link
US (3) US20210154269A1 (cg-RX-API-DMAC7.html)
EP (1) EP4065101A1 (cg-RX-API-DMAC7.html)
JP (2) JP7713447B2 (cg-RX-API-DMAC7.html)
KR (1) KR20220107223A (cg-RX-API-DMAC7.html)
CN (2) CN121243368A (cg-RX-API-DMAC7.html)
AU (1) AU2020394204A1 (cg-RX-API-DMAC7.html)
BR (1) BR112022008817A2 (cg-RX-API-DMAC7.html)
CA (1) CA3162633A1 (cg-RX-API-DMAC7.html)
IL (1) IL293199A (cg-RX-API-DMAC7.html)
MX (1) MX2022006078A (cg-RX-API-DMAC7.html)
WO (1) WO2021108693A1 (cg-RX-API-DMAC7.html)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
WO2023079438A1 (en) * 2021-11-08 2023-05-11 Pfizer Inc. Enhancement of cd47 blockade therapy with anti-vegf agents
WO2023168384A3 (en) * 2022-03-03 2023-10-12 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16, and her2
WO2023228044A1 (en) * 2022-05-25 2023-11-30 Pfizer Inc. Dosing regimens of sirp alpha fusion proteins for treatment of cancer
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
EP4434999A4 (en) * 2021-11-19 2026-02-11 Hangzhou Sumgen Biotech Co Ltd A VARIANT OF SIRP? AND ITS USAGE

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20250213645A1 (en) * 2021-09-17 2025-07-03 L-Base Co., Ltd. Pharmaceutical composition for modulating immune response
US20250235504A1 (en) * 2021-10-29 2025-07-24 Pfizer Inc. Enhancement of cd47 blockade with taxanes for cd47+ cancer therapy
KR20240165995A (ko) * 2022-03-24 2024-11-25 길리애드 사이언시즈, 인코포레이티드 Trop-2 발현 암의 치료를 위한 병용요법
US20240010701A1 (en) * 2022-06-01 2024-01-11 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma
CN120530124A (zh) * 2023-01-04 2025-08-22 阿斯顿科学有限公司 Trop2免疫原性肽
WO2025038668A1 (en) * 2023-08-14 2025-02-20 Voro Therapeutics, Inc. Therapeutic binding agents that conditionally promote myeloid cell activity against target cells and uses thereof
CN117890603A (zh) * 2024-01-17 2024-04-16 南通大学附属医院 Pd-l1作为药物靶点在筛选抑制肌腱粘连药物中的应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017027422A1 (en) * 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof

Family Cites Families (126)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US5697901A (en) 1989-12-14 1997-12-16 Elof Eriksson Gene delivery by microneedle injection
JPH04334377A (ja) 1990-12-31 1992-11-20 Akzo Nv 酸−不安定性リンカー分子
US6613332B1 (en) 1991-06-21 2003-09-02 The University Of Cincinnati Oral administration of therapeutic proteins
DK0590060T3 (da) 1991-06-21 1998-05-11 Univ Cincinnati Oralt indgivelige terapeutiske proteiner samt fremgangsmåde til fremstilling
IL99120A0 (en) 1991-08-07 1992-07-15 Yeda Res & Dev Multimers of the soluble forms of tnf receptors,their preparation and pharmaceutical compositions containing them
US7018809B1 (en) 1991-09-19 2006-03-28 Genentech, Inc. Expression of functional antibody fragments
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
CA2224907A1 (en) 1995-07-25 1997-02-13 Introgene B.V. Methods and means for targeted gene delivery
DE69733815T2 (de) 1996-02-15 2006-06-08 Biosense Webster, Inc., Diamond Bar Sonde zur exkavation
JP2000514440A (ja) 1996-07-09 2000-10-31 ザ ジョーンズ ホプキンス ユニバーシティー 遺伝子輸送システム
US6541615B1 (en) 1996-11-15 2003-04-01 Max-Planck-Gellschaft Zur Foderung Der Wissenschaften E.V. SIRP proteins and uses thereof
CA2226962A1 (en) 1998-02-16 1999-08-16 Marie Sarfati Use of binding agents to cd47 and its ligands in the treatment or the prophylaxis of various inflammatory, autoimmune and allergic diseases and in the treatment of graft rejection
EP1192176A4 (en) 1999-06-11 2003-03-05 Human Genome Sciences Inc 49 HUMAN SECRETED PROTEINS
US6613026B1 (en) 1999-12-08 2003-09-02 Scimed Life Systems, Inc. Lateral needle-less injection apparatus and method
GB9930706D0 (en) 1999-12-24 2000-02-16 Medical Res Council Composition for inhibiting macrophage activity
US7662367B2 (en) 2000-03-02 2010-02-16 Xencor, Inc. Pharmaceutical compositions for the treatment of TNF-α related disorders
TWI334439B (en) 2001-08-01 2010-12-11 Centocor Inc Anti-tnf antibodies, compositions, methods and uses
GB0124145D0 (en) 2001-10-08 2001-11-28 Bayer Ag Genes and proteins for prevention,prediction,prognosis and therapy of cardiovascular disease
US20170281791A1 (en) 2002-03-01 2017-10-05 Immunomedics, Inc. Anti-trop-2 antibody-drug conjugates and uses thereof
CA2478047C (en) 2002-03-01 2014-01-21 Immunomedics, Inc. Rs7 antibodies
US20040018522A1 (en) 2002-05-09 2004-01-29 Brigham And Women's Hospital, Inc. Identification of dysregulated genes in patients with multiple sclerosis
WO2004011618A2 (en) 2002-07-29 2004-02-05 Hmgene, Inc. Methods of identifying adipocyte specific genes, the genes identified, and their uses
US20070010434A1 (en) 2002-09-16 2007-01-11 Genetech, Inc. Novel compositions and methods for the treatment of immune related diseases
EP1900753B1 (en) 2002-11-08 2017-08-09 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
US20100215640A1 (en) 2003-04-24 2010-08-26 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US8613922B2 (en) 2003-04-24 2013-12-24 The University Of North Carolina At Chapel Hill Methods for inhibiting diabetic retinopathy with an antibody against integrin associated protein (IAP)
US20040213792A1 (en) 2003-04-24 2004-10-28 Clemmons David R. Method for inhibiting cellular activation by insulin-like growth factor-1
AU2003264100A1 (en) 2003-08-25 2005-03-10 Pieris Proteolab Ag Muteins of a bilin-binding protein with affinity for a given target
AU2005220156B2 (en) 2004-02-27 2011-06-02 Vaxconsulting Peptides of IL1 beta and TNF alpha and method of treatment using same
WO2005092362A2 (de) 2004-03-29 2005-10-06 Hallstroem Seth Pharmazeutisches kombinationspräparat enthaltend ein therapeutisches protein
US20080299042A1 (en) 2004-04-30 2008-12-04 Biogen Idec Ma Inc. Membrane Associated Molecules
US7514229B2 (en) 2005-09-29 2009-04-07 The Board Of Trustees Of The Leland Stanford Junior University Methods for diagnosing and evaluating treatment of blood disorders
AR060017A1 (es) 2006-01-13 2008-05-21 Novartis Ag Composiciones y metodos de uso para anticuerpos de dickkopf -1
US8377448B2 (en) 2006-05-15 2013-02-19 The Board Of Trustees Of The Leland Standford Junior University CD47 related compositions and methods for treating immunological diseases and disorders
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
AR066240A1 (es) 2007-04-23 2009-08-05 Wyeth Corp Metodos y composiciones para tratar y monitorear el tratamiento de trastornos asociados con il-13
US20090304719A1 (en) 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
EP2573112A1 (en) 2007-10-11 2013-03-27 The Hospital For Sick Children Modulation of sirpa - cd47 interaction for increasing human hematopoietic stem cell engraftment and compounds therefor
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
ES2582340T3 (es) 2008-01-15 2016-09-12 The Board Of Trustees Of The Leland Stanford Junior University Métodos para manipular fagocitosis mediada por CD47
EP2111869A1 (en) 2008-04-23 2009-10-28 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
WO2010070047A1 (en) 2008-12-19 2010-06-24 Novartis Ag Soluble polypeptides for use in treating autoimmune and inflammatory disorders
RU2636046C2 (ru) 2009-01-12 2017-11-17 Сайтомкс Терапьютикс, Инк Композиции модифицированных антител, способы их получения и применения
AU2010215761B2 (en) 2009-02-23 2017-04-06 Cytomx Therapeutics, Inc Proproteins and methods of use thereof
HRP20150553T1 (hr) 2009-05-15 2015-08-28 University Health Network Sastavi i metode za lijeäśenje hematoloških maligniteta ciljajuä†i sirp - cd47 interakciju
KR20120097481A (ko) 2009-07-20 2012-09-04 내셔날 쳉쿵 유니버시티 사람 혈청 알부민(HSA)의 변이체와 컨쥬게이션된 αvβ3 인테그린에 대해 선택적인 폴리펩타이드 및 이의 약제학적 용도
KR101632312B1 (ko) 2009-11-03 2016-06-21 삼성전자주식회사 항체 불변 영역에 특이적으로 결합하는 융합 단백질, 그의 제조 방법 및 이를 이용한 항체 분리 방법
US8961967B2 (en) 2009-11-30 2015-02-24 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
BR112012017164A2 (pt) 2009-12-22 2019-09-24 Novartis Ag proteína de fusão de região constante de anticorpo-cd47 tetravalente
PT2569013T (pt) 2010-05-14 2017-02-08 Univ Leland Stanford Junior Anticorpos monoclonais humanizados e quiméricos para cd47
JP6157352B2 (ja) 2010-10-08 2017-07-05 シティ・オブ・ホープCity of Hope メディトープ(Meditope)のためのモノクローナル抗体フレームワーク結合インターフェース、メディトープ送達系、およびその使用法
US8609621B2 (en) 2010-11-15 2013-12-17 E I Du Pont De Nemours And Company Acid-cleavable linkers exhibiting altered rates of acid hydrolysis
WO2012109267A2 (en) 2011-02-07 2012-08-16 The Trustees Of The University Of Pennsylvania Novel peptides and methods using same
ES2692268T5 (en) 2011-03-29 2025-02-26 Roche Glycart Ag Antibody fc variants
EP3415528B1 (en) 2011-04-13 2021-05-26 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP2699596A4 (en) 2011-04-22 2015-01-14 Emergent Product Dev Seattle PROSTATE-SPECIFIC MEMBRANE-BINDING PROTEINS AND COMPOSITIONS AND METHOD THEREFOR
BR112013031762A2 (pt) 2011-06-16 2016-09-13 Novartis Ag proteínas solúveis para utilização como terapêuticos
WO2013056352A1 (en) 2011-10-19 2013-04-25 University Health Network Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers
WO2013063076A1 (en) 2011-10-25 2013-05-02 Indiana University Research & Technology Corporation Compositions for and methods of modulating complications, risks and issues with xenotransplantation
ES2816647T3 (es) 2012-01-17 2021-04-05 Univ Leland Stanford Junior Reactivos SIRP-alfa de alta afinidad
US9428553B2 (en) 2012-02-10 2016-08-30 City Of Hope Meditopes and meditope-binding antibodies and uses thereof
US9856314B2 (en) 2012-06-22 2018-01-02 Cytomx Therapeutics, Inc. Activatable antibodies having non-binding steric moieties and methods of using the same
EP2863948B1 (en) 2012-06-22 2018-10-24 Cytomx Therapeutics Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
GB201216649D0 (en) 2012-09-18 2012-10-31 Univ Birmingham Agents and methods
PL3575326T3 (pl) 2012-12-17 2022-07-11 Pf Argentum Ip Holdings Llc Leczenie komórek chorobowych cd47+ z użyciem fuzji sirp alfa-fc
WO2014121093A1 (en) 2013-01-31 2014-08-07 Thomas Jefferson University Fusion proteins that facilitate cancer cell destruction
EP2953633B1 (en) 2013-02-05 2017-10-04 The Board of Trustees of the Leland Stanford Junior University Cd47 targeted therapies for the treatment of infectious disease
AU2014244083B2 (en) 2013-03-13 2018-09-27 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods for modulating chemotherapeutic cytotoxicity
CN112245586A (zh) 2013-03-15 2021-01-22 小利兰·斯坦福大学托管委员会 用于实现治疗有效剂量的抗cd47剂的方法
JP6843611B2 (ja) 2013-04-29 2021-03-17 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー 免疫を強化する抗cd47因子の使用
US9945870B2 (en) 2013-05-17 2018-04-17 The Board Of Trustees Of The Leland Stanford Junior University Methods for determining responsiveness to an anti-CD47 agent
CA2919076C (en) 2013-07-31 2024-01-30 Amgen Inc. Stabilization of fc-containing polypeptides
EP3046627B1 (en) 2013-09-18 2019-10-23 The Board of Trustees of the Leland Stanford Junior University Modulation of efferocytosis pathways for treatment of atherosclerotic disease
TR201901782T4 (tr) 2013-09-23 2019-03-21 Regeneron Pharma İnsanlaştirilmiş bi̇r si̇nyal düzenleyi̇ci̇ protei̇n geni̇ne sahi̇p olan i̇nsan dişi hayvanlar.
NZ718283A (en) 2013-09-25 2022-05-27 Cytomx Therapeutics Inc Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
CN105829349B (zh) 2013-10-15 2023-02-03 斯克利普斯研究所 肽嵌合抗原受体t细胞开关和其用途
US9562073B2 (en) 2014-01-31 2017-02-07 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
CA2942245C (en) 2014-03-12 2021-11-02 Yeda Research And Development Co. Ltd. Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US10519237B2 (en) 2014-03-12 2019-12-31 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of disease and injury of the CNS
US9394365B1 (en) 2014-03-12 2016-07-19 Yeda Research And Development Co., Ltd Reducing systemic regulatory T cell levels or activity for treatment of alzheimer's disease
WO2016023001A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Multispecific high affinity pd-1 agents and methods of use
WO2016022971A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Sirp alpha-antibody fusion proteins
WO2016023040A1 (en) 2014-08-08 2016-02-11 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
PT3177640T (pt) 2014-08-08 2020-08-31 Univ Leland Stanford Junior Agentes pd-1 de alta afinidade e métodos de utilização
PL3180363T3 (pl) 2014-08-15 2020-02-28 Merck Patent Gmbh Białka fuzyjne immunoglobulin sirp-alfa
EP4257145B1 (en) 2014-08-26 2025-06-25 The Board of Trustees of the Leland Stanford Junior University Engraftment of stem cells with a combination of an agent that targets stem cells and modulation of immunoregulatory signaling
US10822411B2 (en) 2014-09-15 2020-11-03 The Board Of Trustees Of The Leland Stanford Junior University Targeting aneurysm disease by modulating phagocytosis pathways
EP3204420B1 (en) 2014-10-10 2020-09-02 The United States of America, as represented by The Secretary, Department of Health and Human Services Methods to eliminate cancer stem cells by targeting cd47
EP3012271A1 (en) 2014-10-24 2016-04-27 Effimune Method and compositions for inducing differentiation of myeloid derived suppressor cell to treat cancer and infectious diseases
CA2959821C (en) 2014-10-24 2024-10-29 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for inducing phagocytosis of MHC class I positive cells and for overcoming resistance to anti-CD47 agents/SIRPA
EP3212670B1 (en) 2014-10-29 2020-12-23 Five Prime Therapeutics, Inc. Combination therapy for cancer
EP3221358B1 (en) 2014-11-18 2021-07-21 Janssen Pharmaceutica, N.V. Cd47 antibodies, methods, and uses
WO2016138306A1 (en) 2015-02-27 2016-09-01 The Board Of Trustees Of The Leland Stanford Junior University Combination therapy for treatment of coronary artery disease
CN106146670B (zh) 2015-04-24 2019-01-15 宜明昂科生物医药技术(上海)有限公司 一种新的重组双功能融合蛋白及其制备和应用
CN114425077A (zh) 2015-05-18 2022-05-03 起源生物医药公司 Sirp多肽组合物和使用方法
EA034582B1 (ru) 2015-08-07 2020-02-21 АЭлЭкс ОНКОЛОДЖИ ИНК. Конструкции варианта sirp-альфа и их применение
AU2016310348B2 (en) 2015-08-26 2023-01-05 The Board Of Trustees Of The Leland Stanford Junior University Enhanced depletion of targeted cells with CD47 blockade and an immune costimulatory agonist
WO2017068164A1 (en) 2015-10-21 2017-04-27 Ose Immunotherapeutics Methods and compositions for modifying macrophage polarization into pro-inflammatory cells to treat cancer
US10613092B2 (en) 2016-04-01 2020-04-07 Agilent Technologies, Inc. Scoring methods for anti-PD therapy eligibility and compositions for performing same
BR112018070823A2 (pt) 2016-04-14 2019-02-05 Ose Immunotherapeutics anticorpo sirpa anti-humano ou fragmento de ligação a antígeno do mesmo ou mimético de anticorpo de ligação a antígeno, composição farmacêutica, produto de combinação, molécula de ácido nucleico isolada, vetor, célula hospedeira isolada, polipeptídeo, métodos para fabricar um anticorpo, in vitro ou ex vivo para determinar células positivas para sirpa, de diagnóstico e para prever a resposta de um sujeito, e, uso de um anticorpo anti-sirpa ou um fragmento de ligação a antígeno do mesmo ou um mimético de ligação a anticorpo e in vitro ou ex vivo de pelo menos um anticorpo sirpa anti-humano ou fragmento de ligação a antígeno do mesmo ou mimético de anticorpo de ligação a antígeno.
AU2017250029C1 (en) 2016-04-15 2022-03-24 Pfizer Inc. Macrophage stimulation in CD47 blockade therapy
CN109862910A (zh) 2016-08-03 2019-06-07 小利兰·斯坦福大学托管委员会 破坏巨噬细胞上的Fc受体接合增强抗SIRPα抗体疗法的功效
JOP20190009A1 (ar) 2016-09-21 2019-01-27 Alx Oncology Inc أجسام مضادة ضد بروتين ألفا منظم للإشارات وطرق استخدامها
CA3038712A1 (en) 2016-10-06 2018-04-12 Genentech, Inc. Therapeutic and diagnostic methods for cancer
CA3042583A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Improvements in cd47 blockade therapy by hdac inhibitors
CA3042581A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Enhancement of cd47 blockade therapy by proteasome inhibitors
AU2017371070B2 (en) 2016-12-09 2025-01-02 Alector Llc Anti-SIRP-alpha antibodies and methods of use thereof
JP7179743B2 (ja) 2017-02-17 2022-11-29 オーエスイー・イミュノセラピューティクス 抗SIRPg抗体の新規の使用
CN110958888A (zh) 2017-03-28 2020-04-03 延龄草治疗公司 Cd47阻断疗法
KR102702926B1 (ko) 2017-04-13 2024-09-06 사이로파 비.브이. 항-sirp 알파 항체
CN118271443A (zh) 2017-05-16 2024-07-02 拜奥迪斯私人有限公司 抗SIRPα抗体
WO2018237168A1 (en) * 2017-06-21 2018-12-27 The Board Of Trustees Of The Leland Stanford Junior University Dosing parameters for cd47 targeting therapies to hematologic malignancies
BR112020001653A2 (pt) 2017-07-26 2020-07-21 Forty Seven, Inc. anticorpos anti-sirp-alfa e métodos relacionados
CN111699005A (zh) 2018-02-12 2020-09-22 四十七公司 使用抗cd47抗体和抗cd20抗体的抗癌方案
US20210347848A1 (en) * 2018-08-31 2021-11-11 ALX Oncology Inc. Decoy polypeptides
CN114126648A (zh) 2019-05-31 2022-03-01 Alx肿瘤生物技术公司 用SIRPα Fc融合体组合免疫检查点抑制剂治疗癌症的方法
US20200400662A1 (en) 2019-06-07 2020-12-24 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
CN121243368A (zh) 2019-11-27 2026-01-02 Alx肿瘤生物技术公司 用于治疗癌症的组合疗法
KR20230018475A (ko) 2020-06-01 2023-02-07 알렉소 온콜로지 인크. 암 치료용 저메틸화제를 포함하는 병용 요법
WO2022010806A1 (en) 2020-07-06 2022-01-13 ALX Oncology Inc. Methods for reducing the interference of drugs that bind therapeutic targets expressed on blood cells in serological assays
US20220196651A1 (en) 2020-12-06 2022-06-23 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
JP2024520902A (ja) 2021-05-13 2024-05-27 エーエルエックス オンコロジー インコーポレイテッド がんを治療するための併用療法
US20240010701A1 (en) 2022-06-01 2024-01-11 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017027422A1 (en) * 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
US10259859B2 (en) * 2015-08-07 2019-04-16 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US10696730B2 (en) * 2015-08-07 2020-06-30 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US11208459B2 (en) * 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
Kauder et al (PLoS ONE, 2018, 13:e0201832, p. 1-33) *
NCT03013218 (History of Changes October 24, 2017) *
Rischin et al (Journal of Clinical Oncology, May 20, 2019, 37; no.15_suppl, abstract # 6000) *
Wu et al (OncoImmunology, 2018, 7:e1397248, p. 1-12) *
Yu et al (Oncotarget, 2015, 6:42067-42080) *

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US11639376B2 (en) 2015-08-07 2023-05-02 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
WO2023079438A1 (en) * 2021-11-08 2023-05-11 Pfizer Inc. Enhancement of cd47 blockade therapy with anti-vegf agents
EP4434999A4 (en) * 2021-11-19 2026-02-11 Hangzhou Sumgen Biotech Co Ltd A VARIANT OF SIRP? AND ITS USAGE
WO2023168384A3 (en) * 2022-03-03 2023-10-12 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16, and her2
WO2023228044A1 (en) * 2022-05-25 2023-11-30 Pfizer Inc. Dosing regimens of sirp alpha fusion proteins for treatment of cancer

Also Published As

Publication number Publication date
JP2025118648A (ja) 2025-08-13
CN114845710A (zh) 2022-08-02
EP4065101A1 (en) 2022-10-05
US20230218719A1 (en) 2023-07-13
US20240075101A1 (en) 2024-03-07
MX2022006078A (es) 2022-08-02
JP2023503943A (ja) 2023-02-01
KR20220107223A (ko) 2022-08-02
IL293199A (en) 2022-07-01
JP7713447B2 (ja) 2025-07-25
CA3162633A1 (en) 2021-06-03
US12527838B2 (en) 2026-01-20
WO2021108693A1 (en) 2021-06-03
BR112022008817A2 (pt) 2022-07-26
AU2020394204A1 (en) 2022-06-02
CN121243368A (zh) 2026-01-02

Similar Documents

Publication Publication Date Title
US12527838B2 (en) Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US11407801B2 (en) SIRP-gamma polypeptide compositions and treatment of cancer
US12098214B2 (en) Combination therapies for treating cancer
US12195529B2 (en) Heterodimeric bispecific antibodies
CA3094098A1 (en) Antibodies against signal-regulatory protein alpha and methods of use
AU2021397271A1 (en) Targeted cytokine construct for engineered cell therapy
CN110799528A (zh) 基于多聚体il-15的分子
TW202306978A (zh) 經工程化的多肽
WO2023215725A1 (en) Compositions and methods for cellular immunotherapy
CN117279633A (zh) 用于治疗癌症的组合疗法
HK1252870B (zh) Sirp多肽组合物和使用方法

Legal Events

Date Code Title Description
AS Assignment

Owner name: ALX ONCOLOGY INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WAN, HONG;SIM, BANG JANET;RANDOLPH, SOPHIA;AND OTHERS;SIGNING DATES FROM 20201210 TO 20201215;REEL/FRAME:054767/0360

STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION