US20170224733A1 - Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System - Google Patents
Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System Download PDFInfo
- Publication number
- US20170224733A1 US20170224733A1 US15/425,773 US201715425773A US2017224733A1 US 20170224733 A1 US20170224733 A1 US 20170224733A1 US 201715425773 A US201715425773 A US 201715425773A US 2017224733 A1 US2017224733 A1 US 2017224733A1
- Authority
- US
- United States
- Prior art keywords
- cells
- tumor
- amino acid
- car
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2086—IL-13 to IL-16
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
- A61K40/4205—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4217—Receptors for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0085—Brain, e.g. brain implants; Spinal cord
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5437—IL-13
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70514—CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/17—Hinge-spacer domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/47—Brain; Nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/49—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- Tumor-specific T cell based immunotherapies including therapies employing engineered T cells and ex vivo expanded or selected T cells, have been investigated for anti-tumor treatment.
- the T cells used in such therapies do not remain active in vivo for a long enough period.
- the tumor-specificity of the T cells is relatively low.
- the engineered T cells have insufficient access to the tumor. Therefore, there is a need in the art for tumor-specific cancer therapies with more effective anti-tumor function.
- MG malignant glioma
- AA-grade III anaplastic astrocytoma
- GBM-grade IV glioblastoma multiforme
- compositions comprising T cells (e.g., CAR T cells, Tumor Infiltrating lymphocytes (“TIL”), TCR-engineered T cells, or T cell clones) to the cerebrospinal fluid (“CSF”) of a patient.
- T cells include T cells that have be manipulated, for example, by introduction of a nucleic acid molecule expressing a desired receptor, by ex vivo expansion of isolated or genetically-modified T cells or by ex vivo selection of a subset of T cells obtained from a patient or a donor or by a combination of two or more of these techniques.
- Administration to the CNS can be accomplished, for example, by administration to the ventricular system or the central cavity of the spinal column.
- Administration to the CNS is distinct from both intratumoral administration (injection or infusion into the tumor itself) and administration to a cavity created by resection of a tumor.
- intratumoral administration injection or infusion into the tumor itself
- administration to a cavity created by resection of a tumor administration to a cavity created by resection of a tumor.
- the CNS administration methods described herein can be combined with intraturmoral and/or post-resection, intracavity administration.
- the CNS administration described herein permits infusion of relatively large volumes of the composition comprising T cells, for example 1 ml-2 ml or more in a single infusion. Thus, several million T cells can be administered in a single infusion.
- a method of treating a patient diagnosed with a malignancy of the central nervous system comprises infusing a composition comprising an effective amount of T cells into an anatomical compartment of a patient diagnosed with a malignancy of the central nervous system, the anatomical compartment containing cerebrospinal fluid (“CSF”).
- the method includes infusion of a composition into a ventricular system or a portion of a central canal of a spinal cord, for example.
- the malignancy of the central nervous system includes a primary tumor or a metastasized tumor found somewhere in the central nervous system, including a portion of the brain, spinal column, or the like.
- the anatomical compartment contains a contiguous volume of at least about 50, 100, or 150 mL of cerebrospinal fluid.
- TCR-engineered T cells are prepared by introduction of TCR ⁇ genes into T cells (e.g., autologous T cells) followed by ex vivo expansion of T cells; and infusion of T cells into the patient.
- the infusion of the TCR-engineered T cells confers tumor reactivity to patients whose tumor expresses the appropriate antigen and HLA restriction element.
- the TCR can be targeted to any of a variety of tumor antigens, including, for example melanoma-associated antigen recognized by T cells 1 (MART-1), glycoprotein (gp) 100, carcinoembryonic antigen (CEA), p53, melanoma-associated antigen (MAGE-A3, and New York esophageal squamous cell carcinoma antigen (NYESO).
- Described herein is a method of treating a patient diagnosed with a malignancy of the central nervous system comprising introducing into the cerebrospinal fluid (CSF) of the patient a composition comprising an effective amount of T cells.
- CSF cerebrospinal fluid
- the T cells are autologous or allogenic T cells; the T cells have been manipulated ex vivo by one or more of: expansion, fractionation or transfection with a recombinant nucleic acid molecule; the T cells comprise cells that have been transfected with a recombinant nucleic acid molecule encoding a polypeptide that binds to a tumor cell antigen; the polypeptide is a chimeric antigen receptor; the composition is administered intraventricularly; the composition is administered to the central canal of the spinal cord; the administration is to the left ventrical or the right ventrical; the composition comprises at least 1 ⁇ 10 6 cells; the composition comprising T cells is administered at least two times; the administrations differ in the total number of T cells administered; the administrations escalate in dose; the administrations de-escalate in dose; the T cells comprise CAR T cells; the T cells comprise autologous tumor infiltrating lymphocytes; the T cells comprise TCR-engineered T cells; the malignancy is a diffuse, in
- the T cells comprise CART cells that target IL13R ⁇ 2 and the cells comprise a nucleic acid molecule encoding a chimeric antigen receptor comprising: human IL-13 or a variant thereof having 1-10 amino acid modifications; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-10 amino acid modifications, and a CD3 ⁇ transmembrane domain or a variant thereof having 1-10 amino acid modifications; at least one costimulatory domain; and CD3 signaling domain of a variant thereof having 1-10 amino acid modifications.
- the costimulatory domain is selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 amino acid modifications, a 4IBB costimulatory domain or a variant thereof having 1-10 amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-10 amino acid modifications;
- the variant of a human IL13 has 1-10 amino acid modification that increase binding specificity for IL13R ⁇ 2 versus IL13R ⁇ 1;
- the human IL-13 or variant thereof is an IL-13 variant comprising the amino acid sequence of SEQ ID NO:3 with 1 to 5 amino acid modifications, provided that the amino acid at position 11 of SEQ ID NO:3 is other than E;
- the chimeric antigen receptor comprises two different costimulatory domains selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 amino acid modifications, a 4IBB costimulatory domain or a variant thereof having 1-10 amino acid modifications and an OX40 costimulatory domain or
- the T cells express a chimeric antigen receptor that binds HER2 comprise a nucleic acid molecule encoding a chimeric antigen receptor comprising: a HER2 targeting sequence; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-5 amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-5 amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-5 amino acid modifications, and a CD3s transmembrane domain or a variant thereof having 1-5 amino acid modifications; a costimulatory domain selected from a CD28 costimulatory domain or a variant thereof having 1-5 amino acid modifications and a 4-IBB costimulatory domain or a variant thereof having 1-5 amino acid modifications; and CD3s signaling domain of a variant thereof having 1-5 amino acid modifications.
- a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-5 amino acid modifications, a CD
- the HER2 targeting domain is a HER2 scFv; the HER2 scFv comprising the amino acid sequence: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKGSTSGGGSGGGSGGGGSSE VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADS VKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS (SEQ ID NO:49) or a variant thereof having 1 to 5 amino acid modifications; the chimeric antigen receptor comprises: a HER2 targeting sequence; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-2 amino acid modifications, a CD8
- Also described herein is a method of treating a patient diagnosed with a malignancy of the central nervous system comprising infusing a composition comprising an effective amount of T cells into an anatomical compartment of a patient diagnosed with a malignancy of the central nervous system, the anatomical compartment containing cerebrospinal fluid (CSF).
- CSF cerebrospinal fluid
- the anatomical compartment comprises a portion of a ventricular system; the anatomical compartment comprises a portion of a central canal of a spinal cord; the malignancy of the central nervous system includes a brain tumor; the malignancy of the central nervous system includes a metastasized tumor; the anatomical compartment contains a contiguous volume of at least about 50 mL of cerebrospinal fluid; the anatomical compartment contains a contiguous volume of at least about 100 mL of cerebrospinal fluid; and the anatomical compartment contains a contiguous volume of at least about 150 mL of cerebrospinal fluid.
- cancers that can be treated by the methods described herein are primary CNS malignancies and secondary malignancies arising from a cancer located elsewhere, for example.
- the malignancy treated according to the disclosed methods comprises a tumor.
- treatment results in at least a 50% reduction in tumor volume, at least a 60% reduction in tumor volume, at least a 70% reduction in tumor volume, at least an 80% reduction in tumor volume, or at least an 90% reduction in tumor volume.
- the treatment results in elimination of the malignancy.
- the patient does not experience any grade 3 or higher toxicity.
- the patient was administered a regimen of steroids prior to treatment with the composition comprising an effective amount of T cells, and in some embodiments the regimen of steroids is reduced to a lower dose following the treatment.
- the patient has an increased life expectancy compared to a patient receiving standard of care treatment, including radiation therapy, small molecule drug therapy, antibody therapeutics, or a combination thereof.
- a patient receiving standard of care treatment including radiation therapy, small molecule drug therapy, antibody therapeutics, or a combination thereof.
- the patient receiving standard of care (“SOC”) treatment can expect to survive about 15 months from initial diagnosis (overall survival or OS)
- the patient receiving the disclosed treatment can expect an OS of 15, 20, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36 months or more.
- the patient receiving the claimed treatment can expect an OS of 42, 48, 54, 60, 66, 72, 78, 84, 90 months or more.
- the composition comprises at least 2 ⁇ 10 6 T cells or 2 ⁇ 10 6 T cells expressing a cell surface receptor targeting a tumor antigen, while in some embodiments, the composition comprises at least 1 ⁇ 10 6 T cells or 1 ⁇ 10 6 T cells expressing a cell surface receptor targeting a tumor antigen. In some embodiments, the composition comprises at least 5 ⁇ 10 6 T cells or 5 ⁇ 10 6 T cells expressing a cell surface receptor targeting a tumor antigen, while in some embodiments, the composition comprises at least 10 ⁇ 10 6 T cells or 10 ⁇ 10 6 T cells expressing a cell surface receptor targeting a tumor antigen.
- the disclosed methods comprised repeated administrations of the compositions, for instance repeating administration of the composition at least five times, repeating administration of the composition at least ten times, or repeating administration until the patient receives a total dose of at least 90 ⁇ 10 6 T cells or T cells expressing a cell surface receptor targeting a tumor antigen.
- the administration is repeated once a week or once every two weeks. In some embodiments, the repeated administrations are continued over the course of 15 weeks.
- Also disclosed herein are methods of increasing a level of at least one cytokine or chemokine in the cerebrospinal fluid (CSF) of a patient comprising, administering a composition comprising an effective amount of T cells into the CSF of a patient with a malignancy of the central nervous system, wherein the level of at least one cytokine or chemokine in the CSF is increased following administration of the composition comprising an effective amount of T cells compared to a baseline level of the at least one cytokine or chemokine prior to the administration.
- CSF cerebrospinal fluid
- the level of the at least one cytokine or chemokine in the CSF following the administration is increased 10-fold or 5-fold compared to the baseline level.
- the level of at least five or at least ten cytokines or chemokines is increased following administration of the composition comprising an effective amount of T cells compared to a baseline level of the at least five cytokines or chemokines prior to the administration.
- the at least one cytokine or chemokine comprises EGF, Eotaxin, FGF, G-CSF, GM-CSF, HGF, IFN- ⁇ , IFN- ⁇ , IL-10, IL-12, IL-13, IL-15, IL-17, IL-1R ⁇ , IL-1 ⁇ , IL-2, IL-2R, IL-4, IL-5, IL-6, IL-7, IL-8, IP-10, MCP-1, MIG, MIP-1 ⁇ , MIP-1 ⁇ , RANTES, TNF- ⁇ , or VEGF.
- the increase in cytokine or chemokine expression is a local increase (i.e., specific to the CSF).
- CSF cerebrospinal fluid
- an effective amount of T cells ranges from about 1 ⁇ 10 6 cells to about 100 ⁇ 10 6 cells, and in some embodiments, an effective amount of T cells ranges from about 2 ⁇ 10 6 cells to about 50 ⁇ 10 6 cells.
- the increased number of T cells observed is sustained for at least about six days, or the number of T cells observed does not return to the baseline number for about seven days.
- the T cells observed include infused T cells (e.g. CAR-expressing T cells), and in some embodiments, the T cells observed include endogenous T cells.
- Also disclosed herein are methods of increasing a number of T cells in the cerebrospinal fluid (CSF) of a patient comprising, administering a composition comprising an effective amount of T cells into the CSF of a patient with a malignancy of the central nervous system, wherein the number of T cells detectable in the CSF is increased compared to pre-administration levels.
- CSF cerebrospinal fluid
- the number of T cells detectable in the CSF is increased compared to pre-administration levels for up to seven days following administration.
- the T cells detectable in the CSF comprise endogenous T cells and CAR-expressing T cells, and/or Type 1 T cells, and/or Type 2 T cells.
- the T cells detectable in the CSF comprise CD3+ T cells, and in some embodiments, the T cells detectable in the CSF comprise CD14+ CD11b+ HLA-DR+ mature myeloid populations. In some embodiments, CD19+ B cells and CD11b+ CD15+ granulocytes are detectable in the CSF following administration of the composition.
- reactive lymphocytes, monocytes, and macrophages are detectable in the CSF following administration of the composition.
- Also disclosed herein are methods of determining the suitability of a patient with a malignancy for treatment with an IL-13R ⁇ 2-specific CAR T cell comprising, determining if a score attributed to a sample from the patient exhibits IL-13R ⁇ 2 expression above a predetermined threshold.
- the score attributed to the sample is calculated by determining the immunoreactivity of a resected tumor sample from a patient diagnosed with a malignancy by immunohistochemically staining the sample with a marker of IL-13R ⁇ 2, analyzing the strength of the staining, and calculating a score based on the strength of the staining, wherein a score that corresponds to moderate to strong staining intensity in the sample indicates that treatment with an IL-13R ⁇ 2-specific CAR T cell is suitable for the patient.
- the score comprises counting the number of cells that have a weak, moderate, or strong staining intensity and assigning each intensity a weight
- the H score a method of quantitating immunohistochemical results, is based on the following formula: (3 ⁇ the percentage of strongly staining cells)+(2 ⁇ the percentage of moderately staining cells)+(1 ⁇ the percentage of weakly staining cells), resulting in a range of 0 to 300).
- the patient has a H score that is: greater that 50, 50-100, greater than 100, 100-200, greater than 200, 100-300, or greater than 250 for the relevant tumor-associated antigen.
- an expression of Ki67 in the sample is also determined by immunohistochemical staining.
- Also disclosed herein are methods of treating a patient with a malignancy comprising, administering to a patient diagnosed with a malignancy a composition comprising an effective dose of IL-13R ⁇ 2-specific CART cells, wherein the patient expresses IL-13R ⁇ 2 above a predetermined threshold.
- the predetermined threshold of IL-13R ⁇ 2 expression was previously identified as being suitable for a treatment comprising IL-13R ⁇ 2-specific CAR T cell therapy.
- TIL are tumor infiltrating lymphocytes that can be isolated from a patient or a donor, expand ex vivo and re-infused into the patient in need thereof.
- CAR T cells express chimeric T cell receptors that comprise an extracellular domain, a transmembrane region and an intracellular signaling domain.
- the extracellular domain includes a portion that binds the targeted cell and, optionally, a spacer, comprising, for example a portion human Fc domain.
- the transmembrane portion includes suitable transmembrane domain, for example, a CD4 transmembrane domain, a CD8 transmembrane domain, a CD28 transmembrane domain, a CD3 transmembrane domain or a 4IBB transmembrane domain.
- the intracellular signaling domain includes the signaling domain from the zeta chain of the human CD3 complex (CD3) and one or more costimulatory domains, e.g., a 4-1BB costimulatory domain.
- the target cell binding portion of extracellular domain (for example a scFv or an ligand) enables the CAR, when expressed on the surface of a T cell, to direct T cell activity to those cells expressing the targeted cell surface molecule, for example HER2 or IL13R ⁇ 2, a receptor expressed on the surface of tumor cells, including malignant glioma cells.
- T cells for example, patient-specific, autologous T cells
- Various T cell subsets can be used.
- CAR can be expressed in other immune cells such as NK cells.
- a patient is treated with an immune cell expressing a CAR or TCR the cell can be an autologous or allogenic T cell.
- the cells used are CD4+ and CD8+ central memory T cells (T CM ), which are CD45RO+CD62L+, and the use of such cells can improve long-term persistence of the cells after adoptive transfer compared to the use of other types of patient-specific T cells.
- the T CM cells can include CD4+ cells and CD8+ cells.
- Such CAR useful in the methods described herein are those that target IL13R ⁇ 2.
- Such CAR can include IL13 having an amino acid modification, such as an E13Y mutation, that increases binding specificity.
- the T cells used in the methods described herein can contain a nucleic acid molecule encoding a chimeric antigen receptor (CAR), wherein the chimeric antigen receptor comprises: human IL-13 or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, and a CD3 ⁇ transmembrane domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications; a costimulatory domain; and CD3 ⁇ signaling domain of a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications.
- CAR chimeric antigen receptor
- the costimulatory domain is selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a 4-IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications.
- a 4IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications is present.
- the CAR expressed by the T cells comprises: a variant of a human IL13 having 1-10 amino acid modification that increase binding specificity for IL13R ⁇ 2 versus IL13R ⁇ 1; the human IL-13 or variant thereof is an IL-13 variant comprising the amino acid sequence of SEQ ID NO:3 with 1 to 5 amino acid modifications, provided that the amino acid at position 11 of SEQ ID NO:3 other than E; two different costimulatory domains selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a 4IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications; two different costimulatory domains selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-2 amino acid modifications, a
- the T cells harbor a nucleic acid molecule that expresses a polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 10 and 31-48;
- the chimeric antigen receptor comprises a IL-13/IgG4/CD4t/41-BB region comprising the amino acid of SEQ ID NO:11 and a CD3 ⁇ signaling domain comprising the amino acid sequence of SEQ ID NO:7; and
- the chimeric antigen receptor comprises the amino acid sequence of SEQ ID NOs: 10 and 31-48.
- Also disclosed are methods comprising intraventricular administration of a population of human T cells transduced by a vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises: human IL-13 or a variant thereof having 1-10 amino acid modifications; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-10 amino acid modifications, and a CD3 ⁇ transmembrane domain or a variant thereof having 1-10 amino acid modifications; a costimulatory domain; and CD3 signaling domain of a variant thereof having 1-10 amino acid modifications.
- the population of human T cells comprise a vector expressing a chimeric antigen receptor comprising an amino acid sequence selected from SEQ ID NOs: 10 and 31-48;
- the population of human T cells are comprises of central memory T cells (T CM cells) (e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least 10%, 15%, 20%, 25%, 30% or 35% of the T cells or the T CM cells are CD4+ and at least 10%, 15%, 20%, 25%, 30% or 35% of the T cells or the T CM cells are CD8+ cells).
- T CM cells central memory T cells
- a method of treating cancer in a patient comprising CNS administration of a population of autologous or allogeneic human T cells (e.g., autologous or allogeneic T cells comprising T CM cells, e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least 15%, 20%, 25%, 30%, 35% of the T CM cells are CD4+ and at least 15%, 20%, 25%, 30%, 35% of the T CM cells are CD8+ cells) transduced by a vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 10 and 31-48.
- a population of autologous or allogeneic human T cells e.g., autologous or allogeneic T cells comprising T CM cells, e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least
- the population of human T cells comprise central memory T cells; the cancer is glioblastoma; and the transduced human T cells where prepared by a method comprising obtaining T cells from the patient, treating the T cells to isolate central memory T cells, and transducing at least a portion of the central memory cells to with a viral vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 10 and 31-48.
- the T cells administered to the patient harbor a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is at least 95% identical to an amino acid sequence selected from and SEQ ID NOs: 10 and 31-48; a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NO: 10 and 31-48 except for the presence of no more than 5 amino acid substitutions, deletions or insertions; a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NO:10 and SEQ ID NOs: 10 and 31-48 except for the presence of no more than 5 amino acid substitutions; and a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NO:10 and SEQ ID NOs: 10 and 31-48 except for the presence of no more than 2 amino acid substitutions.
- chimeric antigen receptor comprises an scFv targeted to HER2 (e.g., comprises the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVP SRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKGSTSGGGSGGGSG GGGSSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPT NGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYW GQGTLVTVSS; SEQ ID NO: 49) or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications; a spacer region
- the costimulatory domain is selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a 4-IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications.
- a 4IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications in present.
- T cells administered to the patient express a CAR that comprises: an scFv targeted to HER2 (e.g., a humanized scFv); two different costimulatory domains selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications, a 4IBB costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-10 (e.g., 1 or 2) amino acid modifications; two different costimulatory domains selected from the group consisting of: a CD28 costimulatory domain or a variant thereof having 1-2 amino acid modifications, a 4IBB costimulatory domain or a variant thereof having 1-2 amino acid modifications and an OX40 costimulatory domain or a variant thereof having 1-2 amino acid modifications; human IL-13 or a variant thereof having 1-2 amino acid modifications; a transmembrane
- the T cells administered the patient harbor a nucleic acid molecule that expresses a polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 53-56.
- Also disclosed are methods comprising intraventricular administration of a population of human T cells transduced by a vector comprising an expression cassette encoding a chimeric antigen receptor comprising: an scFv targeted to HER2; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-10 amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-10 amino acid modifications, and a CD3 ⁇ transmembrane domain or a variant thereof having 1-10 amino acid modifications; a costimulatory domain; and CD3 ⁇ signaling domain of a variant thereof having 1-10 amino acid modifications.
- the population of human T cells comprise a vector expressing a chimeric antigen receptor comprising an amino acid sequence selected from: SEQ ID NOs: 53-56;
- the population of human T cells are comprises of central memory T cells (T CM cells) (e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least 10%, 15%, 20%, 25%, 30%, 35% of the T cells or T CM cells are CD4+ and/or at least 10%, 15%, 20%, 25%, 30%, 35% of the T cells or T CM cells are CD8+ cells).
- T CM cells central memory T cells
- a method of treating cancer in a patient comprising intraventricular administration of a population of autologous or allogeneic human T cells (e.g., autologous or allogenic T cells comprising T CM cells, e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least 15%, 20%, 25%, 30%, 35% of the T CM cells are CD4+ and/or at least 15%, 20%, 25%, 30%, 35% of the T CM cells are CD8+ cells) transduced by a vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 53-56.
- a population of autologous or allogeneic human T cells e.g., autologous or allogenic T cells comprising T CM cells, e.g., at least 20%, 30%, 40%, 50% 60%, 70%, 80% of the cells are T CM cells; at least 15%, 20%,
- the population of human T cells comprise central memory T cells; the cancer is glioblastoma; and the transduced human T cells where prepared by a method comprising obtaining T cells from the patient, treating the T cells to isolate central memory T cells, and transducing at least a portion of the central memory cells to with a viral vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 53-56.
- a method of treating cancer in a patient comprising intraventricular administration of a population of autologous or allogeneic human T cells (e.g., autologous or allogenic T cells comprising T CM cells harboring: a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is at least 95% identical to an amino acid sequence selected from SEQ ID NOs: 53-56; a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NOs: 53-56 except for the presence of no more than 5 amino acid substitutions, deletions or insertions; a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NOs: 53-56 except for the presence of no more than 5 amino acid substitutions; and a nucleic acid molecule encoding an polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NOs:
- Certain CAR described herein for example, the IL13(EQ)BB ⁇ CAR and the IL13(EQ)CD28-BB ⁇ CAR, have certain beneficial characteristics compared to certain other IL13-targeted CAR. For example, they have improved selectivity for IL13R ⁇ , elicit lower Th2 cytokine production, particularly lower IL13 production.
- T cells expressing a CAR targeting IL13R ⁇ 2 can be useful in treatment of cancers such as glioblastoma, as well as other cancers that expresses IL13R ⁇ 2.
- this disclosure includes methods for treating cancer using T cells expressing a CAR described herein.
- T cells expressing a CAR targeting HER2 can be useful in treatment of cancers such as glioblastoma, as well as other cancer that expresses HER2, for example breast cancer that has spread to the central nervous system.
- this disclosure includes methods for treating cancer using T cells expressing a CAR described herein.
- the CAR described herein can include a spacer region located between the targeting domain and the transmembrane domain.
- spacers can be used. Some of them include at least portion of a human Fc region, for example a hinge portion of a human Fc region or a CH3 domain or variants thereof. Table 1 below provides various spacers that can be used in the CARs described herein.
- Some spacer regions include all or part of an immunoglobulin (e.g., IgG1, IgG2, IgG3, IgG4) hinge region, i.e., the sequence that falls between the CH1 and CH2 domains of an immunoglobulin, e.g., an IgG4 Fc hinge or a CD8 hinge.
- Some spacer regions include an immunoglobulin CH3 domain or both a CH3 domain and a CH2 domain.
- the immunoglobulin derived sequences can include one ore more amino acid modifications, for example, 1, 2, 3, 4 or 5 substitutions, e.g., substitutions that reduce off-target binding.
- amino acid modification refers to an amino acid substitution, insertion, and/or deletion in a protein or peptide sequence.
- An “amino acid substitution” or “substitution” refers to replacement of an amino acid at a particular position in a parent peptide or protein sequence with another amino acid.
- a substitution can be made to change an amino acid in the resulting protein in a non-conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping).
- Amino acids with nonpolar R groups Alanine, Valine, Leucine, Isoleucine, Proline, Phenylalanine, Tryptophan, Methionine
- Amino acids with uncharged polar R groups Glycine, Serine, Threonine, Cysteine, Tyrosine, Asparagine, Glutamine
- Amino acids with charged polar R groups negatively charged at pH 6.0: Aspartic acid, Glutamic acid
- Basic amino acids positively charged at pH 6.0
- Lysine, Arginine, Histidine at pH 6.0
- Another grouping may be those amino acids with phenyl groups: Phenylalanine, Tryptophan, and Tyrosine.
- transmembrane domains can be used in CAR expressed by the cells used in the methods described herein.
- Table 2 includes examples of suitable transmembrane domains. Where a spacer region is present, the transmembrane domain is located carboxy terminal to the spacer region.
- CAR expressed by the cells used in the methods described herein include one or more (e.g., two) costimulatory domains.
- the costimulatory domain(s) are located between the transmembrane domain and the CD3 ⁇ signaling domain.
- Table 3 includes examples of suitable costimulatory domains together with the sequence of the CD3 ⁇ signaling domain.
- FIG. 1 is a schematic depiction of IL13(E13Y)-zetakine CAR (Left) composed of the IL13R ⁇ 2-specific human IL-13 variant (huIL-13(E13Y)), human IgG4 Fc spacer (hu ⁇ 4 Fc), human CD4 transmembrane (huCD4 tm), and human CD3 ⁇ chain cytoplasmic (huCD3 ⁇ cyt) portions as indicated.
- IL13(EQ)BB ⁇ CAR which is the same as the IL13(E13Y)-zetakine with the exception of the two point mutations, L235E and N297Q indicated in red, that are located in the CH2 domain of the IgG4 spacer, and the addition of a costimulatory 4-1BB cytoplasmic domain (4-1BB cyt).
- FIGS. 2A-C depict certain vectors and open reading frames.
- A is a diagram of the cDNA open reading frame of the 2670 nucleotide IL13(EQ)BBZ-T2ACD19t construct, where the IL13R ⁇ 2-specific ligand IL13(E13Y), IgG4(EQ) Fc hinge, CD4 transmembrane, 4-1BB cytoplasmic signaling, three-glycine linker, and CD3 cytoplasmic signaling domains of the IL13(EQ)BBZ CAR, as well as the T2A ribosome skip and truncated CD19 sequences are indicated.
- the human GM-CSF receptor alpha and CD19 signal sequences that drive surface expression of the IL13(EQ)BB ⁇ CAR and CD19t are also indicated.
- B is a diagram of the sequences flanked by long terminal repeats (indicated by ‘R’) that will integrate into the host genome.
- C is a map of the IL13(EQ)BBZ-T2A-CD19t_epHIV7 plasmid.
- FIG. 3 depicts the construction of pHIV7.
- FIG. 4 depicts the elements of pHIV7.
- FIG. 5 depicts a production scheme for IL13(EQ)BB ⁇ /CD19t+T CM .
- FIGS. 6A-C depicts the results of flow cytometric analysis of surface transgene and T cell marker expression.
- IL13(EQ)BB ⁇ /CD19t+T CM HD006.5 and HD187.1 were co-stained with anti-IL13-PE and anti-CD8-FITC to detect CD8+ CAR+ and CD4+ (i.e., CD8 negative) CAR+ cells (A), or anti-CD19-PE and anti-CD4-FITC to detect CD4+CD19t+ and CD8+ (i.e., CD4 negative) CAR+ cells (B).
- FIGS. 7A-D depict the results of experiments comparing route of CAR+ T cell delivery (i.c. versus i.v.) for large established tumors.
- EGFP-ffLuc+ PBT030-2 TSs (1 ⁇ 10 5 ) were implanted into the right forebrain of NSG mice.
- mice were injected i.c.
- CD3+ T cells were only detected in the i.c. treated group, with no CD3+ cells detected in the tumor or surrounding brain parenchyma for i.v. treated mice.
- FIGS. 8A-B depict the results of studies showing that CAR+ T cell injected intracranially, either intratumoral (i.c.t.) or intraventricular (i.c.v.), can traffic to tumors on the opposite hemisphere.
- EGFP-ffLuc+ PBT030-2 TSs (1 ⁇ 10 5 ) were stereotactically implanted into the right and left forebrains of NSG mice.
- Schematic of multifocal glioma experimental model A).
- CD3 IHC showing T cells infiltrating both the right and left tumor sites (B).
- FIG. 9 depicts the amino acid sequence of IL13(EQ)BB ⁇ /CD19t+ (SEQ ID NO:10).
- FIG. 10 depicts a sequence comparison of IL13(EQ)41BB ⁇ [IL13 ⁇ EQ ⁇ 41BB ⁇ T2A-CD19t_epHIV7; pF02630] (SEQ ID NO:12) and CD19Rop_epHIV7 (pJ01683) (SEQ ID NO:13).
- FIG. 11 depicts the amino acid sequence of IL13(EmY)-CD8h3-CD8tm2-41BB Zeta (SEQ ID NO:31 with GMCSFRa signal peptide; SEQ ID NO:39 without GMCSFRa signal peptide).
- FIG. 12 depicts the amino acid sequence of IL13(EmY)-CD8h3-CD28tm-CD28gg-41BB-Zeta (SEQ ID NO:32 with GMCSFRa signal peptide; SEQ ID NO:40 without GMSCFRa signal peptide).
- FIG. 13 depicts the amino acid sequence of IL13(EmY)-IgG4(HL-CH3)-CD4tm-41BB-Zeta (SEQ ID NO:33 with GMCSFRa signal peptide; SEQ ID NO:41 without GMCSFRa signal peptide).
- FIG. 14 depicts the amino acid sequence of IL13(EmY)-IgG4(L235E,N297Q)-CD8tm-41BB-Zeta (SEQ ID NO:34 with GMCSFRa signal peptide; SEQ ID NO:42 without GMCSFRa signal peptide).
- FIG. 15 depicts the amino acid sequence of IL13(EmY)-Linker-CD28tm-CD28gg-41BB-Zeta (SEQ ID NO:35 with GMCSFRa signal peptide; SEQ ID NO:43 without GMCSFRa signal peptide).
- FIG. 16 depicts the amino acid sequence of IL13(EmY)-HL-CD28m-CD28gg-41BB-Zeta (SEQ ID NO:36 with GMCSFRa signal peptide; SEQ ID NO:44 without GMSCFRa signal peptide).
- FIG. 17 depicts the amino acid sequence of IL13(EmY)-IgG4(HL-CH3)-CD28tm-CD28gg-41BB-Zeta (SEQ ID NO:37 with GMSCFRa signal peptide; SEQ ID NO:45 without GMCSFRa signal peptide).
- FIG. 18 depicts the amino acid sequence of IL13(EmY) IgG4(L235E,N297Q)-CD28tm-CD28gg-41BB-Zeta (SEQ ID NO:38 with GMCSFRa signal peptide; SEQ ID NO:46 without GMCSFRa signal peptide).
- FIG. 19 depicts the amino acid sequence of IL13(EmY)-CD8h3-CD8tm-41BB Zeta (SEQ ID NO:47 with GMCSFRa signal peptide; SEQ ID NO:48 without GMCSFRa signal peptide).
- FIG. 20 depicts the amino acid sequence of Her2scFv-IgG4(L235E, N297Q)-CD28tm-CD28gg-Zeta-T2A-CD19t.
- the various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining.
- the mature CAR sequence (SEQ ID NO:26) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.
- FIG. 21 depicts the amino acid sequence of Her2scFv-IgG4(L235E,N297Q)-CD8tm-41BB-Zeta-T2A-CD19t.
- the various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining.
- the mature CAR sequence (SEQ ID NO:27) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.
- FIGS. 22A-D depict HER2-specific CAR constructs and CAR T cell expansion data.
- FIGS. 23A-D depict in vitro characterization of HER2-CAR T cells against breast cancer cell lines.
- FIGS. 24A-F depict the result of studies on the in vitro tumor activity of HER2-CAR T cells.
- FIGS. 25A-I depict the result of studies on the in vivo anti-tumor efficacy of local intratumorally-delivered HER2-CAR T cells.
- FIGS. 26A-D depict the results of studies on local delivery of HER2-CAR T cells in human orthotopic BBM xenograft models.
- FIGS. 27A-D depict the results of studies on intraventricular delivery of HER2-CAR T cells.
- FIG. 28 schematically depicts the locations of tumor cell injection and CAR T cell injection for a study of intratumoral and intraventricular injection of CAR T cells targeting IL13 ⁇ 2R in a murine model of glioblastoma.
- FIGS. 29A-C depict the results of studies demonstrating regression of established glioma tumor xenografts after administration of IL13(EQ)BB ⁇ /CD19t+ T CM .
- ffLuc + PBT030-2 tumor cells (1 ⁇ 10 5 ) were stereotactically implanted into the right and left forebrains of NSG mice.
- mice were injected either ict or icv with 1 ⁇ 10 6 IL13(EQ)BB ⁇ + Tcm (1.6 ⁇ 10 6 total cells; 63% CAR+) as described in FIG. 4.1 above.
- A Representative mice from each group showing relative tumor burden using Xenogen Living Image.
- FIG. 30 depicts the results of studies demonstrating that huCD3+ cells are detected in the right and left brain tumors/hemispheres after ict and icv administration of IL13(EQ)BB ⁇ /CD19t+ T CM .
- ffLuc + PBT030-2 tumor cells (1 ⁇ 10 5 ) were stereotactically implanted into the right and left forebrains of NSG mice. On day 6, mice were injected either ict (left images) or icv (right images) with 1 ⁇ 10 6 IL13(EQ)BB ⁇ + Tcm (1.6 ⁇ 10 6 total cells; 63% CAR+).
- mice were euthanized from each group, brains were harvested, embedded in paraffin, and IHC was performed with anti-human CD3 antibody to detect T cells.
- Representative IHC images of the left and right tumor sites from mice of each group (ict: m406 and m410; icy: m414 and m415) are depicted. Inlays depict the xenogen flux images of the mice at the day of euthanasia and brain harvest.
- FIG. 31 schematically depicts the time course of CAR T cell preparation and treatment for a clinical trial of CAR T cells for treatment of glioblastoma (A) and provides several dosing schemes (B).
- FIG. 32 presents analysis of CAR T cell persistence, as monitored by CD19 (A) and presence of GBM cells as monitored by IL13R ⁇ 2 expression (B).
- FIG. 33 presents imaging results from Patient UPN097 in the region of the catheter used for intratumoral administration.
- FIG. 34 is a series of graphs showing the levels of various cytokines during the course of treatment for one patient.
- FIGS. 35A-C are images depicting egression of recurrent multifocal glioblastoma, including spinal metastasis, following intraventricular delivery of IL13R ⁇ 2-targeted CAR T cells.
- a patient presenting with a recurrent multifocal GBM, including one metastatic site in the spine and extensive leptomeningeal disease was treated with six local infusions of IL13BB ⁇ Tcm into the resection cavity of the largest recurrent tumor focus (1 cycle of 2 M, and 5 cycles of 10M CAR+ T cells). While the CAR T cell injection site remained stable without evidence of disease recurrence for over 7-weeks, other disease foci distant from the CAR T cell injection site continued to progress (data not shown).
- This patient then received five weekly intraventricular (icy) infusions of IL13BB ⁇ Tcm (1 cycles of 2 M, and 4 cycles of 10M CAR+ T cells). Shown are MRI and/or PET images of (A) transverse brain section, (B) saggital brain section, and (C) transverse (top) and frontal (bottom) sections of the spine before (left) and one week after (right) completion of i.c.v. therapy, with tumor lesion sites indicated by red arrows in each image.
- icy intraventricular
- FIGS. 36A-B shows treatment regimens with enrollment on NCT02208362 and a compassionate use protocol. Enrollment on NCT02208362 was set at day 0 (A), with initiation of compassionate use protocol on day 107 (B).
- NovoTTF-100A a portable medical device that delivers low intensity, intermediate frequency, alternating electric fields by means of noninvasive, disposable scalp electrodes; FGFR, fibroblast growth factor receptor; MRI, magnetic resonance imaging, all of which was performed on the brain unless otherwise indicated; ICT, intracavitary; PET, positron emission tomography, performed at the indicated sites; ICV, intracerebroventricular.
- FIGS. 37A-C shows immunohistochemistry of primary and recurrent tumors.
- Tumor resected at initial diagnosis (A) and recurrent tumor (T1) resected at time of Rickham placement under NCT02208362 (B, C).
- Immunochemical staining using either IL13R ⁇ 2-specific or Ki67-specific DAB with hematoxylin counterstain are depicted, with red boxes outlining the successive magnified images going left to right.
- FIGS. 38A-B shows tumor lesion identification.
- A Identifying characteristics of GBM lesions T1-T8.
- B Brain MRI scans depicting the sites of T1-T7.
- FIGS. 39A-C shows resected tumor region remains stable, without evidence of disease progression/recurrence following intracavitary delivery of IL13BB ⁇ T CM .
- A Flow cytometry analysis of the IL13BB ⁇ T CM cell product. Top row, transduction with the indicated construct drove coordinate surface expression of the IL13BB ⁇ CAR (detected with anti-IL13) and the CD19t marker (detected with anti-CD19) via the T2A ribosomal skip sequence.
- T cell markers TCR- ⁇ / ⁇ , CD3, CD4 and CD8, as well as the exhaustion markers LAG-3, TIM-3, KLRG1 and PD-1 are depicted in the middle row; staining profiles for the memory markers CD62L, CD45RO, CCR7, CD27, and CD28, as well as the na ⁇ ve T cell marker CD45RA are depicted in the bottom row.
- B Treatment schema under NCT02208362.
- ICT intracavitary
- 6 cycles of ICT cell doses (1 cycle of 2 ⁇ 10 6 , and 5 cycles of 10 ⁇ 10 6 CAR+ cells) were administered with one week rest between cycles 3 and 4.
- C Yellow circles on brain MM scans show the site of resected tumor where catheter was placed (T1), as well as the resected-only tumor sites in the frontal lobe (T2, T3), and the newly arising tumor sites (T6, T7) over the 51-day ICT treatment time period.
- FIGS. 40A-E shows regression of recurrent multifocal glioblastoma, including spinal metastases, following intracerebroventricular delivery of IL13R ⁇ 2-targeted CART cells.
- A Treatment schema under compassionate use protocol. After the patient underwent placement of an intracerebroventricular (ICV) Rickham catheter, 5 cycles of ICV cell doses (1 cycle of 2 ⁇ 10 6 and 4 cycles of 10 ⁇ 10 6 CAR+ cells, indicated as cycles 7 through 11) were administered with one week rest between cycles 9 and 10. Red arrow, site of IL13BB ⁇ T CM delivery.
- ICV intracerebroventricular
- MM and/or PET images of (B) transverse brain sections, (C) saggital brain sections, and (D) transverse (top) and frontal (bottom) sections of the spine before (left) and one week after (right) completion of ICV therapy, with tumor lesion sites indicated by yellow circles in each image.
- E Maximum lesion areas for non-resected tumors T4-T8 depict their respective decreases over time with ICV therapy.
- FIG. 41 shows regression of recurrent multifocal GBM following ICV delivery of IL13R ⁇ 2-targeted CAR T cells. Maximum lesion areas for non-resected tumors T4-T7 are depicted.
- FIG. 42A-C shows analysis of cell infiltrates and cytokines from cerebrospinal fluid (CSF) samples.
- CSF cerebrospinal fluid
- A CSF cellular infiltrate numbers spiked after ICV cycles 9, 10 and 11, with flow cytometric evidence of CD19+ B cells, both CAR+ (i.e., CD19t+) and non-engineered CD3+ T cells, CD11b+ CD15+ granulocytes, and CD11b+ CD14+ HLA-DR+ monocytes.
- B Evaluation of the CD3+ T cell population in the CSF for the presence of gene-modified (i.e., CD19t+) T cells.
- CD3-gated cells from the CSF collected at the indicated day of cycles 9, 10 and 11 were co-stained for CD19 and CD8 (top histograms). Percentages of immunoreactive cells were then used to calculate numbers of total CD3+ T cells and CD19+CD3+(IL13BB ⁇ T CM ) cells per mL of CSF fluid at each time point.
- C Fold change in cytokine levels with ICV treatment cycles 7-11. Only those cytokines from the 30-plex analysis that exhibited a 10-fold or more change compared to pre-treatment levels are depicted.
- a chimeric antigen is a recombinant biomolecule that contains, at a minimum, an extracellular recognition domain, a transmembrane region, and an intracellular signaling domain.
- the term “antigen,” therefore, is not limited to molecules that bind antibodies, but to any molecule that can bind specifically to a target.
- a CAR can include a ligand that specifically binds a cell surface receptor.
- the extracellular recognition domain (also referred to as the extracellular domain or simply by the recognition element which it contains) comprises a recognition element that specifically binds to a molecule present on the cell surface of a target cell.
- the transmembrane region anchors the CAR in the membrane.
- the intracellular signaling domain comprises the signaling domain from the zeta chain of the human CD3 complex and optionally comprises one or more costimulatory signaling domains.
- CARs can both to bind antigen and transduce T cell activation, independent of MHC restriction. Thus, CARs are “universal” immunoreceptors which can treat a population of patients with antigen-positive tumors irrespective of their HLA genotype. Adoptive immunotherapy using T lymphocytes that express a tumor-specific CAR can be a powerful therapeutic strategy for the treatment of cancer.
- the CAR described herein can be produced using a vector in which the CAR open reading frame is followed by a T2A ribosome skip sequence and a truncated CD19 (CD19t), which lacks the cytoplasmic signaling tail (truncated at amino acid 323).
- CD19t truncated CD19
- co-expression of CD19t provides an inert, non-immunogenic surface marker that allows for accurate measurement of gene modified cells, and enables positive selection of gene-modified cells, as well as efficient cell tracking and/or imaging of the therapeutic T cells in vivo following adoptive transfer.
- Co-expression of CD19t provides a marker for immunological targeting of the transduced cells in vivo using clinically available antibodies and/or immunotoxin reagents to selectively delete the therapeutic cells, and thereby functioning as a suicide switch.
- a patient receiving an infusion, administration, or injection of CAR T cells may receive a single dose comprising between 1 ⁇ 10 6 and 15 ⁇ 10 6 cells.
- a single dose for use in the disclosed methods can comprise 1 ⁇ 10 6 , 2 ⁇ 10 6 , 3 ⁇ 10 6 , 4 ⁇ 10 6 , 5 ⁇ 10 6 , 6 ⁇ 10 6 , 7 ⁇ 10 6 , 8 ⁇ 10 6 , 9 ⁇ 10 6 , 10 ⁇ 10 6 , 11 ⁇ 10 6 , 12 ⁇ 10 6 , 13 ⁇ 10 6 , 14 ⁇ 10 6 , or 15 ⁇ 10 6 cells.
- a patient may receive a cumulative or total dose of cells between 20 ⁇ 10 6 and 150 ⁇ 10 6 T cells.
- the patient may receive about 20 ⁇ 10 6 , about 25 ⁇ 10 6 , about 30 ⁇ 10 6 , about 35 ⁇ 10 6 , about 40 ⁇ 10 6 , about 45 ⁇ 10 6 , about 50 ⁇ 10 6 , about 55 ⁇ 10 6 , about 60 ⁇ 10 6 , about 65 ⁇ 10 6 , about 70 ⁇ 10 6 , about 75 ⁇ 10 6 , about 80 ⁇ 10 6 , about 85 ⁇ 10 6 , about 90 ⁇ 10 6 , about 95 ⁇ 10 6 , about 100 ⁇ 10 6 , about 105 ⁇ 10 6 , about 110 ⁇ 10 6 , about 115 ⁇ 10 6 , about 120 ⁇ 10 6 , about 125 ⁇ 10 6 , about 130 ⁇ 10 6 , about 135 ⁇ 10 6 , about 140 ⁇ 10 6 , about 145 ⁇ 10 6 , or about 150 ⁇ 10 6 or more T cells over the course of treatment.
- a patient can receive a
- the disclosed methods can comprise an infusion, administration, or injection once a day, once every two days, once every three days, once every four days, once every five days, once every six days, a week, once every two weeks, once every three weeks, once every four weeks, once a month, once every other month, once every three months, or once every six months.
- the disclosed methods can comprise continuous infusion, for instance, from a wearable pump.
- the total time course of treatment may be about 5 weeks, about 10 weeks, about 15 weeks, about 20 weeks, about 25 weeks, about 30 weeks, about 35 weeks, about 40 weeks, about 45 weeks, about 50 weeks, about 55 weeks, about 60 weeks, about 65 weeks, about 70 weeks, about 75 weeks, or more.
- the patient may receive 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more infusions, administrations, or injections of T cells over the course of treatment according to the disclosed methods.
- a patient can receive 11 infusions of T cells over the course of 15 weeks.
- Treating cancer, and more specifically gliomas like glioblastoma, according to the disclosed methods can result in numerous therapeutic effects.
- treatment with the disclosed CAR T cells can result in an increase in the level of cytokines and chemokines in the CSF of a patient being treated according to the disclosed methods.
- Cytokine and/or chemokine expression may increase by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100%, or cytokine and/or chemokine expression may increase by at least 1-fold, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, or at least 10-fold compared to baseline levels, as measured prior to treatment with a composition comprising CAR T cells. This increase in expression may be observed for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 or more cytokines or chemokines.
- the expression of at least one of EGF, Eotaxin, FGF, G-CSF, GM-CSF, HGF, IFN- ⁇ , IFN- ⁇ , IL-10, IL-12, IL-13, IL-15, IL-17, IL-1R ⁇ , IL-1 ⁇ , IL-2, IL-2R, IL-4, IL-5, IL-6, IL-7, IL-8, IP-10, MCP-1, MIG, MIP-1 ⁇ , MIP-1 ⁇ , RANTES, TNF- ⁇ , and VEGF may increase as a result of treatment with CAR T cells as disclosed herein.
- the increase in cytokine and/or chemokine expression may be local (i.e. the increase is only observable in the CNS and CFS, while serum levels of cytokines and chemokines remain unchanged.
- Treatment according to the disclosed methods may also result in an increase in T cells detectable in the CSF. While at least some of the T cells detectable in the CSF following treatment will likely be CAR-expressing T cells, there may also be an increase in endogenous T cells that are recruited to the CSF. Although not wanting to be bound by theory, the increase in endogenous T cells may be a result of the recruitment of Type 1 and Type 2 T helper cells due to the increase in local cytokine levels. Additionally, the detectable T cells can comprise CD3+ T cells, as well as CD14+ CD11b+ HLA-DR+ mature myeloid populations, CD19+ B cells and CD11b+CD15+ granulocytes, and/or reactive lymphocytes, monocytes, and macrophages.
- the increase in the number of T cells in the CSF may be detectable for a specific period of time following treatment according to the disclosed methods.
- a detectable increase in T cells in the CSF may persist or be sustained for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 or more days following administration of a composition comprising T cells.
- an increase in the number of T cells observed in the CSF may not return to baseline levels (i.e. the number of T cells detectable prior to treatment) for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 days.
- the number of T cells detectable in the CSF may increase by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100%, or by at least 1-fold, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 11-fold, at least 12-fold, at least 13-fold, at least 14-fold, or at least 15-fold compared to baseline levels, as measured prior to treatment with a composition comprising CAR T cells.
- FIG. 31 The time course of CAR T cell preparation and treatment is depicted in FIG. 31 .
- research participants underwent resection of their tumor(s) followed by placement of a Rickham catheter and baseline imaging.
- Patient UPN097 underwent tumor resection and was treated in Cycle 1 with 2 ⁇ 10 6 cells and in Cycle 2 with 10 ⁇ 10 6 cells. In both Cycle 1 and Cycle 2 the cells were administered to the cavity left by resection. After the second cycle Patient UPN097 was taken off the study due to rapid tumor progression.
- Patient UPN109 was treated in Cycle 1 with 2 ⁇ 10 6 cells and in Cycles 2 and 3 with 10 ⁇ 10 6 cells. After a rest period, Patient UPN109 was treated in Cycles 4, 5 and 6 with 10 ⁇ 10 6 cells. In Cycles 1-6 the cells were administered intratumorally. In Cycle 7 the patient was treated with 2 ⁇ 10 6 cells. In Cycles 8 and 9 the patient was treated with 10 ⁇ 10 6 cells. In Cycles 7-10 the administration was intraventricular.
- intraventricular refers to the space inside the ventricular system, specifically the cerebral ventricles. Accordingly, the term “intraventricular” and “intracerebroventricular” may be used interchangeably throughout this disclosure. Accordingly, “intraventricular administration” or “intraventricular injection” refer to delivery of a composition into the ventricals of the brain (i.e. the cerebral ventricles).
- the cerebral ventricles are a series of interconnected, fluid-filled spaces that lie in the core of the forebrain and brainstem. This system comprises four ventricles: the right and left lateral ventricles (one of which is found in each hemisphere of the brain), the third ventricle, and the fourth ventricle.
- the disclosed methods comprise various routes of administering the compositions comprising T cells.
- the disclosed compositions may be delivered or administered intraventricularly.
- the disclosed compositions may be delivered or administered into the spinal canal (i.e. intrathecal delivery).
- the disclosed compositions may be delivered or administered into the epidural space of the spinal cord (i.e. epidural delivery).
- the disclosed compositions may be delivered or administered directly into a tumor (i.e. intratumoral delivery).
- the disclosed compositions may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e. intracavity delivery).
- the disclosed methods can comprise a combination of the aforementioned routes of administration. For instance, a patient may receive at least one dose of the composition comprising T cells via intracavity delivery, followed by at least one dose of the composition via intraventricular delivery.
- FIG. 32A presents analysis of CAR T cell persistence, as monitored by CD19. This analysis shows good T cell persistence 8 days after the Cycle 2.
- FIG. 32B shows decreased presence of GBM cells as monitored by IL13R ⁇ 2 expression.
- FIG. 33A and FIG. 33B depict imaging results from Patient UPN097 in the region of the catheter used for intratumoral administration.
- FIG. 33A one can see that few CD3+ or CD8+ T cells are present pretreatment.
- FIG. 33B which is a sample at Day 16 post-treatment taken from the left frontal tumor cavity wall shows a large area of necrotic tumor and significant presence of CD3+ and CD8+ cells.
- Gliomas express IL13 receptors, and in particular, high-affinity IL13 receptors.
- IL13 receptors unlike the IL13 receptor, glioma cells overexpress a unique IL13R ⁇ 2 chain capable of binding IL13 independently of the requirement for IL4R ⁇ or ⁇ c44.
- IL13 has pleotropic immunoregulatory activity outside the CNS. Both IL13 and IL4 stimulate IgE production by B lymphocytes and suppress pro-inflammatory cytokine production by macrophages.
- Detailed studies using autoradiography with radiolabeled IL13 have demonstrated abundant IL13 binding on nearly all malignant glioma tissues studied. This binding is highly homogeneous within tumor sections and in single cell analysis.
- IL13R ⁇ 2 is a very specific cell-surface target for glioma and is a suitable target for a CAR designed for treatment of a glioma.
- Certain patients may be more suitable than others to receive the disclosed methods of treatment. For instance, those patients with malignancies that highly express IL-13R ⁇ 2 may particularly benefit from treatment with the disclosed CAR T-cells.
- Suitability of a patient can be determined by staining a resected tumor sample from a patient to determine the amount of expression of IL-13R ⁇ 2. The sample may be scored based on the number of cells exhibiting weak, moderate, or strong staining intensity. Determining the expression level of Ki67 may also be beneficial for determining the aggressiveness of the disease. Once it has been determined that a patient is well suited to receive the disclosed CAR T cells, the patient may be treated according to the disclosed methods.
- Binding of IL13-based therapeutic molecules to the broadly expressed IL13R ⁇ 1/IL4 ⁇ / ⁇ c receptor complex has the potential of mediating undesired toxicities to normal tissues outside the CNS, and thus limits the systemic administration of these agents.
- An amino acid substitution in the IL13 alpha helix A at amino acid 13 of tyrosine for the native glutamic acid selectively reduces the affinity of IL13 to the IL13R ⁇ 1/IL4 ⁇ / ⁇ c receptor. Binding of this mutant (termed IL13(E13Y)) to IL13R ⁇ 2, however, was increased relative to wild-type IL13.
- this minimally altered IL13 analog simultaneously increases IL13's specificity and affinity for glioma cells.
- CAR described herein include an IL13 containing a mutation (E to Y or E to some other amino acid such as K or R or L or V) at amino acid 13 (according to the numbering of Debinski et al. 1999 Clin Cancer Res 5:3143s).
- IL13 having the natural sequence also may be used, however, and can be useful, particularly in situations where the modified T cells are to be locally administered, such as by injection directly into a tumor mass.
- gliomas are known to have a generally poor patient prognosis.
- GBM glioblastoma multiforme
- the 1-year and 2-year relative survival rates for GBM are 29.6% and 9.0%, respectively. Only 3.4% of patients with a GBM diagnosis survive more than 5 years.
- Current conventional treatments include, but are not limited to, radiation therapy, small molecules (e.g. temozolomide, irinotecan, imatinib mesylate, erlotinib, and hydroxyurea), and biologics such as antibodies (e.g. bevacizumab).
- the disclosed methods of treatment improve clinical prognosis in patients compared to current standards. For instance, the disclosed methods can increase 1-year, 2-year, and 5-year survival rates.
- the 1-year survival rate of a patient being treated according to the disclosed methods can at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100%.
- the 2-year survival rate of a patient being treated according to the disclosed methods can at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100%.
- the 5-year survival rate of a patient being treated according to the disclosed methods can at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100%.
- the disclosed methods also increase the life expectancy of a patient compared to another patient receiving conventional treatments or SOC treatment, including radiation therapy, small molecule drug therapy, therapeutic biologics like therapeutic antibodies, or a combination thereof.
- the patient receiving SOC treatment in which the patient receiving SOC treatment can expect to survive about 15 months from initial diagnosis (overall survival or OS), the patient receiving the disclosed treatment can expect an OS of 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36 months or more.
- the patient receiving the claimed treatment can expect an OS of 42, 48, 54, 60, 66, 72, 78, 84, 90 months or more.
- the disclosed methods may improve a patient's prognosis through a variety of clinical outcomes. For instance, the disclosed methods can result in a reduction in tumor volume in a patient being treated with a composition comprising T cells. In some embodiments, the disclosed methods of treatment can result in at least a 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or at least 100% reduction in tumor volume. In some embodiments, the tumors in a patient may be completely eliminated and the patient can be cured of the malignancy.
- the disclosed methods are safe and well-tolerated. Patients being treated according to the disclosed methods may not experience significant side effects, and furthermore, may be able to discontinue taking auxiliary medications. For instance, in some embodiments, the disclosed methods will not result in any grade 3 or higher toxicities according to NCI Common Toxicity Criteria (CTC).
- CTC NCI Common Toxicity Criteria
- the CTC provides a quantifiable scale of 0-5, with 0 meaning no adverse event, 1 meaning mild, 2 meaning moderate, 3 meaning sever and undesirable, 4 meaning life threatening or disabling, and 5 meaning death.
- side effects and or toxicities may include events like mild or moderate headaches, fatigue, myalgia, and minor nervous system disorders such as olfactory aura, but high grade toxicities will be avoided.
- Steroids like dexamethasone are commonly used in the clinical management of gliomas to prevent neurological side effects like brain edema.
- the disclosed methods of treatment can decrease the need for such auxiliary treatments. For instance, if a patient is receiving a regimen of steroids (e.g. dexamethasone) prior to treatment according to the disclosed methods, the patient may be able to reduce the dose of the steroid regimen or discontinue the steroid regimen altogether without experiencing clinically deleterious effects.
- steroids e.g. dexamethasone
- Brain metastases of breast cancer can express HER2.
- Certain of the CAR described herein that are useful in treatment of malignant glioma are targeted to HER2.
- the CAR described herein can be produced by any means known in the art, though preferably they are produced using recombinant DNA techniques.
- Nucleic acids encoding the several regions of the chimeric receptor can be prepared and assembled into a complete coding sequence by standard techniques of molecular cloning known in the art (genomic library screening, PCR, primer-assisted ligation, site-directed mutagenesis, etc.) as is convenient.
- the resulting coding region is preferably inserted into an expression vector and used to transform a suitable expression host cell line, preferably a T lymphocyte cell line, and most preferably an autologous T lymphocyte cell line.
- Various T cell subsets isolated from the patient can be transduced with a vector for CAR expression.
- Central memory T cells are one useful T cell subset.
- Central memory T cell can be isolated from peripheral blood mononuclear cells (PBMC) by selecting for CD45RO+/CD62L+ cells, using, for example, the CliniMACS® device to immunomagnetically select cells expressing the desired receptors.
- PBMC peripheral blood mononuclear cells
- the cells enriched for central memory T cells can be activated with anti-CD3/CD28, transduced with, for example, a SIN lentiviral vector that directs the expression of the CAR as well as a truncated human CD19 (CD19t), a non-immunogenic surface marker for both in vivo detection and potential ex vivo selection.
- the activated/genetically modified central memory T cells can be expanded in vitro with IL-2/IL-15 and then cryopreserved.
- Example 1 Construction and Structure of an IL13R ⁇ 2-Specific CAR
- the codon optimized CAR sequence contains a membrane-tethered IL-13 ligand mutated at a single site (E13Y) to reduce potential binding to IL13R ⁇ 1, an IgG4 Fc spacer containing two mutations (L235E; N297Q) that greatly reduce Fc receptor-mediated recognition models, a CD4 transmembrane domain, a costimulatory 4-1BB cytoplasmic signaling domain, and a CD3 ⁇ cytoplasmic signaling domain.
- a T2A ribosome skip sequence separates this IL13(EQ)BB ⁇ CAR sequence from CD19t, an inert, non-immunogenic cell surface detection/selection marker.
- FIG. 1A is a schematic drawing of the 2670 nucleotide open reading frame encoding the IL13(EQ)BBZ-T2ACD19t construct.
- the IL13R ⁇ 2-specific ligand IL13(E13Y), IgG4(EQ) Fc, CD4 transmembrane, 4-1BB cytoplasmic signaling, three-glycine linker, and CD3 ⁇ cytoplasmic signaling domains of the IL13(EQ)BBZ CAR, as well as the T2A ribosome skip and truncated CD19 sequences are all indicated.
- the IL13(EQ)BBZ-T2ACD19t construct includes a IL13R ⁇ 2-specific, hinge-optimized, costimulatory chimeric immunoreceptor sequence (designated IL13(EQ)BBZ), a ribosome-skip T2A sequence, and a CD19t sequence.
- the IL13(EQ)BBZ sequence was generated by fusion of the human GM-CSF receptor alpha leader peptide with IL13(E13Y) ligand 5 L235E/N297Q-modified IgG4 Fc hinge (where the double mutation interferes with FcR recognition), CD4 transmembrane, 4-1BB cytoplasmic signaling domain, and CD3 ⁇ cytoplasmic signaling domain sequences. This sequence was synthesized de novo after codon optimization.
- the T2A sequence was obtained from digestion of a T2A-containing plasmid.
- the CD19t sequence was obtained from that spanning the leader peptide sequence to the transmembrane components (i.e., basepairs 1-972) of a CD19-containing plasmid. All three fragments, 1) IL13(EQ)BBZ, 2) T2A, and 3) CD19t, were cloned into the multiple cloning site of the epHIV7 lentiviral vector. When transfected into appropriate cells, the vector integrates the sequence depicted schematically in FIG. 1B into the host cells genome.
- FIG. 1C provides a schematic drawing of the 9515 basepair IL13(EQ)BBZ-T2A-CD19t_epHIV7 plasmid itself.
- IL13(EQ)BBZ CAR differs in several important respects from a previously described IL13R ⁇ 2-specific CAR referred to as IL13(E13Y)-zetakine (Brown et al. 2012 Clinical Cancer Research 18:2199).
- the IL13(E13Y)-zetakine is composed of the IL13R ⁇ 2-specific human IL-13 mutein (huIL-13(E13Y)), human IgG4 Fc spacer (hu ⁇ 4 Fc), human CD4 transmembrane (huCD4 tm), and human CD3 ⁇ chain cytoplasmic (huCD3 ⁇ cyt) portions as indicated.
- the IL13(EQ)BB ⁇ ) has two point mutations, L235E and N297Q that are located in the CH2 domain of the IgG4 spacer, and a costimulatory 4-1BB cytoplasmic domain (4-1BB cyt).
- Example 2 Construction and Structure of epHIV7 Used for Expression of an IL13R ⁇ 2-Specific CAR
- the pHIV7 plasmid is the parent plasmid from which the clinical vector IL13(EQ)BBZ-T2A-CD19t_epHIV7 was derived in the T cell Therapeutics Research Laboratory (TCTRL) at City of Hope (COH).
- TTRL T cell Therapeutics Research Laboratory
- COH City of Hope
- the epHIV7 vector used for expression of the CAR was produced from pHIV7 vector.
- this vector uses the human EF1 promoter to drive expression of the CAR.
- Both the 5′ and 3′ sequences of the vector were derived from pv653RSN as previously derived from the HXBc2 provirus.
- the polypurine tract DNA flap sequences (cPPT) were derived from HIV-1 strain pNL4-3 from the NIH AIDS Reagent Repository.
- the woodchuck post-transcriptional regulatory element (WPRE) sequence was previously described.
- pHIV7 is schematically depicted in FIG. 3 .
- pv653RSN containing 653 bp from gag-pol plus 5′ and 3′ long-terminal repeats (LTRs) with an intervening SL3-neomycin phosphotransferase gene (Neo) was subcloned into pBluescript, as follows: In Step 1, the sequences from 5′ LTR to rev-responsive element (RRE) made p5′HIV-1 51, and then the 5′ LTR was modified by removing sequences upstream of the TATA box, and ligated first to a CMV enhancer and then to the SV40 origin of replication (p5′HIV-2).
- RRE rev-responsive element
- Step 2 after cloning the 3′ LTR into pBluescript to make p3′HIV-1, a 400-bp deletion in the 3′ LTR enhancer/promoter was made to remove cis-regulatory elements in HIV U3 and form p3′HIV-2.
- Step 3 fragments isolated from the p5′HIV-3 and p3′HIV-2 were ligated to make pHIV-3.
- Step 4 the p3′HIV-2 was further modified by removing extra upstream HIV sequences to generate p3′HIV-3 and a 600-bp BamHI-SalI fragment containing WPRE was added to p3′HIV-3 to make the p3′HIV-4.
- Step 5 the pHIV-3 RRE was reduced in size by PCR and ligated to a 5′ fragment from pHIV-3 (not shown) and to the p3′HIV-4, to make pHIV-6.
- Step 6 a 190-bp BglII-BamHI fragment containing the cPPT DNA flap sequence from HIV-1 pNL4-3 (55) was amplified from pNL4-3 and placed between the RRE and the WPRE sequences in pHIV6 to make pHIV-7.
- This parent plasmid pHIV7-GFP (GFP, green fluorescent protein) was used to package the parent vector using a four-plasmid system.
- a packaging signal, psi ⁇ , is required for efficient packaging of viral genome into the vector.
- the RRE and WPRE enhance the RNA transcript transport and expression of the transgene.
- the flap sequence, in combination with WPRE, has been demonstrated to enhance the transduction efficiency of lentiviral vector in mammalian cells.
- helper functions required for production of the viral vector
- the helper functions are divided into three separate plasmids to reduce the probability of generation of replication competent lentivirus via recombination: 1) pCgp encodes the gag/pol protein required for viral vector assembly; 2) pCMV-Rev2 encodes the Rev protein, which acts on the RRE sequence to assist in the transportation of the viral genome for efficient packaging; and 3) pCMV-G encodes the glycoprotein of the vesiculo-stomatitis virus (VSV), which is required for infectivity of the viral vector.
- VSV vesiculo-stomatitis virus
- the regions of homology include a packaging signal region of approximately 600 nucleotides, located in the gag/pol sequence of the pCgp helper plasmid; a CMV promoter sequence in all three helper plasmids; and a RRE sequence in the helper plasmid pCgp. It is highly improbable that replication competent recombinant virus could be generated due to the homology in these regions, as it would require multiple recombination events. Additionally, any resulting recombinants would be missing the functional LTR and tat sequences required for lentiviral replication.
- the CMV promoter was replaced by the EF1 ⁇ -HTLV promoter (EF1p), and the new plasmid was named epHIV7 ( FIG. 4 ).
- the EF1p has 563 bp and was introduced into epHIV7 using NruI and NheI, after the CMV promoter was excised.
- the IL13(EQ)BBZ-T2ACD19t_epHIV7 vector construct does not contain an intact 3′LTR promoter, so the resulting expressed and reverse transcribed DNA proviral genome in targeted cells will have inactive LTRs.
- no HIV-I derived sequences will be transcribed from the provirus and only the therapeutic sequences will be expressed from their respective promoters.
- the removal of the LTR promoter activity in the SIN vector is expected to significantly reduce the possibility of unintentional activation of host genes.
- Table 4 summarizes the various regulator elements present in IL13(EQ)BBZ-T2ACD19t_epHIV7.
- a seed bank is generated, which is used to inoculate the fermenter to produce sufficient quantities of plasmid DNA.
- the plasmid DNA is tested for identity, sterility and endotoxin prior to its use in producing lentiviral vector.
- cells were expanded from the 293T working cell (WCB), which has been tested to confirm sterility and the absence of viral contamination.
- a vial of 293T cells from the 293T WCB was thawed.
- Cells were grown and expanded until sufficient numbers of cells existed to plate an appropriate number of 10 layer cell factories (CFs) for vector production and cell train maintenance. A single train of cells can be used for production.
- CFs layer cell factories
- the lentiviral vector was produced in sub-batches of up to 10 CFs. Two sub-batches can be produced in the same week leading to the production of approximately 20 L of lentiviral supernatant/week. The material produced from all sub-batches were pooled during the downstream processing phase, in order to produce one lot of product.
- 293T cells were plated in CFs in 293T medium (DMEM with 10% FBS). Factories were placed in a 37° C. incubator and horizontally leveled in order to get an even distribution of the cells on all the layers of the CF.
- the initial tangential flow ultrafiltration (TFF) concentration of the endonuclease-treated supernatant was used to remove residual low molecular weight components from the crude supernatant, while concentrating the virus ⁇ 20 fold.
- the clarified endonuclease-treated viral supernatant was circulated through a hollow fiber cartridge with a NMWCO of 500 kD at a flow rate designed to maintain the shear rate at ⁇ 4,000 sec-1 or less, while maximizing the flux rate.
- Diafiltration of the nuclease-treated supernatant was initiated during the concentration process to sustain the cartridge performance.
- An 80% permeate replacement rate was established, using 4% lactose in PBS as the diafiltration buffer.
- the viral supernatant was brought to the target volume, representing a 20-fold concentration of the crude supernatant, and the diafiltration was continued for 4 additional exchange volumes, with the permeate replacement rate at 100%.
- T lymphocytes are obtained from a patient by leukopheresis, and the appropriate allogenic or autologous T cell subset, for example, Central Memory T cells (T CM ), are genetically altered to express the CAR, then administered back to the patient by any clinically acceptable means, to achieve anti-cancer therapy.
- T CM Central Memory T cells
- Suitable T CM can be prepared as follows. Apheresis products obtained from consented research participants are ficolled, washed and incubated overnight. Cells are then depleted of monocyte, regulatory T cell and na ⁇ ve T cell populations using GMP grade anti-CD14, anti-CD25 and anti-CD45RA reagents (Miltenyi Biotec) and the CliniMACSTM separation device. Following depletion, negative fraction cells are enriched for CD62L+ T CM cells using DREG56-biotin (COH clinical grade) and anti-biotin microbeads (Miltenyi Biotec) on the CliniMACSTM separation device.
- DREG56-biotin COH clinical grade
- anti-biotin microbeads Miltenyi Biotec
- T CM cells are formulated in complete X-Vivo15 plus 50 IU/mL IL-2 and 0.5 ng/mL IL-15 and transferred to a Teflon cell culture bag, where they are stimulated with Dynal ClinExTM Vivo CD3/CD28 beads. Up to five days after stimulation, cells are transduced with IL13(EQ)BBZ-T2A-CD19t_epHIV7 lentiviral vector at a multiplicity of infection (MOI) of 1.0 to 0.3.
- MOI multiplicity of infection
- Cultures are maintained for up to 42 days with addition of complete X-Vivo15 and IL-2 and IL-15 cytokine as required for cell expansion (keeping cell density between 3 ⁇ 10 5 and 2 ⁇ 10 6 viable cells/mL, and cytokine supplementation every Monday, Wednesday and Friday of culture). Cells typically expand to approximately 10 9 cells under these conditions within 21 days. At the end of the culture period cells are harvested, washed twice and formulated in clinical grade cryopreservation medium (Cryostore CS5, BioLife Solutions).
- cryopreserved and released product On the day(s) of T cell infusion, the cryopreserved and released product is thawed, washed and formulated for re-infusion.
- the cryopreserved vials containing the released cell product are removed from liquid nitrogen storage, thawed, cooled and washed with a PBS/2% human serum albumin (HSA) Wash Buffer. After centrifugation, the supernatant is removed and the cells resuspended in a Preservative-Free Normal Saline (PFNS)/2% HSA infusion diluent. Samples are removed for quality control testing.
- PFNS Preservative-Free Normal Saline
- HSA Preservative-Free Normal Saline
- FIGS. 6A-C depict the results of flow cytometric analysis of surface transgene and T cell marker expression.
- IL13(EQ)BB ⁇ /CD19t+ T CM HD006.5 and HD187.1 were co-stained with anti-IL13-PE and anti-CD8-FITC to detect CD8+ CAR+ and CD4+ (i.e., CD8 negative) CAR+ cells ( FIG. 6A ), or anti-CD19-PE and anti-CD4-FITC to detect CD4+ CD19t+ and CD8+ (i.e., CD4 negative) CAR+ cells ( FIG. 6B ).
- IL13(EQ)BB ⁇ /CD19t+ T CM HD006.5 and HD187.1 were stained with fluorochrome-conjugated anti-CD3, TCR, CD4, CD8, CD62L and CD28 (grey histograms) or isotype controls (black histograms).
- FIG. 6C In each of FIGS. 6A-C , the percentages indicated are based on viable lymphocytes (DAPI negative) stained above isotype.
- PBT030-2 engrafted mice were treated with either two i.v. infusions (5 ⁇ 10 6 CAR+ T CM ; days 19 and 26) or four i.c. infusions (1 ⁇ 10 6 CAR+ T CM ; days 19, 22, 26 and 29) of IL13(EQ)BBZ+ T CM , or mock T CM (no CAR).
- two i.v. infusions 5 ⁇ 10 6 CAR+ T CM ; days 19 and 26
- four i.c. infusions (1 ⁇ 10 6 CAR+ T CM ; days 19, 22, 26 and 29) of IL13(EQ)BBZ+ T CM , or mock T CM (no CAR).
- IL13(EQ)BBZ+ T CM IL13(EQ)BBZ+ T CM
- mock T CM mock T CM
- FIGS. 7A-B brains from a cohort of mice 7 days post T cell injection were harvested and evaluated for CD3+ human T cells by IHC.
- mice treated i.v. with either mock T CM or IL13(EQ)BB ⁇ T CM there were no detectable CD3+ human T cells in the tumor or in others mouse brain regions where human T cells typically reside (i.e. the leptomeninges) ( FIG. 7C ), suggesting a deficit in tumor tropism. This is in contrast to the significant number of T cells detected in the i.c. treated mice ( FIG. 7D ).
- Tumor derived cytokines are important in recruiting T cells to the tumor.
- PBT030-2 tumor cells were evaluated and it was found that this line produces high levels of MCP-1/CCL2 comparable to U251T cells (data not shown), a glioma line previously shown to attract i.v. administered effector CD8+ T cells to i.c. engrafted tumors.
- Malignant gliomas are highly invasive tumors and are often multi-focal in presentation.
- the studies described above establish that IL13BBZ T CM can eliminate infiltrated tumors such as PBT030-2, and mediate long-term durable antitumor activity.
- the complete amino acid sequence of IL13(EQ)BB ⁇ /CD19t is depicted in FIG. 9 .
- the entire sequence (SEQ ID NO:1) includes: a 22 amino acid GMCSF signal peptide (SEQ ID NO:2), a 112 amino acid IL-13 sequence (SEQ ID NO:3; amino acid substitution E13Y shown in bold); a 229 amino acid IgG4 sequence (SEQ ID NO:4; with amino acid substitutions L235E and N297Q shown in bold); a 22 amino acid CD4 transmembrane sequence (SEQ ID NO:5); a 42 amino acid 4-1BB sequence (SEQ ID NO:6); a 3 amino acid Gly linker; a 112 amino acid CD3 ⁇ sequence (SEQ ID NO:7); a 24 amino acid T2A sequence (SEQ ID NO:8); and a 323 amino acid CD19t sequence (SEQ ID NO:9).
- the mature chimeric antigen receptor sequence includes: a 112 amino acid IL-13 sequence (SEQ ID NO:3; amino acid substitution E13Y shown in bold); a 229 amino acid IgG4 sequence (SEQ ID NO:4; with amino acid substitutions L235E and N297Q shown in bold); at 22 amino acid CD4 sequence (SEQ ID NO:5); a 42 amino acid 4-1BB sequence (SEQ ID NO:6); a 3 amino acid Gly linker; and a 112 amino acid CD3 ⁇ sequence (SEQ ID NO:7).
- IL-13/IgG4/CD4t/41-BB sequence SEQ ID NO:11
- SEQ ID NO:11 which includes: a 112 amino acid IL-13 sequence (SEQ ID NO:3; amino acid substitution E13Y shown in bold); a 229 amino acid IgG4 sequence (SEQ ID NO:4; with amino acid substitutions L235E and N297Q shown in bold); at 22 amino acid CD4 sequence (SEQ ID NO:5); and a 42 amino acid 4-1BB sequence (SEQ ID NO:6).
- the IL13/IgG4/CD4t/4-1BB sequence (SEQ ID NO:11) can be joined to the 112 amino acid CD3 ⁇ sequence (SEQ ID NO:7) by a linker such as a Gly Gly Gly linker.
- the CAR sequence (SEQ ID NO:10) can be preceded by a 22 amino acid GMCSF signal peptide (SEQ ID NO:2).
- FIG. 10 depicts a comparison of the sequences of IL13(EQ)41BB ⁇ [IL13 ⁇ EQ ⁇ 41BB ⁇ T2A-CD19t_epHIV7; pF02630] (SEQ ID NO:12) and CD19Rop_epHIV7 (pJ01683) (SEQ ID NO:13).
- FIGS. 11-18 depict the amino acid sequences of additional CAR directed against IL13R ⁇ 2.
- the various domains are labelled except for the GlyGlyGly spacer located between certain intracellular domains.
- Each includes human IL13 with and Glu to Tyr (SEQ ID NO:3; amino acid substitution E13Y shown in highlighted).
- the amino acid sequence expressed can include a 24 amino acid T2A sequence (SEQ ID NO:8); and a 323 amino acid CD19t sequence (SEQ ID NO:9) to permit coordinated expression of a truncated CD19 sequence on the surface of CAR-expressing cells.
- a panel of CAR comprising human IL13(E13Y) domain, a CD28 tm domain, a CD28gg costimulatory domain, a 4-1BB costimulatory domain, and a CD3 ⁇ domain CAR backbone and including either a HL (22 amino acids) spacer, a CD8 hinge (48 amino acids) spacer, IgG4-HL-CH3 (129 amino acids) spacer or a IgG4(EQ) (229 amino acids) spacer were tested for their ability to mediate IL13R ⁇ 2-specific killing as evaluated in a 72-hour co-culture assay. With the exception of HL (22 amino acids) which appeared to have poor CAR expression in this system, all were active.
- Her2scFv-IgG4(L235E, N297Q)-CD28tm-CD28gg-Zeta-T2A-CD19t is referred to as Her2scFv-IgG4(L235E, N297Q)-CD28tm-CD28gg-Zeta-T2A-CD19t.
- This CAR includes a variety of important features including: a scFv targeted to HER2; an IgG4 Fc region that is mutated at two sites within the CH2 region (L235E; N297Q) in a manner that reduces binding by Fc receptors (FcRs); a CD28 transmembrane domain, a CD28 co-stimulatory domain, and CD3 ⁇ activation domain.
- the immature CAR includes: GMCSFR signal peptide, HER2 scFv, IgG4 that acts as a spacer, a CD8 transmembrane domain, a 4-IBB co-stimulatory domain that includes a LL to GG sequence alteration, a three Gly sequence, CD3 Zeta stimulatory domain.
- the transcript also encodes a T2A ribosomal sequence and a truncated CD19 sequence that are not part of the CAR protein sequence.
- the mature CAR is identical to the immature CAR, but lacks the GMCSF signal peptide.
- FIG. 22A is a schematic diagram of two the HER2-specific CAR constructs depicted in FIG. 20 and FIG. 21 .
- HER2(EQ)28 ⁇ the scFv is tethered to the membrane by a modified IgG4 Fc linker (double mutant, L235E; N297Q), containing a CD28 transmembrane domain, an intracellular CD28 co-stimulatory domain and a cytolytic CD3 ⁇ domain.
- the T2A skip sequence separates the CAR from a truncated CD19 (CD19t) protein employed for cell tracking.
- HER2(EQ)BB ⁇ is similar except that the costimulatory domain is 4-1BB rather than CD28 and the transmembrane domain is a CD8 transmembrane domain rather than a CD28 transmembrane domain.
- Human central memory (TCM) cells were transfected with a lentiviral vector expressing either HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ .
- FIG. 22B depicts representative FACS data of human TCM surface phenotype.
- FIG. 22C depicts the results of assays for CD19 and Protein L expression in TCM transfected with a lentiviral vector expressing either HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ .
- FIG. 23A depicts the HER2 expression level of each of these lines.
- FIG. 23B Flow cytometry (gated on CAR+ T cells) was used to characterize CD107a degranulation and IFN ⁇ production in Mock (untransduced), HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ CAR T cells following a 5 hr co-culture with either MDA-MB-361 tumor cells (low HER2 expressing) or BBM1 tumor cells (high HER2 expressing).
- FIG. 23C Similar studies were conducted with the other breast cancer cells lines, and the results are summarized in FIG. 23C . Production of IFN ⁇ production by HER2-CAR T cells following a 24 hr culture with recombinant HER2 protein or tumor targets was measured by ELISA and the results of this analysis are shown in FIG. 23D .
- FIG. 24A Flow cytometry was used to assess tumor cell killing following a 72 h co-culture of Mock (untransduced), HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ CAR T cells with tumor targets.
- the results of this analysis are presented in FIG. 24A .
- PD-1 and LAG-3 induction in total CAR T cells after a 72 h co-culture with HER2-negative MDA-MB-468 or HER2-positive BBM1 cells was measured, and the results of this analysis are presented in FIG. 24B .
- PD-1 induction in CD8+ CAR T cells following a 72 h co-culture with tumor targets that are HER2-negative (LCL lymphoma, MDA-MB-468, U87 glioma), low-HER2 expressing (MDA-MB-361, 231BR) or high-HER2 expressing (SKBR3, BT474, BBM1) was measured, and the results of this analysis are presented in FIG. 24C .
- HER2(EQ)BB ⁇ causes lower PD-1 induction that does HER2(EQ)28 ⁇ .
- Tumor cell killing with Effector:Tumor (E:T) ratio ranging from 0.25:1 to 2:1 was measured for both HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ CAR T cells.
- FIG. 24D shows that both HER2(EQ)28 ⁇ and HER2(EQ)BB ⁇ are effective in tumor cell killing in vitro.
- CFSE proliferation of HER2-CAR T cells following a 72 h co-culture with MDA-MB-468 or BBM1 cells was measured by flow cytometry.
- FIG. 24E shows that HER2(EQ)BB ⁇ CAR T cells proliferate more than HER2(EQ)28 ⁇ CAR T cells.
- FIGS. 25A-25C are H&E staining of tumors. Mice were treating by injection directly into the tumor with Mock (untransduced) or HER2(EQ)BB ⁇ CAR T cells.
- BBM1 cells 0.2M or BT474 (0.15M) were intracranially injected in NSG mice.
- HER2(EQ)28 ⁇ or HER2(EQ)BB ⁇ , or Mock (untransduced) T cells (1M) were injected intratumorally.
- BBM1 ( FIG. 26A ) and BT474 ( FIG. 26B ) tumors were monitored by luciferase-based optical imaging. Kaplan Meier curves are presented in FIG. 26C and FIG. 26D .
- FIG. 27A illustrates the region of tumor implantation by stereotactic injection of BBM1 cells (0.2M), and intraventricular T cell delivery. Staining of tumors is depicted in FIG. 27B .
- HER2(EQ)28 ⁇ , HER2(EQ)BB ⁇ , or Mock (unstransduced) T cells (0.5M) were injected intratumorally. Tumor growth was monitored by luciferase-based optical imaging.
- FIG. 27C presents the flux averages for each treatment group, and FIG. 27D presents the Kaplan Meier survival curve for each treatment group.
- Example 14 Comparison of Intracranial and Intratumoral Administration of T CM Expressing a CAR Targeted to IL13R ⁇ 2
- ic intracranial
- ict intratumoral
- icy intraventricular
- mice that had been enriched from PBMC by CliniMACSTM/AutoMACS selection were lenti-transduced with IL13(EQ)BBZ-T2A-CD19t_epHIV7 lentivirus, expanded and then cryopreserved using methods similar to that described above.
- mice were observed daily for overall health, including body weight and alertness. Tumor burden, as measured by Xenogen imaging, was examined; and immunohistochemistry (IHC) to detect T cell recruitment/infiltration of the tumors was also performed on a subset of mice.
- IHC immunohistochemistry
- mice from each group were euthanized, their brains harvested, embedded in paraffin and immunohistochemistry (IHC) was performed to evaluate the presence of human CD3-expressing cells (i.e., human T cells).
- IHC immunohistochemistry
- mice While this was not a survival study, and thus mice were all euthanized at specific time points to evaluate T cell trafficking in the brains (described below), the mice were monitored daily for any obvious signs of distress or general toxicity. Mice treated with either the ict or icv regimen did not exhibit any weight loss, and were bright, alert and reactive throughout the experiment. Thus, regardless of the route of T cell administration, there were no signs of any therapy-associated adverse effects.
- ict delivery of IL13(EQ)BB ⁇ /CD19t+T CM exhibited robust anti-tumor activity against the PBT030-2 tumors as expected.
- icv delivery of IL13(EQ)BB ⁇ /CD19t+ T CM appeared to provide greater therapeutic benefit against is engrafted PBT030-2 tumors than that observed with ict administration, especially against the tumor lesion in the contralateral (left) hemisphere.
- CD3+ T cells were found at both the left and right tumor sites in mice that had received either ict or icv administered T cells. These data are representative of 3 mice in each group at one week, and 2 mice in each group at two weeks post T cell administration.
- Example 15 Phase 1 Clinical Trial Evaluating IL-13R ⁇ 2 CAR T Cells for Treatment of Glioblastoma
- This example describes the initial findings of a clinical trial evaluating the safety, feasibility and bioactivity of weekly intracranial infusions of autologous IL13BB ⁇ Tcm in patients with recurrent IL13R ⁇ 2+ GBM.
- Enrolled patients undergo leukapheresis to collect autologous PBMC and, concurrent with IL13BB ⁇ + Tcm manufacturing, tumor biopsy or resection is performed, with placement of a reservoir/catheter device.
- patients are treated on a 4-week therapeutic regimen, consisting of 3-weekly intracranial infusions of IL13BB ⁇ + Tcm followed by one rest week for toxicity and disease assessment.
- This patient was initially treated per protocol with six local infusions of IL13BB ⁇ Tcm into the resection cavity of the largest recurrent tumor focus in the posterior temporal-occipital region. Encouragingly, this CAR T cell injection site remained stable without evidence of disease recurrence for over 7-weeks, while other disease foci distant from the CAR T cell injection site continued to progress.
- This patient was then treated on a compassionate use protocol with five weekly intraventricular infusions of IL13BB ⁇ Tcm without any other therapeutic interventions.
- One week following the final intraventricular CAR T cell infusion all intracranial and spinal tumors had regressed with most decreasing more than 75% by volume, and this patient remained clinically stable four months following the start of CAR T cell treatment.
- the CAR, IL13(EQ)BB ⁇ , used in this study is described above.
- the sequence of the immature CAR, including the CD19t marker is depicted in FIG. 9 .
- the entire immature sequence includes: a 22 amino acid GMCSF signal peptide (SEQ ID NO:2), a 112 amino acid IL-13 sequence (SEQ ID NO:3; amino acid substitution E13Y shown in bold); a 229 amino acid IgG4 sequence (SEQ ID NO:4; with amino acid substitutions L235E and N297Q shown in bold); a 22 amino acid CD4 transmembrane sequence (SEQ ID NO:5); a 42 amino acid 4-1BB sequence (SEQ ID NO:6); a 3 amino acid Gly linker; a 112 amino acid CD3 ⁇ sequence (SEQ ID NO:7); a 24 amino acid T2A sequence (SEQ ID NO:8); and a 323 amino acid CD19t sequence (SEQ ID NO:9).
- T CM were enriched from peripheral blood mononuclear cells (PBMC) using the CliniMACS® device to immunomagnetically select for CD45RO+/CD62L+ T CM .
- PBMC peripheral blood mononuclear cells
- CliniMACS® device to immunomagnetically select for CD45RO+/CD62L+ T CM .
- These cells were activated with anti-CD3/CD28 Dynal beads, transduced with a SIN lentiviral vector that directs the expression of the IL13(EQ)BB ⁇ CAR.
- the activated/genetically modified IL13(EQ)BB ⁇ /CD19t+ T CM cells were expanded in vitro with IL-2/IL-15 and then cryopreserved.
- CAR T cells were performed manually over about 5-10 minutes through a Rickham catheter followed by up to 1.0 mL preservative-free normal-saline (PFNS) flush delivered by convection enhanced delivery (CED) at 0.5 ml/hour.
- PFNS preservative-free normal-saline
- CED convection enhanced delivery
- Intraventricular administration of CAR T cells was performed manually over approximately 5-10 minutes through a Rickham catheter placed into the lateral ventricle. This was followed by up to 0.5 mL preservative-free normal-saline (PFNS) flush delivered via a manual push technique over 5-10 minutes.
- PFNS flush is meant to clear the administration line and push remaining CAR T cells through the catheter.
- FIG. 31 The time course of CAR T cell preparation and treatment is depicted in FIG. 31 .
- research participants underwent resection of their tumor(s) followed by placement of a Rickham catheter and baseline imaging.
- Patient UPN097 underwent tumor resection and was treated in Cycle 1 with 2 ⁇ 10 6 cells and in Cycle 2 with 10 ⁇ 10 6 cells. In both Cycle 1 and Cycle 2 the cells were administered to the cavity left by resection. After the second cycle Patient UPN097 was taken off the study due to rapid tumor progression.
- Patient UPN109 was treated in Cycle 1 with 2 ⁇ 10 6 cells and in Cycles 2 and 3 with 10 ⁇ 10 6 cells. After a rest period, Patient UPN109 was treated in Cycles 4, 5 and 6 with 10 ⁇ 10 6 cells. In Cycles 1-6 the cells were administered into. In Cycle 7 the patient was treated with 2 ⁇ 10 6 cells. In Cycles 8 and 9 the patient was treated with 10 ⁇ 10 6 cells. In Cycles 7-10 the administration was intraventricular.
- FIG. 32A presents analysis of CAR T cell persistence, as monitored by CD19. This analysis shows good T cell persistence 8 days after the Cycle 2.
- FIG. 32B shows decreased presence of GBM cells as monitored by IL13R ⁇ 2 expression on cells.
- FIG. 33A and FIG. 33B depict imaging results from Patient UPN097 in the region of the catheter used for intratumoral administration.
- FIG. 33A one can see that few CD3+ or CD8+ T cells are present pretreatment.
- FIG. 33B which is a sample at Day 16 post-treatment taken from the left frontal tumor cavity wall shows a large area of necrotic tumor and significant presence of CD3+ and CD8+ cells.
- FIGS. 34A-D there was an increase in IFN-gamma (a Th1 cytokine) over the two Cycles of treatment while levels of IL-13 (a Th2 cytokine did not change significantly ( FIG. 34A and FIG. 34B ).
- IL-6 a tumor related cytokine, decreased during Cycle 1 and remained at the lower level during Cycle 2 ( FIG. 34C ).
- IL-8 another tumor related cytokine, decreased during Cycle 1, but increased towards its pre-Cycle 1 level during Cycle 2 ( FIG. 34D ).
- FIGS. 35A-B presents MM and/or PET images of transverse brain section ( FIG. 35A ) and saggital brain section ( FIG. 35B ).
- FIG. 35C presents transverse (top) and frontal (bottom) sections of the spine before (left) and one week after (right) completion of intraventricular therapy, with tumor lesion sites indicated by red arrows in each image.
- a 50 year old male was initially diagnosed with a low-grade brain tumor in the right temporal lobe after presenting with grand mal seizures. After four months of monitoring, this right temporal tumor displayed increased enhancement by MRI, and the patient underwent tumor resection which confirmed a diagnosis of WHO grade IV glioma (GBM). The patient then received standard-of-care adjuvant proton radiation to a total dose of 59.4 cobalt Gy equivalent with concurrent temozolomide (140 mg daily), followed by 4-cycles of temozolomide with concomitant use of the Novocure device (NovoTTF-100A) for three months. Six months after the primary tumor resection, PET and MRI images showed evidence of disease progression.
- IL13R ⁇ 2-targeted CAR T cells FIG. 36
- IHC intracranial pressure
- FIG. 37 Peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- NCT01975701 fibroblastic growth factor inhibitor
- the patient was treated on a separate clinical protocol evaluating a fibroblastic growth factor inhibitor (NCT01975701), and progressed through therapy with symptoms of headaches, confusion and disorientation increasing. Additionally, the patient was tapered off steroids prior to T cell injections.
- This patient was treated starting with a low dose of 2 ⁇ 10 6 CAR+ T cells followed by five infusions of 10 ⁇ 10 6 CAR+ T cells ( FIG. 39 ).
- a second catheter was placed in the right lateral ventricle, allowing the patient to receive an additional five intracerebroventricular (ICV) treatment cycles of IL13BB ⁇ TCM, again starting at a low dose of 2 ⁇ 10 6 CAR T cells followed by four infusions of 10 ⁇ 10 6 CAR T cells ( FIG. 40 ).
- ICV intracerebroventricular
- the patient received 11 cell infusions for a total dose of 94 ⁇ 10 6 CAR+ T cells.
- the treatment course encompassed 15-weeks, with evaluation weeks for toxicity and disease assessment (i.e., MM and PET imaging) taking place after every third cycle, and after the final two ICV infusions.
- the patient received no other therapeutic interventions during this CAR T cell treatment course, and findings up to the 190 day evaluation period, encompassing the 11 infusions cycles, is reported here.
- a second IL13BB ⁇ TCM product was manufactured and beginning on day 192 this patient has continued to receive ICV infusions of this second manufactured product approximately every 3 weeks.
- Example 18 Cell Product Manufacture and Infusion
- the lentiviral vector encoding the 4-1BB costimulatory, IL13R ⁇ 2-targeted CAR, IL13BB ⁇ is detailed herein.
- the codon optimized CAR sequence contains a membrane-tethered human IL-13 ligand mutated at a single site (E13Y) to reduce potential binding to IL13R ⁇ 1, a human IgG4 Fc spacer containing two mutations (L235E; N297Q) that prevent Fc receptor-mediated recognition, a human CD4 transmembrane domain, a human costimulatory 4-1BB cytoplasmic signaling domain, and a human CD3 ⁇ cytoplasmic signaling domain.
- a T2A ribosome skip sequence then separates this IL13BB ⁇ CAR sequence from a truncated human CD19 sequence (CD19t), an inert, nonimmunogenic cell surface marker.
- PBMC peripheral blood mononuclear cells
- X Vivo15 media Bio Whittaker
- FCS fetal calf serum
- CliniMACSTM PBS/EDTA buffer Miltenyi Biotec
- HSA human serum albumin
- CSL Behring clinical grade biotinylated-DREG56 mAb
- CD62L+ fraction (TCM) was purified with positive selection on CliniMACSTM according to the manufacturer's instructions, and resuspended in X Vivo15 containing 10% FCS.
- TCM TCM were stimulated with GMP Dynabeads® Human T expander CD3/CD28 (Invitrogen) at a 1:3 ratio (T cell:bead), and transduced with clinical grade IL13BB ⁇ -T2A-CD19t_epHIV7 at an MOI of 0.3 in 5.5 mL X Vivo15 containing 10% FCS with 5 ⁇ g/mL protamine sulfate (APP Pharmaceutical), 50 U/mL rhIL-2 and 0.5 ng/mL rhIL-15 in a 32 Vuelife tissue culture bag (AFC) that was placed at a horizontal position on a culture rack at 37° C., 5% CO2.
- GMP Dynabeads® Human T expander CD3/CD28 Invitrogen
- IL13BB ⁇ -T2A-CD19t_epHIV7 MOI of 0.3 in 5.5 mL X Vivo15 containing 10% FCS with 5 ⁇ g/mL protamine sulf
- T cells were transferred to 730 Vuelife bags (AFC). Seven days after the lentiviral transduction, the CD3/CD28 Dynabeads were removed using the Dynal ClinEx Vivo Magnetic Particle Concentrator bag magnet, and bead-free T cells were drained into a new 730 Vuelife bag.
- the T2A ribosome skip sequence 12 then separates this IL13BB ⁇ sequence from CD19t, an inert, nonimmunogenic cell surface marker marking cell transduction ( FIG. 39A ).
- This T2A linkage results in the coordinate expression of both IL13BB ⁇ and CD19t from a single transcript.
- TCM central memory T cells
- EOP end-of-process
- IL13BB ⁇ TCM product underwent quality control release testing as per the clinical protocol.
- T cells were thawed, washed and reformulated into a final volume of 0.5 mL in pharmaceutical preservative-free normal saline (PFNS) with 2% human serum albumin (HSA).
- PFNS pharmaceutical preservative-free normal saline
- HSA human serum albumin
- Cells were manually injected into the Rickham reservoir using a 21 gauge butterfly needle to deliver a 0.5 mL volume over 5-10 minutes, followed by up to 1 mL PFNS flush delivered by convection enhanced delivery (CED) at 0.5 mL per hour.
- CED convection enhanced delivery
- the post-gadolinium T1 weighted MRI sequences of the brain and spine were acquired on a Siemens Viro 3 Tesla scanner. Lesions were measured on axial T1 MPR weighted images obtained after the administration of Multihance. Imaging with 18-F-fluorodeoxyglucose (18-F-FDG) was performed using a GE Discovery DST HP60 PET-CT scanner (70 cm axial field of view, slice thickness 3.75 mm). Maximal standardized uptake values (SUVs) were obtained utilizing Vital Images Vitrea version 6.7.2 software. Regions of contrast-enhancing tumor foci were outlined by a radiologist for measurements of largest tumor area (mm2) and tumor volumes (cm3) were computed.
- Cryopreserved cell banks of quality control released autologous IL13BB ⁇ TCM were thawed and reformulated for infusion by washing twice with phosphate buffered saline (PBS) with 2% HSA and resuspending in pharmaceutical preservative-free normal saline with 2% HSA.
- Delivery of the therapeutic CAR T cells into either the glioma resection cavity (ICT) or the lateral ventricle (ICV) was achieved using a HolterTM Rickham Ventriculostomy Reservoir (Codman), with a ventricular catheter (Integra Pudenz), and a stylet.
- the reservoir/catheter system was inserted at the time of tumor resection, and the tip of the catheter was partially embedded into the resection wall in order to allow for cell delivery both into the cavity and into the peritumoral brain tissue.
- Post-operative imaging CT and MRI were obtained to confirm catheter position and extent of tumor resection.
- Example 20 IL13BB ⁇ TCM Display a Central Memory-Like T Cell Phenotype
- Enriched TCM (36 ⁇ 10 6 ) were ex vivo stimulated, lentivirally transduced and expanded to yield 638 ⁇ 10 6 total cells in 17 days.
- the final T cell product (CD3+ and TCR+) consisted of CD4 (74%) and CD8 (16%) T cell subsets and expressed IL13BB ⁇ and CD19t with gene modified co-staining for both cell surface proteins ( FIG. 39A ).
- the CAR T cell product exhibited a central memory T cell phenotype, expressing CD45RO (97%), CD62L (57%), CCR7 (28%), CD28 (97%) and CD27 (59%) ( FIG. 39A ).
- the product also expressed of some markers of exhaustion, including TIM-3 (65%) and LAG-3 (49%), but not significant levels of PD-1 and KLRG1 ( FIG. 39A ).
- the patient was treated with weekly infusions of IL13BB ⁇ TCM administered via a reservoir/catheter device through two different intracranial delivery routes, that being intracavitary (ICT) delivery following tumor resection (cycles 1-6) and intracerebroventricular (ICV) delivery into the cerebral spinal fluid (CSF) (cycles 7-11).
- ICT intracavitary
- ICV intracerebroventricular
- CSF cerebral spinal fluid
- the 11 intracranial infusions at a maximum cell dose of 10 ⁇ 10 6 CAR+ T cells, were well-tolerated with no grade 3 or higher toxicity (NCI Common Toxicity Criteria) with possible or higher attribution to the therapy observed. Mild events noted following CAR T cell infusions include.
- the patient's tumor displayed characteristics of a highly aggressive recurrent GBM with poor prognostic features. This included evidence of recurrence from primary diagnosis within six months following standard-of-care therapy, the presentation of multifocal tumor lesions, including spinal lesions and extensive leptomeningeal disease ( FIG. 38 ), histological features of a dedifferentiated GBM, and a high tumor proliferation rate with over 60% of the cells staining positive for Ki67 ( FIG. 37B ). Tumor expression of IL13R ⁇ 2, as evaluated by IHC on FFPE of resected tumor tissue, was similar between the primary and recurrent tumors with an H score of 100 and 80, respectively ( FIG. 37 ).
- Intratumoral IL13R ⁇ 2 expression for the recurrent tumor was heterogeneous, with 10% of the cells showing high staining intensity (2-3+), 60% showing low expression (1+), and 30% of the cells not staining above background (0+).
- the highest levels of IL13R ⁇ 2 expression were often observed in tumor regions of pseudopalisading necrosis ( FIG. 37A ), an expression pattern noted for other GBM tumors.
- this patient Following enrollment on the clinical protocol, this patient underwent surgical resection for three of the five recurrent lesions ( FIG. 38 ), and the reservoir/catheter device was place in the resected cavity of the largest recurrent foci (T1) in the right posterior temporal-occipital area.
- This patient was initially treated per protocol with six weekly intracavitary (ICT) infusions of CAR+ T cells (2 ⁇ 10 6 cycle 1; 10 ⁇ 10 6 cycles 2-6) ( FIG. 1B ), and during this time period the temporal-occipital tumor lesion (T1) remained stable for over 45-days post-surgery without evidence of progressive disease ( FIG. 39C ).
- ICT intracavitary
- CSF was evaluated for cell infiltrates, CAR+ T cell persistence, and cytokine levels.
- ICV infusion i.e., day 1-2 of cycles 6-11
- cell numbers per mL of CSF increased 7.0 ⁇ 3.6 fold as compared to pre-infusion levels (day 0 of each cycle), and increased 153 ⁇ 128 fold as compared to pre-ICV (C7D0) levels ( FIG. 42 ).
- Total cell numbers in the CSF typically decreased over the 7-day treatment cycle.
- the cell infiltrates included a large proportion of CD3+ T cells, both endogenous and CAR-expressing, as well as CD14+CD11b+ HLA-DR+ mature myeloid populations ( FIG. 42A ). Only rare CD19+ B cells and CD11b+CD15+ granulocytes were detected ( FIG. 42A ). Consistent with flow cytometry data, CSF cytopathology on C11D1 reported the presence of reactive lymphocytes, monocytes, and macrophages.
- CAR-T persistence was also monitored over the ICV treatment course. Due to low cell recovery in the CSF for cycles 7 and 8, analysis focused on evaluating cycle 9 and time points immediately following cycles 10 and 11. Importantly, CAR+ T cells were detected at all-time points evaluated ( FIG. 42B ), including C9D0 which corresponded to 7-days post cycle 8, thus demonstrating persistence of the therapeutic cells for at least 7 to 8 days post-infusion. However, CAR T numbers in the CSF post infusion decreased at the later cycles (C10D1 and C11D1) when tumor burden had also significantly decreased ( FIG. 40B ).
- C9D2 CAR+ cell numbers increasing 1.6-fold 2 days later (C9D2) from pre-infusion (C9D0) and then decreasing 2.3-fold by day 8 (C9D8).
- cytokine levels in the CSF corresponded to significant elevations of cytokine levels in the CSF.
- the measured levels and calculated fold-change over baseline for the 30-cytokines measured is presented in Tables 9 and 10 below.
- 11 cytokines increased more than 10-fold from pre-ICV baseline (C7D0) immediately following IL3BB ⁇ T CM infusions, including cytokines IFN ⁇ , TNF, IL-2, IL-10, IL-5, IL-6, and IL-8 and chemokines CXCL9/MIG, CXCL10/IP-10, and CCR2/MCP-1 and soluble cytokine receptor IL-1R ⁇ ( FIG. 3C ).
- cytokines showed greater than a 5-fold increase from baseline (C7D0), including G-CSF, IL-12, IL2-R, IL-4, IL-7, and MIP-lb.
- the inflammatory cytokines that exhibited the highest fold increase immediately following IL3BB ⁇ T CM infusion as compared to pre-ICV (C7D0) was IL-2 (>90-fold for C9D2) and the IFN- ⁇ inducible chemokines CXCL9 and CXCL10 (>40-fold for C8D1, C9D2, C10D1 and C11D2). These cytokines returned to near baseline levels within 7-days between treatment cycles. Cytokines that did not show significant increase following CAR T cell infusions include IL-13, RANTES and VEGF (Tables 9 and 10).
- Example 24 Patient Sample Processing and Analysis
- Tumor resection material was collected through the COH department of Pathology according to the clinical protocol.
- IL13R ⁇ 2 immunohistochemistry was performed on 5 ⁇ m-sections of formalin-fixed paraffin-embedded specimens as previously described, and Ki67 IHC was similarly performed with the exception of antigen retrieval by heating @ pH 8.0, and incubation with a 1:75 dilution of anti-K167 (Dako Corp).
- IL-13R ⁇ 2 immunoreactivity was scored by a clinical neuropathologist and quantified based on the percentage of tumor cells exhibiting weak (1+), moderate (2+), or strong (3+) intensity of cytoplasmic and golgi-like staining.
- the H score is obtained by the formula: (3 ⁇ percentage of strongly staining cells)+(2 ⁇ percentage of moderately staining cells)+percentage of weakly staining cells, giving a range of 0 to 300.
- the H score can be translated into the intensity scoring system described in the enrollment criteria as follows: 0 representing negative (H score 0), 1+ low (H score 1-100), 2+ moderate (H score 101-200) and 3+ high (H score 201-300).
- the criteria for inclusion was at least 20% of the cells scoring 1+ staining intensity (>20%, 1+), representing an H score of 20. Appropriate positive (testicular) and negative (prostate) controls were employed for IL-13R ⁇ 2 IHC staining.
- a “+” sign reflects the presence of membranous staining. This test has been performed at the Department of Pathology, City of Hope National Medical Center and is regarded as investigational for research. This Laboratory is certified under the Clinical Laboratory Improvement Amendments of 1988 (CLIA) as qualified to perform high complexity clinical laboratory testing.
- Peripheral blood samples were collected in vacutainer tubes ⁇ EDTA. Samples with EDTA were ficolled immediately upon receipt and peripheral blood mononuclear cells (PBMC) were frozen in Crystor CS5 at ⁇ 80° C. and then transferred to liquid nitrogen for long term storage. Samples without EDTA were allowed to coagulate for 2-3 hours at room temperature; serum was collected by centrifugation, aliquoted in single use 100-200 ⁇ l aliquots and stored at ⁇ 80° C. Cerebral spinal fluid (CSF) was collected from the ICV reservoir in a 3 cc syringe, spun down, and supernatants were aliquoted and stored at ⁇ 80° C.
- CSF Cerebral spinal fluid
- the CSF cells were resuspended in HBSS ⁇ / ⁇ (Corning CellGro) with 2% FCS and sodium azide for immediate flow cytometric analysis, with the remaining cells resuspended and frozen in Cryostor CS4 at ⁇ 80° C. and then transferred to liquid nitrogen for long term storage
- Cell surface phenotyping of immune cells was performed by flow cytometry using fluorochrome conjugated antibodies specific for CD3, CD4, CD11b, CD14, CD19, CD27, CD28, CD62L, CD45RA, CD45RO, IL-13, TCR- ⁇ / ⁇ (BD Biosciences), KLRG1, CD15 (BioLegend), HLA-DR, PD1 (eBiosciences), CD8 (Fisher Scientific), LAG-3 (Lifespan Biosciences), CCR7, or TIM-3 (R&D Systems), and their respective isotype controls.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Psychology (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Oncology (AREA)
- Mycology (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/425,773 US20170224733A1 (en) | 2016-02-05 | 2017-02-06 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
| US17/025,723 US12472233B2 (en) | 2016-02-05 | 2020-09-18 | Administration of engineered T cells for treatment of cancers in the central nervous system |
| US19/351,506 US20260027181A1 (en) | 2016-02-05 | 2025-10-07 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662292152P | 2016-02-05 | 2016-02-05 | |
| US201662309348P | 2016-03-16 | 2016-03-16 | |
| US15/425,773 US20170224733A1 (en) | 2016-02-05 | 2017-02-06 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/025,723 Continuation US12472233B2 (en) | 2016-02-05 | 2020-09-18 | Administration of engineered T cells for treatment of cancers in the central nervous system |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20170224733A1 true US20170224733A1 (en) | 2017-08-10 |
Family
ID=59496551
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/425,773 Abandoned US20170224733A1 (en) | 2016-02-05 | 2017-02-06 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
| US17/025,723 Active 2040-01-27 US12472233B2 (en) | 2016-02-05 | 2020-09-18 | Administration of engineered T cells for treatment of cancers in the central nervous system |
| US19/351,506 Pending US20260027181A1 (en) | 2016-02-05 | 2025-10-07 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/025,723 Active 2040-01-27 US12472233B2 (en) | 2016-02-05 | 2020-09-18 | Administration of engineered T cells for treatment of cancers in the central nervous system |
| US19/351,506 Pending US20260027181A1 (en) | 2016-02-05 | 2025-10-07 | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System |
Country Status (14)
| Country | Link |
|---|---|
| US (3) | US20170224733A1 (https=) |
| EP (2) | EP3411393B1 (https=) |
| JP (2) | JP7189019B2 (https=) |
| KR (1) | KR20180105709A (https=) |
| CN (1) | CN108779160A (https=) |
| AU (2) | AU2017213661B2 (https=) |
| BR (1) | BR112018015836A2 (https=) |
| CA (1) | CA3013773A1 (https=) |
| DK (1) | DK3411393T3 (https=) |
| ES (1) | ES2879700T3 (https=) |
| IL (2) | IL287889B2 (https=) |
| MX (1) | MX2023006304A (https=) |
| RU (1) | RU2757308C2 (https=) |
| WO (1) | WO2017136829A1 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019178085A1 (en) * | 2018-03-14 | 2019-09-19 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Il-13 receptor alpha 2 targeted, zetakine directed t cell immunotherapy |
| WO2019232523A1 (en) * | 2018-06-01 | 2019-12-05 | The Board Of Trustees Of The Leland Stanford Junior University | Il-13/il-4 superkines: immune cell targeting constructs and methods of use thereof |
| US10611837B2 (en) | 2014-04-10 | 2020-04-07 | Seattle Children's Hospital | Transgene genetic tags and methods of use |
| WO2021154543A3 (en) * | 2020-01-31 | 2021-09-02 | City Of Hope | TARGETED CHIMERIC ANTIGEN RECEPTOR MODIFIED T CELLS FOR TREATMENT OF IL13Rα2 POSITIVE MALIGNANCIES |
| US11111493B2 (en) | 2018-03-15 | 2021-09-07 | KSQ Therapeutics, Inc. | Gene-regulating compositions and methods for improved immunotherapy |
| US11123369B2 (en) | 2015-08-07 | 2021-09-21 | Seattle Children's Hospital | Bispecific CAR T-cells for solid tumor targeting |
| WO2021202793A3 (en) * | 2020-03-31 | 2021-11-11 | Fred Hutchinson Cancer Research Center | Chimeric antigen receptors targeting cd33 |
| US11408005B2 (en) | 2016-12-12 | 2022-08-09 | Seattle Children's Hospital | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
| WO2022212525A3 (en) * | 2021-03-30 | 2022-11-10 | City Of Hope | Chimeric antigen receptors comprising ifn gamma |
| US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
| US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| US12150981B2 (en) | 2012-12-20 | 2024-11-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing T cells as anti-cancer therapeutics |
| US12152079B2 (en) | 2018-03-14 | 2024-11-26 | Seattle Children's Research Institute | Nucleic acids encoding IL-13 receptor alpha 2 (IL13Ra2) chimeric antigen receptor for tumor specific T cell immunotherapy |
| US12240870B2 (en) | 2018-02-23 | 2025-03-04 | Purdue Research Foundation | Sequencing method for CAR T cell therapy |
| US12472233B2 (en) | 2016-02-05 | 2025-11-18 | City Of Hope | Administration of engineered T cells for treatment of cancers in the central nervous system |
| US12570758B2 (en) | 2020-03-31 | 2026-03-10 | Fred Hutchinson Cancer Center | Chimeric antigen receptors targeting CD33 |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109971725B (zh) * | 2017-12-28 | 2024-02-02 | 上海细胞治疗研究院 | 抗体修饰的嵌合抗原受体修饰t细胞及其用途 |
| CN113646433B (zh) * | 2020-07-16 | 2022-10-11 | 苏州博腾生物制药有限公司 | 靶向抗TNF-α抗体的组合物和方法 |
| JP2023550148A (ja) | 2020-11-20 | 2023-11-30 | シンシア・イノベーション・インコーポレイテッド | がん免疫治療に用いられる武装二重car-t組成物及び方法 |
| WO2025235801A1 (en) | 2024-05-08 | 2025-11-13 | City Of Hope | Antibodies targeted to osteopontin and uses thereof for reducing resistance of solid tumors immune cell therapy |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20120148552A1 (en) * | 2008-08-26 | 2012-06-14 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US20130280224A1 (en) * | 2010-11-17 | 2013-10-24 | Alon Monsonego | T-cell therapy to neurodegenerative diseases |
| US9181527B2 (en) * | 2009-10-29 | 2015-11-10 | The Trustees Of Dartmouth College | T cell receptor-deficient T cell compositions |
Family Cites Families (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090257994A1 (en) | 2001-04-30 | 2009-10-15 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| US7514537B2 (en) * | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US11278594B2 (en) | 2001-04-30 | 2022-03-22 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| SI2856876T1 (en) * | 2007-03-30 | 2018-04-30 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| EP2885428B1 (en) * | 2012-08-17 | 2017-05-03 | Memorial Sloan-Kettering Cancer Center | Gene expression profile associated with prostate cancer |
| IL238323B2 (en) * | 2012-10-30 | 2023-11-01 | Esperance Pharmaceuticals Inc | Antibody/drug conjugates and methods of use |
| AU2013204922B2 (en) * | 2012-12-20 | 2015-05-14 | Celgene Corporation | Chimeric antigen receptors |
| CN113307880B (zh) * | 2014-01-13 | 2025-07-04 | 希望之城公司 | 在Fc间隔物区中具有突变的嵌合抗原受体(CAR)及其使用方法 |
| CA2945388A1 (en) * | 2014-04-23 | 2015-10-29 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors (car) for use in therapy and methods for making the same |
| AU2016306209B2 (en) * | 2015-08-07 | 2023-07-06 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Bispecific CAR T-cells for solid tumor targeting |
| CN105131126B (zh) * | 2015-10-10 | 2019-02-01 | 北京康爱瑞浩细胞技术有限公司 | 用于治疗恶性肿瘤的嵌合抗原受体及其制备方法与应用 |
| IL302560B2 (en) | 2015-10-13 | 2025-08-01 | Hope City | Chimeric antigen receptors containing a chlorotoxin domain |
| KR20180083874A (ko) * | 2015-11-04 | 2018-07-23 | 사울 제이. 프라이스맨 | Her2를 표적화하는 키메라 항원 수용체 |
| IL287889B2 (en) | 2016-02-05 | 2024-03-01 | Hope City | Administration of engineered t cells for treatment of cancers in the central nervous system |
| CN115551882A (zh) | 2020-01-31 | 2022-12-30 | 希望之城公司 | 用于治疗IL13Rα2阳性恶性病的靶向性嵌合抗原受体修饰的T细胞 |
| WO2021183755A1 (en) | 2020-03-11 | 2021-09-16 | City Of Hope | Dual-targeting chimeric antigen receptor modified t cells comprising il-13 and chlorotoxin for cancer treatment |
| CA3175123A1 (en) | 2020-03-12 | 2021-09-16 | City Of Hope | Targeted chimeric antigen receptor modified t cells for treatment of il13r.alpha.2 positive malignancies |
| AU2021342126A1 (en) | 2020-09-10 | 2023-05-18 | City Of Hope | Combination therapy comprising cancer-targeted car-t cells and a method of using same for a treatment for cancer |
-
2017
- 2017-02-06 IL IL287889A patent/IL287889B2/en unknown
- 2017-02-06 WO PCT/US2017/016711 patent/WO2017136829A1/en not_active Ceased
- 2017-02-06 EP EP17748349.2A patent/EP3411393B1/en active Active
- 2017-02-06 AU AU2017213661A patent/AU2017213661B2/en active Active
- 2017-02-06 DK DK17748349.2T patent/DK3411393T3/da active
- 2017-02-06 RU RU2018130752A patent/RU2757308C2/ru active
- 2017-02-06 CN CN201780017442.9A patent/CN108779160A/zh active Pending
- 2017-02-06 CA CA3013773A patent/CA3013773A1/en active Pending
- 2017-02-06 EP EP21166981.7A patent/EP3912993A1/en not_active Withdrawn
- 2017-02-06 US US15/425,773 patent/US20170224733A1/en not_active Abandoned
- 2017-02-06 ES ES17748349T patent/ES2879700T3/es active Active
- 2017-02-06 JP JP2018540862A patent/JP7189019B2/ja active Active
- 2017-02-06 KR KR1020187025196A patent/KR20180105709A/ko not_active Ceased
- 2017-02-06 BR BR112018015836-4A patent/BR112018015836A2/en active Search and Examination
-
2018
- 2018-08-01 IL IL260930A patent/IL260930B/en unknown
- 2018-08-03 MX MX2023006304A patent/MX2023006304A/es unknown
-
2020
- 2020-09-18 US US17/025,723 patent/US12472233B2/en active Active
-
2022
- 2022-09-02 AU AU2022224866A patent/AU2022224866A1/en not_active Abandoned
- 2022-12-01 JP JP2022192529A patent/JP7597452B2/ja active Active
-
2025
- 2025-10-07 US US19/351,506 patent/US20260027181A1/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20120148552A1 (en) * | 2008-08-26 | 2012-06-14 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US9181527B2 (en) * | 2009-10-29 | 2015-11-10 | The Trustees Of Dartmouth College | T cell receptor-deficient T cell compositions |
| US20130280224A1 (en) * | 2010-11-17 | 2013-10-24 | Alon Monsonego | T-cell therapy to neurodegenerative diseases |
Non-Patent Citations (2)
| Title |
|---|
| Tsurushima et al., Reduction of End-stage Malignant Glioma by Injection with Autologous Cytotoxic T Lymphocytes. Jpn. J. Cancer Res. 90, 536–545, May 1999 (Year: 1999) * |
| Tsurushima Jp J Cancer Res, 1999, 90 536-545 * |
Cited By (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12150981B2 (en) | 2012-12-20 | 2024-11-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing T cells as anti-cancer therapeutics |
| US11414486B2 (en) | 2014-04-10 | 2022-08-16 | Seattle Children's Hospital | Transgene genetic tags and methods of use |
| US12202897B2 (en) | 2014-04-10 | 2025-01-21 | Seattle Children's Hospital | Drug regulated transgene expression |
| US10865242B2 (en) | 2014-04-10 | 2020-12-15 | Seattle Children's Hospital | Method and compositions for cellular immunotherapy |
| US12448445B2 (en) | 2014-04-10 | 2025-10-21 | Seattle Children's Hospital | Transgene genetic tags and methods of use |
| US11155616B2 (en) | 2014-04-10 | 2021-10-26 | Seattle Children's Hospital | Drug regulated transgene expression |
| US10611837B2 (en) | 2014-04-10 | 2020-04-07 | Seattle Children's Hospital | Transgene genetic tags and methods of use |
| US12258397B2 (en) | 2014-04-10 | 2025-03-25 | Seattle Children's Hospital | Production of engineered T-cells by sleeping beauty transposon coupled with methotrexate selection |
| US12503507B2 (en) | 2014-04-10 | 2025-12-23 | Seattle Children's Hospital | Defined composition gene modified T-cell products |
| US11123369B2 (en) | 2015-08-07 | 2021-09-21 | Seattle Children's Hospital | Bispecific CAR T-cells for solid tumor targeting |
| US11458167B2 (en) | 2015-08-07 | 2022-10-04 | Seattle Children's Hospital | Bispecific CAR T-cells for solid tumor targeting |
| US12472233B2 (en) | 2016-02-05 | 2025-11-18 | City Of Hope | Administration of engineered T cells for treatment of cancers in the central nervous system |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| US11408005B2 (en) | 2016-12-12 | 2022-08-09 | Seattle Children's Hospital | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
| US11850262B2 (en) | 2017-02-28 | 2023-12-26 | Purdue Research Foundation | Compositions and methods for CAR T cell therapy |
| US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
| US12269862B2 (en) | 2018-01-22 | 2025-04-08 | Endocyte, Inc. | Methods of use for CAR T cells |
| US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
| US12240870B2 (en) | 2018-02-23 | 2025-03-04 | Purdue Research Foundation | Sequencing method for CAR T cell therapy |
| EP4491718A3 (en) * | 2018-03-14 | 2025-03-26 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | Il-13 receptor alpha 2 targeted, zetakine directed t cell immunotherapy |
| EP3765487A4 (en) * | 2018-03-14 | 2022-01-05 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | IL-13REZEPTOR-ALPHA 2 T-CELL IMMUNOTHERAPY TARGETED AGAINST ZETAKIN |
| US12606603B2 (en) | 2018-03-14 | 2026-04-21 | Seattle Children's Hospital | IL-13 receptor alpha 2 targeted, zetakine directed T cell immunotherapy |
| AU2019234580B2 (en) * | 2018-03-14 | 2024-02-01 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | IL-13 receptor alpha 2 targeted, zetakine directed T cell immunotherapy |
| US12152079B2 (en) | 2018-03-14 | 2024-11-26 | Seattle Children's Research Institute | Nucleic acids encoding IL-13 receptor alpha 2 (IL13Ra2) chimeric antigen receptor for tumor specific T cell immunotherapy |
| WO2019178085A1 (en) * | 2018-03-14 | 2019-09-19 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Il-13 receptor alpha 2 targeted, zetakine directed t cell immunotherapy |
| US11111493B2 (en) | 2018-03-15 | 2021-09-07 | KSQ Therapeutics, Inc. | Gene-regulating compositions and methods for improved immunotherapy |
| US11421228B2 (en) | 2018-03-15 | 2022-08-23 | KSQ Therapeutics, Inc. | Gene-regulating compositions and methods for improved immunotherapy |
| US11608500B2 (en) | 2018-03-15 | 2023-03-21 | KSQ Therapeutics, Inc. | Gene-regulating compositions and methods for improved immunotherapy |
| CN112533943A (zh) * | 2018-06-01 | 2021-03-19 | 利兰斯坦福初级大学董事会 | Il-13/il-4超级因子:免疫细胞靶向性构建体及其使用方法 |
| WO2019232523A1 (en) * | 2018-06-01 | 2019-12-05 | The Board Of Trustees Of The Leland Stanford Junior University | Il-13/il-4 superkines: immune cell targeting constructs and methods of use thereof |
| US12590133B2 (en) | 2018-06-01 | 2026-03-31 | The Board Of Trustees Of The Leland Stanford Junior University | IL-13/IL-4 superkines: immune cell targeting constructs and methods of use thereof |
| US12419954B2 (en) | 2020-01-31 | 2025-09-23 | City Of Hope | Targeted chimeric antigen receptor modified T cells for treatment of IL13Rα2 positive malignancies |
| WO2021154543A3 (en) * | 2020-01-31 | 2021-09-02 | City Of Hope | TARGETED CHIMERIC ANTIGEN RECEPTOR MODIFIED T CELLS FOR TREATMENT OF IL13Rα2 POSITIVE MALIGNANCIES |
| WO2021202793A3 (en) * | 2020-03-31 | 2021-11-11 | Fred Hutchinson Cancer Research Center | Chimeric antigen receptors targeting cd33 |
| US12570758B2 (en) | 2020-03-31 | 2026-03-10 | Fred Hutchinson Cancer Center | Chimeric antigen receptors targeting CD33 |
| WO2022212525A3 (en) * | 2021-03-30 | 2022-11-10 | City Of Hope | Chimeric antigen receptors comprising ifn gamma |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2019504105A (ja) | 2019-02-14 |
| CA3013773A1 (en) | 2017-08-10 |
| RU2018130752A (ru) | 2020-03-06 |
| MX2023006304A (es) | 2023-06-14 |
| DK3411393T3 (da) | 2021-06-28 |
| US20260027181A1 (en) | 2026-01-29 |
| IL287889B2 (en) | 2024-03-01 |
| US20210244761A1 (en) | 2021-08-12 |
| US12472233B2 (en) | 2025-11-18 |
| EP3411393A4 (en) | 2019-09-25 |
| EP3912993A1 (en) | 2021-11-24 |
| AU2017213661A1 (en) | 2018-08-16 |
| AU2022224866A1 (en) | 2022-09-29 |
| JP2023026758A (ja) | 2023-02-28 |
| ES2879700T3 (es) | 2021-11-22 |
| AU2017213661B2 (en) | 2022-06-02 |
| RU2757308C2 (ru) | 2021-10-13 |
| EP3411393B1 (en) | 2021-04-07 |
| IL287889A (en) | 2022-01-01 |
| WO2017136829A1 (en) | 2017-08-10 |
| HK1257741A1 (en) | 2019-10-25 |
| BR112018015836A2 (en) | 2018-12-26 |
| RU2018130752A3 (https=) | 2020-10-07 |
| CN108779160A (zh) | 2018-11-09 |
| JP7189019B2 (ja) | 2022-12-13 |
| IL287889B1 (en) | 2023-11-01 |
| IL260930B (en) | 2021-12-01 |
| JP7597452B2 (ja) | 2024-12-10 |
| KR20180105709A (ko) | 2018-09-28 |
| EP3411393A1 (en) | 2018-12-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260027181A1 (en) | Administration of Engineered T Cells for Treatment of Cancers in the Central Nervous System | |
| JP6986190B2 (ja) | IL13Rα2を標的とする共刺激性キメラ抗原受容体T細胞L13Rα2を標的とする共刺激性キメラ抗原レセプターT細胞 | |
| CN106459914B (zh) | 经修饰的自然杀伤细胞及其用途 | |
| CN105408473B9 (zh) | 工程化嵌合抗原受体(car)t细胞的人应用 | |
| US20220118019A1 (en) | Allogeneic cell therapy of b cell malignancies using genetically engineered t cells targeting cd19 | |
| CA3138633A1 (en) | Allogeneic cell therapy of b cell malignancies using genetically engineered t cells targeting cd19 | |
| Shabaneh et al. | Safety switch optimization enhances antibody-mediated elimination of CAR T cells | |
| US20230071910A1 (en) | Methods for dosing and treatment of follicular lymphoma and marginal zone lymphoma in adoptive cell therapy | |
| JPWO2018110374A1 (ja) | 殺細胞効果を有するキメラ抗原受容体遺伝子改変リンパ球 | |
| HK40064909A (en) | Administration of engineered t cells for treatment of cancers in the central nervous system | |
| HK1257741B (en) | Administration of engineered t cells for treatment of cancers in the central nervous system | |
| EP3707246B1 (en) | Treatment of cns lymphoma and systemic lymphoma with intracerebroventricularly administered cd19 car | |
| AU2024363867A1 (en) | Chimeric receptors and uses thereof | |
| WO2025085721A1 (en) | Chimeric receptors and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: CITY OF HOPE, CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BADIE, BEHNAM;BROWN, CHRISTINE E.;FORMAN, STEPHEN J.;AND OTHERS;SIGNING DATES FROM 20170207 TO 20170213;REEL/FRAME:042220/0118 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |