US20150133393A1 - Novel JNK Inhibitor Molecules for Treatment of Various Diseases - Google Patents
Novel JNK Inhibitor Molecules for Treatment of Various Diseases Download PDFInfo
- Publication number
- US20150133393A1 US20150133393A1 US14/367,706 US201214367706A US2015133393A1 US 20150133393 A1 US20150133393 A1 US 20150133393A1 US 201214367706 A US201214367706 A US 201214367706A US 2015133393 A1 US2015133393 A1 US 2015133393A1
- Authority
- US
- United States
- Prior art keywords
- seq
- diseases
- sequence
- disease
- jnk inhibitor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/08—Peptides having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/005—Enzyme inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/162—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/02—Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/14—Drugs for dermatological disorders for baldness or alopecia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/04—Centrally acting analgesics, e.g. opioids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/08—Antiepileptics; Anticonvulsants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/12—Ophthalmic agents for cataracts
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
- C12N2740/16322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
- C12N2740/16334—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to the field of enzyme inhibition, in particular to (poly-)peptide inhibitors of c-Jun amino terminal kinase (JNK).
- JNK c-Jun amino terminal kinase
- the present invention relates to using these JNK inhibitors in the treatment of various diseases.
- JNK The c-Jun amino terminal kinase
- MAP mitogen-activated protein
- JNK signal transduction pathway is activated in response to environmental stress and by the engagement of several classes of cell surface receptors. These receptors can include cytokine receptors, serpentine receptors and receptor tyrosine kinases.
- JNK has been implicated in biological processes such as oncogenic transformation and mediating adaptive responses to environmental stress.
- JNK has also been associated with modulating immune responses, including maturation and differentiation of immune cells, as well as effecting programmed cell death in cells identified for destruction by the immune system. This unique property makes JNK signaling a promising target for developing pharmacological intervention. Among several neurological disorders, JNK signaling is particularly implicated in ischemic stroke and Parkinson's disease, but also in other diseases as mentioned further below. Furthermore, the mitogen-activated protein kinase (MAPK) p38alpha was shown to negatively regulate the cell proliferation by antagonizing the JNK-c-Jun-pathway.
- MAPK mitogen-activated protein kinase
- the mitogen-activated protein kinase (MAPK) p38alpha therefore appears to be active in suppression of normal and cancer cell proliferation and, as a further, demonstrates the involvement of JNK in cancer diseases (see e.g. Hui et al., Nature Genetics, Vol 39, No. 6, June 2007).
- JNK c-Jun N-terminal Kinase
- JNK signalling in diseases such as the involvement in excitotoxicity of hippocampal neurons, liver ischemia, reperfusion, neurodegenerative diseases, hearing loss, deafness, neural tube birth defects, cancer, chronic inflammatory diseases, obesity, diabetes, in particular insulin-resistant diabetes, and proposed that it is likely that selective JNK inhibitors are needed for treatment of various diseases with a high degree of specificity and lack of toxicity.
- Inhibitors of the JNK signaling pathway include e.g. upstream kinase inhibitors (for example, CEP-1347), small chemical inhibitors of JNK (SP600125 and AS601245), which directly affect kinase activity e.g. by competing with the ATP-binding site of the protein kinase, and peptide inhibitors of the interaction between JNK and its substrates (see e.g. Kuan et al., Current Drug Targets—CNS & Neurological Disorders, February 2005, vol. 4, no. 1, pp. 63-67; WO 2007/031280; all incorporated herewith by reference).
- WO 2007/031280 discloses small cell permeable fusion peptides, comprising a so-called TAT transporter sequence derived from the basic trafficking sequence of the HIV-TAT protein and an amino acid inhibitory sequence of IB1.
- WO 2007/031280 discloses in particular two specific sequences, L-TAT-IB1 (GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQD, herein SEQ ID NO: 196) and D-TAT-IB1 (dqsrpvqpflnlttprkprpprrrqrrkkrg; herein SEQ ID NO: 197), the latter being the retro-inverso sequence of L-TAT-IB1. Due to the HIV TAT derived transporter sequence, these fusion peptides are more efficiently transported into the target cells, where they remain effective until proteolytic degradation.
- ATP independent peptide inhibitors of JNK are usually more specific inhibitors, they are frequently the first choice if it comes to inhibiting JNK.
- peptide inhibitors disclosed in WO 2007/031280 are not optimal for all purposes.
- compound L-TAT-IB1 (herein SEQ ID NO: 196) which consists of L amino acids only, is quickly proteolytically degraded.
- D-TAT-IB1 (herein SEQ ID NO: 197), which comprises D amino acids.
- D-TAT-IB1 exhibits the retro-inverso sequence of L-TAT-IB1.
- JNK inhibitors have been discussed, proposed and successfully tested in the art as treatment for a variety of disease states.
- Dickens et al. described the c-Jun amino terminal kinase inhibitor JIP-1 and proposed JIP-1 as candidate compounds for therapeutic strategies for the treatment of for example chronic myeloid leukaemia, in particular, in the context of Bcr-Abl caused transformation of pre-B-cells (Science; 1997; 277(5326):693-696).
- JIP-1 derived inhibitors of JNK signalling are proposed for the treatment of neurodegenerative diseases, such as Parkinson's disease or Alzheimer's disease; stroke and associated memory loss, autoimmune diseases such as arthritis; other conditions characterized by inflammation; malignancies, such as leukemias, e.g. chronic myelogenous leukemia (CML); oxidative damage to organs such as the liver and kidney; heart diseases; and transplant rejections.
- neurodegenerative diseases such as Parkinson's disease or Alzheimer's disease
- stroke and associated memory loss autoimmune diseases such as arthritis
- autoimmune diseases such as arthritis
- malignancies such as leukemias, e.g. chronic myelogenous leukemia (CML)
- CML chronic myelogenous leukemia
- JNK-inhibitor SP600125
- SP600125 tumor necrosis factor- ⁇ production and epithelial cell apoptosis in acute murine colitis.
- the authors concluded that inhibition of JNK is of value in human inflammatory bowel disease treatment (Immunology; 2006, 118(1):112-121).
- JNK c-Jun N-terminal kinase
- JNK-inhibition For retinal diseases and age-related macula degeneration in particular, Roduit et al. (Apoptosis, 2008, 13(3), p. 343-353) have likewise suggested to use JNK-inhibition as therapeutic approach. Similar considerations relying on JNK-inhibition are disclosed for example in WO 2010/113753 for the treatment of age-related macular degeneration, diabetic macular edema, diabetic retinopathy, central exudative chorioretinopathy, angioid streaks, retinal pigment epithelium detachment, multifocal choroiditis, neovascular maculopathy, retinopathy of prematurity, retinitis pigmentosa, Leber's disease, retinal artery occlusion, retinal vein occlusion, central serous chorioretinopathy, retinal macroaneurysm, retinal detachment, proliferative vitreoretinopathy, Stargardt'
- FIG. 1 Illustration of the inhibitory efficacy of several JNK inhibitors according to the present invention, which was investigated by in vitro AlphaScreen assay (Amplified Luminescence Proximity Homogeneous-Screen Assay).
- FIG. 2 Table illustrating the inhibitory efficacy of several JNK inhibitors (SEQ ID NOs: 193, 2, 3, 5, 6, and 7) according to the present invention. Given are the IC50 values in the nM range, the respective standard error of the mean and the number of experiments performed (n).
- FIG. 3 Illustration of the inhibitory efficacy of several JNK inhibitors according to the present invention, which are fusion proteins of a JNK inhibitory (poly-)peptide sequence and a transporter sequence.
- the inhibitory efficacy was determined by means of in vitro AlphaScreen assay (Amplified Luminescence Proximity Homogeneous-Screen Assay).
- FIG. 4 Table illustrating the inhibitory efficacy of several JNK inhibitors according to the present invention, which are fusion proteins of a JNK inhibitory (poly-)peptide sequence and a transporter sequence. Given are the IC50 values in the nM range, the respective standard error of the mean (SEM) and the number of experiments performed (n).
- FIG. 5 Stability of JNK inhibitors with SEQ ID NOs: 172, 196 and 197 in 50% human serum.
- the JNK inhibitor with SEQ ID NO: 196 was totally degraded into amino acids residues within 6 hours (A).
- the JNK inhibitor with SEQ ID NO: 172 was completely degraded only after 14 days (B).
- the JNK inhibitor with SEQ ID NO: 197 was stable at least up to 30 days (B).
- FIG. 6 shows internalizations experiments using TAT derived transporter constructs with D-amino acid/L-amino acid pattern as denoted in SEQ ID NO: 30.
- the transporter sequences analyzed correspond to SEQ ID NOs: 52-94 plus SEQ ID NOs: 45, 47, 46, 43 and 99 ( FIG. 6 a ) and SEQ ID NOs: 100-147 ( FIG. 6 b ).
- SEQ ID NO: 31 shows a higher internalization capability than the L-TAT transporter (SEQ ID NO: 43).
- Hela cells were incubated 24 hours in 96well plate with 10 mM of the respective transporters.
- the cells were then washed twice with an acidic buffer (0.2M Glycin, 0.15M NaCl, pH 3.0) and twice with PBS. Cells were broken by the addition of RIPA lysis buffer. The relative amount of internalized peptide was then determined by reading the fluorescence intensity (Fusion Alpha plate reader; PerkinElmer) of each extract followed by background subtraction.
- FIG. 7 The JNK inhibitor with the sequence of SEQ ID NO: 172 blocks LPS-induced cytokine and chemokine release in THP1-PMA-differentiated macrophages.
- FIG. 7A TNF release (THP1pma 6 h 3 ng/ml LPS);
- FIG. 7B TNF ⁇ release (THP1pma 6 h 10 ng/ml LPS);
- FIG. 7C IL 6 release (THP1pma 6 h 10 ng/ml LPS);
- FIG. 7D MCP1 release (THP1pma 6 h 3 ng/ml LPS).
- FIG. 8 The JNK inhibitor of SEQ ID NO: 172 blocks LPS-induced IL6 release in THP1 differentiated macrophages with higher potency than D-TAT-IB1 (SEQ ID NO: 197), dTAT (SEQ ID NO: 45) and SP 600125. LPS was added for 6 h (10 ng/ml).
- FIG. 9 The JNK inhibitor of SEQ ID NO: 172 blocks LPS-induced TNF ⁇ release in THP1 differentiated macrophages with higher potency than D-TAT-IB1 (SEQ ID NO: 197), dTAT (SEQ ID NO: 45) and SP 600125. LPS was added for 6 h (10 ng/ml).
- FIG. 10 The JNK inhibitor of SEQ ID NO: 172 blocks LPS-induced IL-6 release in PMA differentiated macrophages with higher potency than D-TAT-IB1 (SEQ ID NO: 197) and L-TAT-IB1 (SEQ ID NO: 196). LPS was added for 6 h.
- FIG. 11 The JNK inhibitor of SEQ ID NO: 172 blocks LPS-induced TNF ⁇ release in PMA differentiated macrophages with higher potency than D-TAT-IB1 (SEQ ID NO: 197) and L-TAT-IB1 (SEQ ID NO: 196).
- FIG. 12 The JNK inhibitor of SEQ ID NO: 172 blocks LPS-induced TNF ⁇ release in Primary Rat Whole Blood Cells at 3 ng/ml. Given are the results for the control, 1 ⁇ M of SEQ ID NO: 172, 3 ⁇ M of SEQ ID NO: 172, and 10 ⁇ M of SEQ ID NO: 172 at different levels of LPS (ng/ml).
- FIG. 13 The JNK inhibitor of SEQ ID NO: 172 blocks IL2 secretion by primary human T-cells in response to PMA/Ionomycin.
- FIG. 14 The JNK inhibitor of SEQ ID NO: 172 blocks IL2 secretion by primary human T-cells in response to CD3/CD28 stimulation.
- the JNK inhibitors used are indicated by their SEQ ID NO: 172 and 197.
- FIG. 15 Dose-dependent inhibition by JNK inhibitor with SEQ ID NO: 172 of CD3/CD28-induced IL-2 release in primary rat lymph-nodes purified T cells. Control rat were sacrificed and lymph-nodes were harvested. T cells further were purified (using magnetic negative selection) and plated into 96-well plates at 200.000 cells/well. Cells were treated with anti-rat CD3 and anti-rat CD28 antibodies (2 ⁇ g/mL). JNK inhibitor with SEQ ID NO: 172 was added to the cultures 1 h before CD3/CD28 treatment and IL-2 release was assessed in supernatant 24 h after treatment.
- FIG. 16 Dose-dependent inhibition of CD3/CD28-induced IL-2 release in primary rat lymph-nodes purified T cells: Comparison of several JNK inhibitors, namely SEQ ID NOs: 172, 197 and SP600125.
- FIG. 17 Dose dependent inhibition of IL-2 release in rat whole blood stimulated with PMA+ionomycin.
- JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before stimulation with PMA+ionomycin.
- Three doses of activators were added (25/500 ng/mL, 50/750 ng/mL and 50/1000 ng/mL) for 4 h.
- IL-2 release was assessed in supernatant.
- JNK inhibitor with SEQ ID NO: 172 at 10 ⁇ M did efficiently reduce PMA-iono-induced IL-2 release at the three tested activator concentrations.
- FIG. 18 JNK inhibition and IL-6 release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with LPS (0.02 ng/mL) for 4 hours.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the LPS-induced IL-6 release in a dose-dependent manner.
- FIG. 19 JNK inhibition and IL-2 release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with PMA+ionomycin (25/700 ng/mL, 50/800 ng/ml and 50/1000 ng/mL) for 4 hours.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the PMA+ionomycin-induced IL-2 release in a dose-dependent manner.
- FIG. 20 JNK inhibition and IFN- ⁇ release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with PMA+ionomycin (25/700 ng/mL, 50/800 ng/ml and 50/1000 ng/mL) for 4 hours.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the PMA+ionomycin-induced IFN- ⁇ release in a dose-dependent manner.
- FIG. 21 JNK inhibition and TNF- ⁇ release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with PMA+ionomycin (25/700 ng/mL, 50/800 ng/ml and 50/1000 ng/mL) for 4 hours.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the PMA+ionomycin-induced TNF- ⁇ release in a dose-dependent manner.
- FIG. 22 JNK inhibition and TNF- ⁇ release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with PHA-L (5 ⁇ g/mL) for 3 days.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the PHA-L-induced TNF- ⁇ release in a dose-dependent manner.
- FIG. 23 JNK inhibition and IL-2 release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with PHA-L (5 ⁇ g/mL) for 3 days.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the PHA-L-induced IL-2 release in a dose-dependent manner.
- FIG. 24 JNK inhibition and TNF- ⁇ release in human whole blood.
- the JNK inhibitor with SEQ ID NO: 172 was added at three different concentrations, namely 1, 3 and 10 ⁇ M 1 h before whole blood stimulation with CD3+/ ⁇ CD28 antibodies (2 ⁇ g/mL) for 3 days.
- the JNK inhibitor with SEQ ID NO: 172 did reduce the CD3/CD28-induced TNF- ⁇ release in a dose-dependent manner.
- FIG. 25 Photographic illustration of in vivo anti-inflammatory properties of the JNK inhibitors with SEQ ID NO: 197 (10 ⁇ g/kg) and SEQ ID NO: 172 (10 ⁇ g/kg) after CFA (complete Freund's adjuvant) induced paw swelling. Paw swelling was induced in the left hind paw, the right hind paw was not treated.
- FIG. 27 Graphical representation of in vivo anti-inflammatory properties of the JNK inhibitors with SEQ ID NO: 197 (10 ⁇ g/kg) and SEQ ID NO: 172 (10 ⁇ g/kg) after CFA (complete Freund's adjuvant) induced paw swelling. Indicated is the measured in vivo cytokine release one hour after CFA induced paw swelling.
- FIG. 28 Clinical evaluation of administration of different amounts of the JNK inhibitor according to SEQ ID NO: 172 in albino rats after intravenous administration (endotoxins induced uveitis model).
- FIG. 33 Clinical scoring by slit lamp 24 hours after EIU induction and administration of JNK inhibitor according to SEQ ID NO: 172 (1 mg/kg i.v.) at different times prior to EIU induction. From left to right: Vehicle (0 hours); SEQ ID NO: 172 4 weeks prior to EIU induction; SEQ ID NO: 172 2 weeks prior to EIU induction; SEQ ID NO: 172 1 week prior to EIU induction; SEQ ID NO: 172 48 hours prior to EIU induction; SEQ ID NO: 172 24 hours prior to EIU induction; SEQ ID NO: 172 0 hours prior to EIU induction; Dexamethasone (2 mg/kg i.v.) 0 hours prior to EIU induction. Mean ⁇ SEM. *p ⁇ 0.05 versus vehicle, **p ⁇ 0.01 versus vehicle.
- FIG. 34 Number of PMN cells per section quantified 24 hours after EIU induction and administration of JNK inhibitor according to SEQ ID NO: 172 (1 mg/kg i.v.) at different times prior to EIU induction. From left to right: Vehicle (0 hours); SEQ ID NO: 172 4 weeks prior to EIU induction; SEQ ID NO: 172 2 weeks prior to EIU induction; SEQ ID NO: 172 1 week prior to EIU induction; SEQ ID NO: 172 48 hours prior to EIU induction; SEQ ID NO: 172 24 hours prior to EIU induction; SEQ ID NO: 172 0 hours prior to EIU induction; Dexamethasone (2 mg/kg i.v.) 0 hours prior to EIU induction. Mean ⁇ SEM. *p ⁇ 0.05 versus vehicle, **p ⁇ 0.01 versus vehicle.
- FIG. 35 shows the mean calculated TBUT AUC values for animals with scopolamine induced dry eye syndrome. Shown are the results for animals treated with vehicle, 3 different concentrations of an all-D-retro-inverso JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 197, 3 different concentrations of a JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 172, and the results for animals treated with cyclosporine.
- FIG. 36 shows the mean calculated PRTT AUCs for animals with scopolamine induced Dry Eye (Day 7-21). Shown are the results for animals treated with vehicle, 3 different concentrations of an all-D-retro-inverso JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 197, 3 different concentrations of a JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 172, and the results for animals treated with cyclosporine.
- FIG. 37 shows the mean histological Cornea Lesion Scores for animals with scopolamine induced dry eye syndrome. Shown are the results for animals treated with vehicle, 3 different concentrations of an all-D-retro-inverso JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 197, 3 different concentrations of a JNK-inhibitor (poly-)peptide with the sequence of SEQ ID NO: 172, and the results for animals treated with cyclosporine.
- the present invention relates to a JNK inhibitor, which comprises an inhibitory (poly-)peptide sequence according to the following general formula:
- the inhibitory (poly-)peptide sequence of the JNK inhibitor according to the present invention comprises L-amino acids and in most embodiments D-amino acids. Unless specified otherwise, L-amino acid residues are indicated herein in capital letters, while D amino acid residues are indicated in small letters. Glycine may be indicated in capital or small letters (since there is no D- or L-glycine).
- the amino acid sequences disclosed herein are always given from N- to C-terminus (left to right) unless specified otherwise.
- the given amino acid sequence may be modified or unmodified at the C- and/or N-terminus, e.g. acetylation at the C-terminus and/or amidation or modification with cysteamide at the N-terminus. For sake of clarity such possible but entirely optional modifications at the C- and/or N-terminus of the amino acid sequences disclosed herein are for sake of clarity not specifically indicated.
- the JNK inhibitors of the present invention are (poly-)peptide inhibitors of the c-Jun N-terminal kinase (JNK). Said inhibitors inhibit the kinase activity of c-Jun N-terminal kinase (JNK), i.e. prevent or reduce the extent of phosphorylation of JNK substrates such as c-Jun, ATF2 and/or Elk-1.
- JNK c-Jun N-terminal kinase
- JNK c-Jun N-terminal kinase
- JNK c-Jun N-terminal kinase
- JNK activity refers to the inhibition of the kinase activity of c-Jun N-terminal kinase (JNK).
- a JNK inhibitor comprises at least one functional unit of a polymer of amino acids, i.e. a (poly-)peptide sequence. Moreover, this at least one functional polymer of amino acids provides for inhibition of JNK activity.
- the amino acid monomers of said inhibitory (poly-)peptide sequence are usually linked to each other via peptide bonds, but (chemical) modifications of said peptide bond(s) or of side chain residues may be tolerable, provided the inhibitory activity (inhibition of JNK activity) is not totally lost, i.e. the resulting chemical entity still qualifies as JNK inhibitor as functionally defined herein.
- the inhibitory (poly-)peptide sequence of the JNK inhibitors of the present invention is less than 500, 490, 480, 470, 460, 450, 440, 430, 420, 410, 400, 390, 380, 370, 360, 350, 340, 330, 320, 310, 300, 290, 280, 270, 260, 250, 240, 230, 220, 210, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, or less than 12 amino acids long.
- the inhibitory (poly-)peptide sequence of the JNK inhibitors of the present invention is less than 500, 490, 480, 470, 460
- JNK inhibitor inhibits JNK activity, e.g. exhibits with regard to the inhibition of human JNK mediated phosphorylation of a c-Jun substrate (SEQ ID NO: 198) an IC 50 value of:
- the inhibitor inhibits human JNK2 and/or human JNK3 according to the above definition, but not JNK1 according to the above definition.
- JNK activity is inhibited or not, may easily be assessed by a person skilled in the art.
- a radioactive kinase assay or a non-radioactive kinase assay e.g. Alpha screen test; see for example Guenat et al. J Biomol Screen, 2006; 11: pages 1015-1026.
- a JNK inhibitor according to the present invention may thus for example comprise an inhibitory (poly-)peptide sequence according to any of SEQ ID NOs: 2 to 27 (see table 1).
- the JNK inhibitor according to the present invention may also be a JNK inhibitor (variant) which comprises an inhibitory (poly-)peptide sequence sharing at least 50%, more preferably at least 55%, more preferably at least 60%, more preferably at least 65%, more preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, most preferably at least 90% sequence identity with a sequence selected from SEQ ID NOs: 1-27, in particular with SEQ ID NO: 8,
- inhibitory (poly-)peptide sequence sharing sequence identity with regard to the respective sequence selected from SEQ ID NOs: 1-27, such inhibitory (poly-)peptide sequence sharing sequence identity
- variants disclosed herein (in particular JNK inhibitor variants comprising an inhibitory (poly-)peptide sequence sharing—within the above definition—a certain degree of sequence identity with a sequence selected from SEQ ID NOs: 1-27), share preferably less than 100% sequence identity with the respective reference sequence.
- the non-identical amino acids are preferably the result of conservative amino acid substitutions.
- Conservative amino acid substitutions may include amino acid residues within a group which have sufficiently similar physicochemical properties, so that a substitution between members of the group will preserve the biological activity of the molecule (see e.g. Grantham, R. (1974), Science 185, 862-864).
- conservative amino acid substitutions are preferably substitutions in which the amino acids originate from the same class of amino acids (e.g. basic amino acids, acidic amino acids, polar amino acids, amino acids with aliphatic side chains, amino acids with positively or negatively charged side chains, amino acids with aromatic groups in the side chains, amino acids the side chains of which can enter into hydrogen bridges, e.g. side chains which have a hydroxyl function, etc.).
- Conservative substitutions are in the present case for example substituting a basic amino acid residue (Lys, Arg, His) for another basic amino acid residue (Lys, Arg, His), substituting an aliphatic amino acid residue (Gly, Ala, Val, Leu, Ile) for another aliphatic amino acid residue, substituting an aromatic amino acid residue (Phe, Tyr, Trp) for another aromatic amino acid residue, substituting threonine by serine or leucine by isoleucine. Further conservative amino acid exchanges will be known to the person skilled in the art.
- the isomer form should preferably be maintained, e.g. K is preferably substituted for R or H, while k is preferably substituted for r and h.
- JNK inhibitor variants are for example if:
- % sequence identity has to be understood as follows: Two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting “gaps” in either one or both sequences, to enhance the degree of alignment. A % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
- an amino acid sequence having a “sequence identity” of at least, for example, 95% to a query amino acid sequence is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted.
- BESTFIT uses the “local homology” algorithm of (Smith and Waterman (1981), J. Mol. Biol. 147, 195-197.) and finds the best single region of similarity between two sequences.
- the JNK inhibitor according to the present invention may comprise—aside of the inhibitory (poly-)peptide sequence mentioned above—additional sequences, domains, labels (e.g. fluorescent or radioactive labels), epitopes etc. as long as the ability to inhibit JNK activity as defined herein is not lost.
- the JNK inhibitor according to the present invention may also comprise a transporter sequence.
- a “transporter sequence” as used herein, is a (poly-)peptide sequence providing for translocation of the molecule it is attached to across biological membranes.
- a JNK inhibitor according to the present invention comprising a transporter sequence is preferably capable of translocating across biological membranes.
- such JNK inhibitor of the present invention may more readily enter a cell, a cellular subcompartment and/or into the nucleus of a cell.
- Said transporter sequence may be joined for example (e.g. directly) N-terminally or (e.g. directly) C-terminally to the inhibitory (poly-)peptide sequence of the JNK inhibitor.
- the transporter sequence and the inhibitory (poly-)peptide sequence may also be spaced apart, e.g. may be separated by intermediate sequences. It is also contemplated that the transporter sequence may be positioned entirely elsewhere in the JNK inhibitor molecule than the inhibitory (poly-)peptide sequence, in particular if the JNK inhibitor is a more complex molecule (e.g. comprising several domains, is a multimeric conjugate etc.). It is also contemplated that the transporter sequence and the inhibitory (poly-)peptide sequence may overlap as long as the JNK inhibitory activity is maintained. Examples for such overlap are given further below.
- Transporter sequences for use with the JNK inhibitor of the present invention may be selected from, without being limited thereto, transporter sequences derived from HIV TAT (HIV), e.g. native proteins such as e.g. the TAT protein (e.g. as described in U.S. Pat. Nos. 5,804,604 and 5,674,980, each of these references being incorporated herein by reference), HSV VP22 (Herpes simplex) (described in e.g. WO 97/05265; Elliott and O'Hare, Cell 88 : 223-233 (1997)), non-viral proteins (Jackson et al, Proc. Natl. Acad. Sci.
- HIV TAT HIV TAT
- native proteins such as e.g. the TAT protein (e.g. as described in U.S. Pat. Nos. 5,804,604 and 5,674,980, each of these references being incorporated herein by reference)
- HSV VP22 Herpes simplex
- transporter sequences derived from Antennapedia particularly from Drosophila antennapedia (e.g. the antennapedia carrier sequence thereof), FGF, lactoferrin, etc. or derived from basic peptides, e.g. peptides having a length of 5 to 15 amino acids, preferably 10 to 12 amino acids and comprising at least 80%, more preferably 85% or even 90% basic amino acids, such as e.g. arginine, lysine and/or histidine, or may be selected from e.g.
- arginine rich peptide sequences such as RRRRRRRRR (R 9 ; SEQ ID NO: 152), RRRRRRRR (R 8 ; SEQ ID NO: 153), RRRRRRR (R 7 ; SEQ ID NO: 154), RRRRRR (R 6 , SEQ ID NO: 155), RRRRR (R 6 , SEQ ID NO: 156) etc., from VP22, from PTD-4 proteins or peptides, from RGD-K 16 , from PEPT1/2 or PEPT1/2 proteins or peptides, from SynB3 or SynB3 proteins or peptides, from PC inhibitors, from P21 derived proteins or peptides, or from JNKI proteins or peptides.
- transporter sequences for use in the JNK inhibitor of the present invention are in particular, without being limited thereto, basic transporter sequences derived from the HIV-1 TAT protein.
- the basic transporter sequence of the HIV-1 TAT protein may include sequences from the human immunodeficiency virus HIV-1 TAT protein, e.g. as described in, e.g., U.S. Pat. Nos. 5,804,604 and 5,674,980, each incorporated herein by reference.
- the full-length HIV-1 TAT protein has 86 amino acid residues encoded by two exons of the HIV TAT gene. TAT amino acids 1-72 are encoded by exon 1, whereas amino acids 73-86 are encoded by exon 2.
- the full-length TAT protein is characterized by a basic region which contains two lysines and six arginines (amino acids 49-57) and a cysteine-rich region which contains seven cysteine residues (amino acids 22-37).
- the basic region i.e., amino acids 49-57
- the cysteine-rich region mediates the formation of metal-linked dimers in vitro (Frankel, A. D. et al, Science 240: 70-73 (1988); Frankel, A. D.
- Preferred TAT transporter sequences for use in the JNK inhibitor of the present invention are preferably characterized by the presence of the TAT basic region amino acid sequence (amino acids 49-57 of naturally-occurring TAT protein); the absence of the TAT cysteine-rich region amino acid sequence (amino acids 22-36 of naturally-occurring TAT protein) and the absence of the TAT exon 2-encoded carboxy-terminal domain (amino acids 73-86 of naturally-occurring TAT protein). More preferably, the transporter sequence in the JNK inhibitor of the present invention may be selected from an amino acid sequence containing TAT residues 48-57 or 49 to 57 or variants thereof.
- the transporter sequence in a given JNK inhibitor of the present invention also exhibits D-amino acids, for example in order to improve stability towards proteases.
- Particularly preferred are transporter sequences which exhibit a specific order of alternating D- and L-amino acids. Such order of alternating D- and L-amino acids (the motif) may follow—without being limited thereto—the pattern of any one of SEQ ID NOs: 28-30:
- Said order of D- and L-amino acids becomes relevant when the transporter sequence is synthesized, i.e. while the amino acid sequence (i.e. the type of side chain residues) remains unaltered, the respective isomers alternate.
- a known transporter sequence derived from HIV TAT is RKKRRQRRR (SEQ ID NO: 43). Applying the D-/L amino acid order of SEQ ID NO: 30 thereto would yield rKKRrQRRr (SEQ ID NO: 46).
- the transporter sequence of the JNK inhibitor of the present invention may comprise at least one sequence according to rXXXrXXXr (SEQ ID NO: 31), wherein:
- transporter sequences for use in the inventive JNK inhibitor molecule may be selected, without being limited thereto, from sequences as given in table 2 below, (SEQ ID NOs: 31-170) or from any fragment or variant or chemically modified derivative thereof (preferably it retains the function of translocating across a biological membrane).
- transporter sequences may also be selected from fragments or variants of the above sequences of table 2 (with the proviso that such fragment or variant retain preferably the function to provide for translocation across biological membranes).
- variants and/or fragments of those transporter sequences preferably comprise a peptide sequence sharing at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 85%, preferably at least 90%, more preferably at least 95% and most preferably at least 99% sequence identity over the whole length of the sequence of such a transporter sequence as defined in Table 2.
- a “fragment” of a transporter sequence as defined in Table 2 is preferably to be understood as a truncated sequence thereof, i.e. an amino acid sequence, which is N-terminally, C-terminally and/or intrasequentially truncated compared to the amino acid sequence of the original sequence.
- a “variant” of a transporter sequence or its fragment as defined above is preferably to be understood as a sequence wherein the amino acid sequence of the variant differs from the original transporter sequence or a fragment thereof as defined herein in one or more mutation(s), such as one or more substituted, (or, if necessary, inserted and/or deleted) amino acid(s).
- variants of such a transporter sequence as defined above have the same biological function or specific activity compared to the respective original sequence, i.e. provide for transport, e.g. into cells or the nucleus.
- a variant of such a transporter sequence as defined above may for example comprise about 1 to 50, 1 to 20, more preferably 1 to 10 and most preferably 1 to 5, 4, 3, 2 or 1 amino acid alterations.
- Variants of such a transporter sequence as defined above may preferably comprise conservative amino acid substitutions. The concept of conservative amino acid substitutions is known in the art and has already been set out above for the JNK inhibitory (poly-)peptide sequence and applies here accordingly.
- the length of a transporter sequence incorporated in the JNK inhibitor of the present invention may vary. It is contemplated that in some embodiments the transporter sequence of the JNK inhibitor according to the present invention is less than 150, less than 140, less than 130, less than 120, less than 110, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 20, and/or less than 10 amino acids in length.
- the JNK inhibitor comprising a transporter domain may be fused to a label, e.g. a fluorescent protein such as GFP, a radioactive label, an enzyme, a fluorophore, an epitope etc. which can be readily detected in a cell.
- a label e.g. a fluorescent protein such as GFP, a radioactive label, an enzyme, a fluorophore, an epitope etc. which can be readily detected in a cell.
- the JNK inhibitor comprising the transporter sequence and the label is transfected into a cell or added to a culture supernatant and permeation of cell membranes can be monitored by using biophysical and biochemical standard methods (for example flow cytometry, (immuno)fluorescence microscopy etc.).
- JNK inhibitors according to the present invention comprising a transporter sequence are given in table 3:
- JNK inhibitors comprising an inhibitory (poly-)peptide sequence and a transporter sequence
- Amino acid sequence AA SEQ ID NO: rKKRrQRRrRPk R PTT L N L f 20 171 rKKRrQRRrRPk R PaT L N L f 20 172 rKKRrQRRrRPk R PTT L r L f 20 173 rKKRrQRRr R PTT L N L f 17 174 rKKRrQRr R PTT L N L f 16 175 rKKRrQRRrRPk R PTT L N L w 20 176 rKKRrQRRrRPk R PTD L N L f 20 177 rKKRrQRRr R PTT L r L w 17 178 rKKRrQRr R PTT L r L w 16 179 rKKRrQRRr R PTD L r L w 17 180 rKKRrQRr R PTD L AA
- the transporter sequence and the inhibitory (poly-)peptide sequence may overlap.
- the N-terminus of the transporter sequence may overlap with the C-terminus of the inhibitory (poly-)peptide sequence or the C-terminus of the transporter sequence may overlap with the N-terminus of the inhibitory (poly-)peptide sequence.
- the transporter sequence overlaps by one, two or three amino acid residues with the inhibitory (poly-) peptide sequence.
- a given transporter sequence may overlap with SEQ ID NO:1 or the respective variants thereof at position 1 (X1), position 1 and 2 (X1, X2), positions 1, 2 and 3 (X1, X2, X3).
- SEQ ID NOs: 174, 175, 178, 179, 180, 181, 182, 183, 184, 188, 189 and 190 are good examples for JNK inhibitors according to the present invention, wherein transporter sequence and the inhibitory (poly-)peptide sequence overlap, e.g. rKKRrQRRr RPTTLNLf (SEQ ID NO: 174) is an overlap of SEQ ID NO: 46 (underlined) and SEQ ID NO: 11 (italics).
- JNK inhibitor according to the present invention may also be selected from JNK inhibitors, which are a variant of any one of the JNK inhibitors according to SEQ ID NOs: 171-190.
- such variant shares at least 50%, more preferably at least 55%, more preferably at least 60%, more preferably at least 65%, more preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with the sequence of SEQ ID NOs: 171-190, in particular with SEQ ID NO: 172,
- non-identical amino acids in the variants of JNK inhibitors comprising SEQ ID NOs: 171-190 are preferably the result of conservative amino acid substitutions (see above).
- substitutions mentioned above are also contemplated for variants of JNK inhibitors comprising SEQ ID NOs: 171-190.
- the present invention certainly also contemplates variants of any one of the JNK inhibitors according to SEQ ID NOs: 171-190, which deviate from the original sequence not or not exclusively in the inhibitory (poly-)peptide sequence, but exhibits variant residues in the transporter sequence.
- variants and fragments of transporter sequences see in particular respective disclosure above.
- the transporter sequence and the JNK inhibitory (poly)-peptide sequence of the JNK inhibitors according to the present invention need not necessarily be directly joined to each other. They may also be spaced apart, e.g. by intermediate (poly-)peptide sequences.
- Preferred intermediate sequences separating the inhibitory (poly-)peptide sequences and other (functional) sequences such as transporter sequences consist of short peptide sequences less than 10 amino acids in length like a hexamer, a pentamer, a tetramer, a tripeptide or even only a dipeptide or a single amino acid residue.
- Particularly preferred intermediate sequence are one, two or more copies of di-proline, di-glycine, di-arginine and/or di-lysine, all either in L-amino acid form only, or in D-amino acid form only, or with mixed D- and L-amino acids.
- di-proline, di-glycine, di-arginine and/or di-lysine all either in L-amino acid form only, or in D-amino acid form only, or with mixed D- and L-amino acids.
- di-proline di-glycine
- di-arginine and/or di-lysine all either in L-amino acid form only, or in D-amino acid form only, or with mixed D- and L-amino acids.
- other known peptide spacer sequences may be employed as well.
- a particularly preferred JNK inhibitor according to the present invention comprises SEQ ID NO: 8 (or a sequence sharing sequence identity with SEQ ID NO: 8 with the scope and limitations defined further above) and a transporter sequence.
- the transporter sequence is preferably selected from any one of SEQ ID Nos: 31-170 or variants thereof as defined herein, even more preferably from any one of SEQ ID NOs: 31-34 and 46-151.
- a particularly preferred embodiment of a JNK inhibitor according to the present invention is a JNK inhibitor comprising SEQ ID NO: 8 and SEQ ID NO: 46 (or sequences sharing respective sequence identity thereto within the scope and limitations defined further above).
- a preferred example is a JNK inhibitor comprising the sequence of SEQ ID NO: 172 or respective variants thereof varying in the transporter sequence and/or the inhibitory (poly-)peptide sequence as defined herein.
- the present invention relates to a JNK inhibitor comprising
- transporter sequence and the inhibitory (poly-)peptide sequence may overlap.
- Preferred transporter sequences for said embodiment of the invention are particularly the transporter sequence of SEQ ID NO: 46, preferably joined (e.g. directly) to the N-Terminus of the inhibitory (poly-)peptide sequence.
- a JNK inhibitor of the present invention may also be a JNK inhibitor comprising or consisting of the sequence GRKKRRQRRRPPKRPTTLNLFPQVPRSQD (SEQ ID NO: 194), or the sequence GRKKRRQRRRPTTLNLFPQVPRSQD (SEQ ID NO: 195).
- the present invention relates to a (poly-)peptide comprising a transporter sequence selected from the group of sequences consisting of rKKRrQRr (SEQ ID NO: 148), rKKRrQRrK (SEQ ID NO: 149), and/or rKKRrQRrR (SEQ ID NO: 150).
- comprising a certain sequence or a certain SEQ ID NO: usually implies that (at least) one copy of said sequence is present, e.g. in the JNK inhibitor molecule.
- one inhibitory (poly-)peptide sequence will usually suffice to achieve sufficient inhibition of JNK activity.
- the inventor certainly contemplate that the use of two or more copies of the respective sequence (e.g. two or more copies of an inhibitory (poly-)peptide sequence of different or same type and/or two or more copies of a transporter sequence of different or the same type) may also employed as long as the overall ability of the resulting molecule to inhibit JNK activity is not abolished (i.e. the respective molecule is still a JNK inhibitor as defined herein).
- inventive JNK inhibitors may be obtained or produced by methods well-known in the art, e.g. by chemical synthesis via solid-phase peptide synthesis using Fmoc (9-fluorenylmethyloxycarbonyl) strategy, i.e. by successive rounds of Fmoc deprotection and Fmoc-amino acid coupling cycles.
- Fmoc (9-fluorenylmethyloxycarbonyl) strategy i.e. by successive rounds of Fmoc deprotection and Fmoc-amino acid coupling cycles.
- a commercial service offering such peptide synthesis is provided by many companies, for example the company PolyPeptide (Stra ⁇ bourg, France).
- JNK inhibitors for use according to the present invention may optionally be further modified, in particular at the amino acid residues of the inhibitory (poly-peptide) sequence. Possible modifications may for example be selected from the group consisting of:
- the present invention relates in a further aspect to a JNK inhibitor as disclosed herein modified with modifications selected from (i) to (xi) or modified with a combination of two or more of the elements mentioned under (i) to (xi), and a pharmaceutical composition (see below) comprising such modified JNK inhibitor.
- the JNK inhibitors as defined according to the invention can be formulated in a pharmaceutical composition, which may be applied in the prevention or treatment of any of the diseases as defined herein.
- a pharmaceutical composition used according to the present invention includes as an active component a JNK inhibitor as defined herein, in particular a JNK inhibitor comprising or consisting of an inhibitory (poly-)peptide sequence according to SEQ ID NO: 1, as defined herein.
- the active compound is a JNK inhibitor comprising or consisting of an inhibitory (poly-)peptide sequence according to any one of SEQ ID NOs: 2-27; or, if a transporter sequence is attached, according to any one of SEQ ID NOs: 171-190.
- the inventors of the present invention additionally found, that the JNK-inhibitors as defined herein, in particular if fused to a transporter sequence; exhibit a particular well uptake rate into cells involved in the diseases of the present invention. Therefore, the amount of a JNK-inhibitor inhibitor in the pharmaceutical composition to be administered to a subject, may—without being limited thereto—have a very low dose. Thus, the dose may be much lower than for peptide drugs known in the art, such as DTS-108 (Florence Meyer-Losic et al., Clin Cancer Res., 2008, 2145-53). This has several positive aspects, for example a reduction of potential side reactions and a reduction in costs.
- the dose (per kg bodyweight) is in the range of up to about 10 mmol/kg, preferably up to about 1 mmol/kg, more preferably up to about 100 pmol/kg, even more preferably up to about 10 pmol/kg, even more preferably up to about 1 pmol/kg, even more preferably up to about 100 nmol/kg, most preferably up to about 50 nmol/kg.
- the dose range may preferably be from about 1 pmol/kg to about 1 mmol/kg, from about 10 pmol/kg to about 0.1 mmol/kg, from about 10 pmol/kg to about 0.01 mmol/kg, from about 50 pmol/kg to about 1 pmol/kg, from about 100 pmol/kg to about 500 nmol/kg, from about 200 pmol/kg to about 300 nmol/kg, from about 300 pmol/kg to about 100 nmol/kg, from about 500 pmol/kg to about 50 nmol/kg, from about 750 pmol/kg to about 30 nmol/kg, from about 250 pmol/kg to about 5 nmol/kg, from about 1 nmol/kg to about 10 nmol/kg, or a combination of any two of said values.
- a “safe and effective amount” for components of the pharmaceutical compositions as used according to the present invention means an amount of each or all of these components, that is sufficient to significantly induce a positive modification of diseases or disorders strongly related to JNK signalling as defined herein.
- a “safe and effective amount” is small enough to avoid serious side-effects, that is to say to permit a sensible relationship between advantage and risk. The determination of these limits typically lies within the scope of sensible medical judgment.
- a “safe and effective amount” of such a component will vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the pharmaceutical compositions according to the invention can be used according to the invention for human and also for veterinary medical purposes.
- composition as used according to the present invention may furthermore comprise, in addition to one or more of the JNK inhibitors, a (compatible) pharmaceutically acceptable carrier, excipient, buffer, stabilizer or other materials well known to those skilled in the art.
- the expression “(compatible) pharmaceutically acceptable carrier” preferably includes the liquid or non-liquid basis of the composition.
- the term “compatible” means that the constituents of the pharmaceutical composition as used herein are capable of being mixed with the pharmaceutically active component as defined above and with one another component in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the composition under usual use conditions.
- Pharmaceutically acceptable carriers must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a person to be treated.
- the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable liquid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable liquid carriers e.g. pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g. phosphate, citrate etc. buffered solutions, vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma ; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid, etc.
- a buffer preferably an aqueous buffer, may be used.
- the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable solid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable solid carriers e.g. one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well, which are suitable for administration to a person.
- suitable pharmaceutically acceptable solid carriers are e.g.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn starch or potato starch
- cellulose and its derivatives such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate
- powdered tragacanth malt
- gelatin gelatin
- tallow solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulphate, etc.
- the precise nature of the (compatible) pharmaceutically acceptable carrier or other material may depend on the route of administration.
- the choice of a (compatible) pharmaceutically acceptable carrier may thus be determined in principle by the manner in which the pharmaceutical composition as used according to the invention is administered.
- the pharmaceutical composition as used according to the invention can be administered, for example, systemically.
- Routes for administration include, for example, parenteral routes (e.g. via injection), such as intravenous, intramuscular, subcutaneous, intradermal, or transdermal routes, etc., enteral routes, such as oral, or rectal routes, etc., topical routes, such as nasal, or intranasal routes, etc., or other routes, such as epidermal routes or patch delivery.
- parenteral routes e.g. via injection
- enteral routes such as oral, or rectal routes, etc.
- topical routes such as nasal, or intranasal routes, etc.
- administration may occur intratympanical, for example if ear related diseases are treated.
- the suitable amount of the pharmaceutical composition to be used can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
- Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
- Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
- Suitable pharmaceutically acceptable carriers for topical application include those, which are suitable for use in lotions, creams, gels and the like. If the compound is to be administered per orally, tablets, capsules and the like are the preferred unit dose form.
- the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art. The choice thereof will depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
- compositions for oral administration may be in tablet, capsule, powder or liquid form.
- a tablet may include a solid carrier as defined above, such as gelatin, and optionally an adjuvant.
- Liquid pharmaceutical compositions for oral administration generally may include a liquid carrier as defined above, such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a “prophylactically effective amount or a “therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a “prophylactically effective amount” as the case may be
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated.
- Treatment of a disease as defined herein typically includes administration of a pharmaceutical composition as defined above.
- the JNK inhibitors of the present invention will modulate the JNK activity in the subject.
- the term “modulate” includes in particular the suppression of phosphorylation of c-jun, ATF2 or NFAT4 in any of the above diseases, for example, by using at least one JNK inhibitor comprising or consisting of an inhibitory (poly)peptide sequence according to any of sequences of SEQ ID NOs: 2 to 27, potentially comprising an additional transporter sequence, as a competitive inhibitor of the natural c-jun, ATF2 and NFAT4 binding site in a cell.
- modulate also includes suppression of hetero- and homomeric complexes of transcription factors made up of, without being limited thereto, c-jun, ATF2, or NFAT4 and their related partners, such as for example the AP-1 complex that is made up of c-jun, AFT2 and c-fos.
- Treatment of a subject with the pharmaceutical composition as disclosed above may be typically accomplished by administering (in vivo) an (“therapeutically effective”) amount of said pharmaceutical composition to a subject, wherein the subject may be e.g. a human subject or an animal.
- the animal is preferably a non-human mammal, e.g., a non-human primate, mouse, rat, dog, cat, cow, horse or pig.
- therapeutically effective means that the active component of the pharmaceutical composition is of sufficient quantity to ameliorate the diseases and disorders as discussed herein.
- the gist of the present invention is to use the above disclosed JNK inhibitors and pharmaceutical compositions in a method for treatment of the human or animal body by therapy, in particular of the human body.
- JNK signalling is involved in a multitude of diverse disease states and disorder and inhibition of said signalling has proposed and successfully tested for many of these.
- the inventors of the present invention found that the JNK inhibitors disclosed herein are effective JNK inhibitors and are thus equally suitable for the treatment of the diseases as disclosed in the art.
- Treatment of a human or animal body by therapy refers to any kind of therapeutic treatment of a respective subject. It includes for example prevention of onset of the disease or symptoms (prophylaxis), i.e. typically prior to manifestation of the disease in the patient.
- the term also includes the “mere” treatment of symptoms of a given disease, i.e. the treatment will ameliorate pathogenesis by reducing disease associated symptoms, without necessarily curing the underlying cause of the disease and symptoms. Certainly, curing the underlying cause of the disease is also encompassed by the term.
- the term also encompasses a treatment which delays or even stops progression of the respective disease.
- the JNK inhibitors according to the present invention may be administered for example prophylactically prior to potential onset of a foreseeable disorder, e.g. prior to a planned surgical intervention or planned exposure to stressful stimuli.
- a surgical intervention could for example bear the risk of inflammation of the respective wound or neighbouring tissue (e.g. dry eye syndrome after surgical eye treatment, peri-implantitis after dental implantation treatment, rejection of the graft after transplantation, etc.).
- Exposure to stressful stimuli like radiation could lead to apoptosis of affected tissue and cells.
- the JNK inhibitors according to the present invention may for example be administered at least once up to about 4 weeks in advance.
- the JNK inhibitors may for example be administered at least 24 hours, at least 48 hours, at least 1 week, at least 2 weeks or 4 weeks in advance.
- the diseases and disorders to be treated with the JNK inhibitors as disclosed herein may be acute or chronic.
- the JNK inhibitors of the present invention may for example be used for the treatment of diseases of various organs, such as diseases of the eye, diseases of the bone, neural diseases, neuronal diseases, neurodegenerative diseases, diseases of the skin, immune and/or autoimmune diseases, diseases of the eye, diseases of the mouth, inflammatory diseases, metabolic diseases, cardiovascular diseases, proliferative diseases (in particular cancers and tumors), diseases of the ear, diseases of the intestine, diseases of the respiratory system (e.g. lung diseases), infectious diseases, and various other diseases.
- diseases of various organs such as diseases of the eye, diseases of the bone, neural diseases, neuronal diseases, neurodegenerative diseases, diseases of the skin, immune and/or autoimmune diseases, diseases of the eye, diseases of the mouth, inflammatory diseases, metabolic diseases, cardiovascular diseases, proliferative diseases (in particular cancers and tumors), diseases of the ear, diseases of the intestine, diseases of the respiratory system (e.g. lung diseases), infectious diseases, and various other diseases.
- the JNK inhibitors of the present invention may be used for example for the treatment of inflammatory diseases including for example acute inflammation as well as chronic inflammation.
- the JNK inhibitors of the present invention may be used to treat any type of tissue inflammation, e.g. inflammation in the eye, inflammation in the mouth, inflammation of the respiratory system including in particular the lung, inflammation of the skin, inflammation within the cardiovascular system, inflammation of the brain, inflammation in the ear, etc.
- tissue inflammation e.g. inflammation in the eye, inflammation in the mouth, inflammation of the respiratory system including in particular the lung, inflammation of the skin, inflammation within the cardiovascular system, inflammation of the brain, inflammation in the ear, etc.
- Some non-limiting examples for such inflammatory disease states are mucositis, stomatitis, peri-implantitis, retinitis, chorioiditis, keratoconjunctivitis sicca, inflammatory bowel diseases (IBD), uveitis (e.g.
- the JNK inhibitors as disclosed herein may for example be used in methods of treatment of ear diseases (in particular diseases of the inner ear), hearing loss (in particular acute hearing loss), damaged hair cell stereocilia, hair cell apoptosis, noise trauma, otitis, otitis media etc.
- Hearing loss and associated hair cell apoptosis are non-limiting examples for disorders resulting from stress situations for cells in which JNK inhibition can modulate the stress response and for example block apoptosis.
- the JNK inhibitors of the present invention may also be used for the treatment of metabolic disorders, for example for the treatment of diabetes (type 1 or type 2, in particular type 1), Fabry disease, Gaucher disease, hypothermia, hyperthermia hypoxia, lipid histiocytosis, lipidoses, metachromatic leukodystrophy, mucopolysaccharidosis, Niemann Pick disease, obesity, and Wolman's disease.
- Diabetes type 1 or type 2, in particular type 1
- hypothermia hyperthermia hypoxia
- lipid histiocytosis lipid histiocytosis
- lipidoses metachromatic leukodystrophy
- mucopolysaccharidosis Niemann Pick disease
- obesity obesity
- Wolman's disease Hypothermia, hyperthermia and hypoxia are again non-limiting examples for stress situations for cells in which JNK inhibition can modulate the stress response and for example block apoptosis.
- the JNK inhibitors of the present invention may be used for the treatment of neural, neuronal and/or neurodegenerative diseases, respectively.
- diseases are for example Alexander disease, Alzheimer's disease, amyotrophic lateral sclerosis (ALS), apoplexy, Ataxia Telangiectasia, cut or otherwise disrupted axons, axotomy, brain lesions, CMT (Charcot-Marie-Tooth), corticobasal degeneration, dementia, diseases or disorders of the nervous system, dystonia, epilepsy, Farber's disease, Friedreich ataxia (SCA), gangliosidoses, Guillain-Barré syndrome, hereditary spastic paraplegia, Hirschsprung's disease, human immunodeficiency virus dementia, Huntington's disease, infarct of the brain, ischemic stroke, Krabbe disease, Lennox Gastaut Syndrome, lissencephaly, multiple sclerosis, myelodysplastic syndromes, myelopathy,
- the JNK inhibitor peptides of the present invention may for example be used in a method of treatment of autoimmune diseases of the CNS, auto-inflammatory diseases, Celiac disease; Sjogren's syndrome, systemic lupus erythematosus etc.
- bone diseases which may be treated with the JNK inhibitors of the present invention are for example arthritis, disc herniation, fibrodysplasia ossificans progressiva (FOP), osteoarthritis, osteopetrosis, osteoporosis, in particular diabetes induced osteoporosis, Paget's Disease, rheumatoid arthritis, etc.
- FOP fibrodysplasia ossificans progressiva
- osteoarthritis osteopetrosis
- osteoporosis in particular diabetes induced osteoporosis
- Paget's Disease Paget's Disease
- rheumatoid arthritis etc.
- Examples for skin diseases which may be treated with the JNK inhibitors of the present invention are for example psoriasis and lupus erythematosus.
- Diseases of the eye which may be treated with the JNK inhibitors of the present invention involve for example age-related macular degeneration (AMD); angioid streaks; anterior ischemic optic neuropathy; anterior uveitis; cataract, in particular age related cataract; central exudative chorioretinopathy; central serous chorioretinopathy; chalazion; chorioderemia; chorioiditis; choroidal sclerosis; conjunctivitis; cyclitis; diabetic retinopathy; dry eye syndrome; endophthalmitis; episcleritis; eye infection; fundus albipunctatus; gyrate atrophy of choroid and retina; hordeolum; inflammatory diseases of the blephara; inflammatory diseases of the choroid; inflammatory diseases of the ciliary body; inflammatory diseases of the conjunctiva; inflammatory diseases of the cornea; inflammatory diseases of the iris; inflammatory diseases of the lacrimal gland; inflammatory diseases of the orbit
- NMDA induced retinotoxicity non-chronic or chronic inflammatory eye diseases; Oguchi's disease; optic nerve disease; orbital phlegmon; panophtalmitis; panuveitis; post caspule opacification; posterior capsule opacification (PCO) (a cataract after-surgery complication); posterior uveitis; proliferative vitreoretinopathy; retinal artery occlusion; retinal detachment, retinal diseases; retinal injuries; retinal macroaneurysm; retinal pigment epithelium detachment; retinal vein occlusion; retinitis; retinitis pigmentosa; retinitis punctata albescens; retinopathy, in particular retinopathy of prematurity and diabetic retinopathy; scleritis; Stargardt's disease; treatment of inflamed ocular wounds and
- Exemplary diseases of the mouth which may be treated with the JNK inhibitors as disclosed herein are periodontitis, in particular chronic periodontitis; mucositis, oral desquamative disorders, oral liquen planus, pemphigus vulgaris, pulpitis; stomatitis; temporomandibular joint disorder, peri-implantitis etc.
- JNK inhibitors of the present invention may—as already previously proposed for other JNK inhibitors—be used for the treatment of proliferative diseases like cancer and tumor diseases, such as acusticus neurinoma lung carcinomas; acute lymphocytic leukemia (L1, L2, L3); acute lymphoid leukaemia (ALL); acute myelogenous leukemia (AML); adenocarcinomas; anal carcinoma; bronchial carcinoma; cervix carcinoma; cervical cancer; astrocytoma; basalioma; cancer with Bcr-Abl transformation; bladder cancer; blastomas; bone cancer; brain metastases; brain tumours; breast cancer; Burkitt's lymphoma; carcinoids; cervical cancer; chronic lymphocytic leukaemia (CLL); chronic myeloid leukaemia (CML); colon cancer; colon carcinoma; corpus carcinoma; craniopharyngeomas; CUP syndrome; virus-induced tumours; EBV-induced B cell lympho
- the inhibitors of the present invention may be used accordingly, e.g. for the treatment of cardiovascular diseases such as arterial hypertension; arteriosclerosis; arteriosclerotic lesions; Behcet's syndrome; bifurcations of blood vessels; cardiac hypertrophy; cardiavascular hypertrophy; cardiomyopathies, in particular chemotherapy induced cardiomyopathies; cerebral ischemia; coronary heart diseases; dilatation of the abdominal aorta; focal cerebral ischemia; global cerebral ischemia; heart hypertrophy; infrarenal aneurism hypertension; ischemia; myocardial infarct, in particular acute myocardial infarction; myocarditis; reperfusion; restenosis; vasculitis; Wegener's granulomatosis; etc.
- cardiovascular diseases such as arterial hypertension; arteriosclerosis; arteriosclerotic lesions; Behcet's syndrome; bifurcations of blood vessels; cardiac hypertrophy; cardiavascular hypertrophy; cardiomyopathies, in particular chemotherapy
- the JNK inhibitors of the present invention may in the context of cardiovascular diseases also be used complementary to coronary artery bypass graft surgery (CABG surgery); percutaneous transluminal coronary angioplasty (PTCA); and/or stent treatment, for example to prevent or treat intimal hyperplasia resulting from said (surgical) treatment.
- CABG surgery coronary artery bypass graft surgery
- PTCA percutaneous transluminal coronary angioplasty
- stent treatment for example to prevent or treat intimal hyperplasia resulting from said (surgical) treatment.
- ARDS acute respiratory distress syndrome
- COPD chronic obstructive pulmonary disease
- cystic fibrosis inflammatory lung diseases; pneumonia; pulmonary fibrosis; etc.
- the inhibitors of the present invention may also be used to treat disease of the intestinal tract, e.g. colitis (e.g. atypical colitis, chemical colitis; collagenous colitis, distal colitis, diversion colitis; fulminant colitis, indeterminate colitis, infectious colitis, ischemic colitis, lymphocytic colitis, or microscopic colitis), Crohn's disease, gastroenteritis, Hirschsprung's disease, inflammatory digestive diseases; inflammatory bowel disease (IBD), Morbus Crohn, non-chronic or chronic digestive diseases, non-chronic or chronic inflammatory digestive diseases; regional enteritis; ulcerative colitis etc.
- colitis e.g. atypical colitis, chemical colitis; collagenous colitis, distal colitis, diversion colitis; fulminant colitis, indeterminate colitis, infectious colitis, ischemic colitis, lymphocytic colitis, or microscopic colitis
- Crohn's disease gastroenteritis, Hirschsprung's disease, inflammatory digestive diseases
- the JNK inhibitors of the present invention may also serve as therapeutic agent for the treatment of infectious diseases resulting from e.g. bacterial or viral infection.
- the JNK inhibitors as disclosed herein may for example prevent or ameliorate inflammatory reactions caused by said infections.
- diseases states which are not considered to be limiting, are viral encephalitis; viral induced cancers (e.g. as mentioned above), human immunodeficiency virus dementia, meningitis, meningoencephalitis, encephalomyelitis, tonsillitis, etc.
- JNK inhibitors of the present invention can be used as treatment, for example Aarskog syndrome, acetaminophen hepatotoxicity; Alder-Reilly anomaly; alopecia greata; alpha-1-antitrypsin deficiency; anaphylaxis; apoptosis; apoptotic cell death; atypical hemolytic uremic syndrome; basopenia; basophilia; bipolar disorders; burns; cellular shear stress; Chedial-Higashi syndrome; DNA damage due to chemotherapeutic drugs; cholestasis; chromosome 11, Partial Monosomy 11q; chromosome 22, Trisomy Mosaic; chronic granulomatous disease; hepatitis, such as chronic or fulminant hepatitis; clinical depression; common variable hypogammaglobulinemia; congenital C3 deficiency; CTL protection from activation-induced cell death (AICD); deafness; depression and
- the inventors of the present invention consider temporomandibular joint disorder, mucositis, stomatitis, oral liquen planus (desquamative disorder), Pemphigus vulgaris (desquamative disorder), periodontitis, chronic periodontitis, pulpitis, peri-implantitis, uveitis (anterior uveitis, intermediate uveitis, posterior uveitis), keratoconjunctivitis sicca (dry eye syndrome), coronary artery bypass graft surgery (CABG surgery), acute myocardial infarction, prevention of intimal hyperplasia following percutaneous transluminal coronary angioplasty (PTCA), prevention of intimal hyperplasia following stent placement, atherosclerosis, COPD, asthma, rheumatoid arthritis, osteoarthritis, Crohn's disease, inflammatory bowel disease (IBD), psoriasis, diabetes, stroke, Parkinson's disease, Alzheimer's disease, systemic
- bronchial carcinoma is certainly not only a proliferative disease but would also belong in the group of diseases of the respiratory system including lung diseases.
- classification of individual diseases is not considered to be limiting or concluding but is considered to of exemplary nature only. It does not preclude that individual disease states recited in one class are factually also suitable examples for the application of the JNK inhibitors of the present invention as treatment in another class of disease states.
- a person skilled in the art will readily be capable of assigning the different disease states and disorders to matching classifications.
- the present invention contemplates the use of a JNK inhibitor as defined herein for the treatment of various diseases states and disorders.
- the present invention does not contemplate to use the JNK inhibitors as defined herein for immunizing non-human animals, e.g. for the production of monoclonal antibodies. Such methods are herein not considered to be methods for treatment of the animal body by therapy.
- synthesis of the JNK inhibitor with SEQ ID NO: 172 is set out below. A person skilled in the art will know that said synthesis may also be used for and easily adapted to the synthesis of any other JNK inhibitor according to the present invention.
- the JNK inhibitor with SEQ ID NO: 172 was manufactured by solid-phase peptide synthesis using the Fmoc (9-fluorenylmethyloxycarbonyl) strategy.
- the linker between the peptide and the resin was the Rink amide linker (p-[Fmoc-2,3-dimethoxybenzyl]-phenoxyacetic acid).
- the peptide was synthesized by successive Fmoc deprotection and Fmoc-amino acid coupling cycles.
- the completed peptide was cleaved by trifluoroacetic acid (TFA) directly to yield the crude C-terminal amide, which was then purified by preparative reverse phase HPLC.
- the purified fractions were pooled in a homogeneous batch that is treated by ion exchange chromatography to obtain its acetate salt.
- the peptide was then freeze-dried.
- the p-methylbenzhydrylamide resin (MBHA-resin) was first washed with dichloromethane/dimethylformamide/diisoproplyethylamine under nitrogen. The washed resin was then coupled to the Rink amide linker (p-[Fmox-2,4-dimethoxybenzyl]-phenoxyacetic acid) in PyBOB (benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate)/diisopropylethylamine/1-hydroxybenzotriazole to yield Fmoc-Rink amide-MBNA resin.
- Rink amide linker p-[Fmox-2,4-dimethoxybenzyl]-phenoxyacetic acid
- PyBOB benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate
- the Fmoc-Rink amide-MBHA resin was deprotected by washing it in 35% (v/v) piperidine/dimethylformamide, followed by dimethylformamide. The deprotection reaction took approximately 16 minutes.
- Fmoc-protected amino acids e.g., 2 eq of amino acid and HOBt (1-hydroxybenzotriazole) in dimethylformamide/dichloromethane (50/50) were added to the resin followed by addition of 2 eq of the coupling agent diisopropylcarbodiimide (DIC). The coupling reaction took from one hour to overnight depending upon the respective amino acid being added.
- the peptide was cleaved from the resin in a mixture of trifluoroacetic acid/1,2-ethanedthiol/thioanisole/water/phenol (88/2.2/4.4/4.4/7 v/v), also called TFA/K reagent, for 4 hours at room temperature.
- the reaction volume was 1 mL/100 mg of peptide resin.
- the mixture temperature was regulated to stay below 30° C.
- the peptide was extracted from the resin by filtration through a fritted disc. After concentration on a rotavapor to 1 ⁇ 3 of its volume, the peptide was precipitated by cold t-butyl methyl ether and filtered. The crude peptide was then dried under vacuum at 30° C.
- the crude peptide was then purified by reverse-phase HPLC to a purity of >95%.
- the purified fractions were concentrated on a rotavaporator and freeze-dried.
- the concentrated freeze-dried pools of purified peptide with the sequence of SEQ ID NO: 172 was dissolved in water and purified by ion exchange chromatography on Dowex acetate, 50-100 mesh resin.
- JNK inhibitors of the present invention may be prepared in similar manner.
- the method allows to measure in vitro, in a non radioactive standardized assay, the ability of a candidate compound to decrease the phosphorylation of the c-Jun specific substrate by JNK. Moreover, it will be illustrated how to determine the inhibitory effect (IC50) and the Ki of a chosen compound for JNK. The method is suitable to verify whether a candidate compound does or does not inhibit JNK activity. and a person skilled in the art will certainly understand how to adapt the below methods for his specific purposes and needs.
- the mixes were added with the pipette in different corner of the well. After the filling in of the plate with each mix, the plate was tapped (Keep one side fix and let the opposite side tap the table) to let the mix go down the walls of the wells.
- the bioluminescent energy transfer was read on the Fusion Alpha Plate reader (Perkin Elmer).
- All compounds should at least be tested in triplicate in 3 independent experiments for each isoform of JNK. Possibly concentrations of the compounds to be tested were 0, 0.03 nM, 0.1 nM, 0.3 nM, 1 nM, 3 nM, 10 nM, 30 nM, 100 nM, 300 nM, 1 ⁇ M, 3 ⁇ M, 10 ⁇ M, 30 ⁇ M, and 100 ⁇ M. Controls were samples either without JNK or without substrate (c-Jun).
- Ki IC50/(1+([Substrate]/Km of the substrate)
- the 6 well culture plates are coated with 3 ml of Poly-D-Lys (Sigma P9011; 25 ⁇ g/ml in PBS), the 24 well plates with 600 ⁇ l and the 96 well plates with 125 ⁇ l and incubated for 4 h at 37° C., CO 2 5% and 100% relative humidity.
- Poly-D-Lys Sigma P9011; 25 ⁇ g/ml in PBS
- the cells were plated into the dishes in 2.4 ml medium (RPMI) at plating densities of 1′000′000 cells/ml for suspension cells. After inoculation, the plates were incubated at 37° C., 5% CO 2 and 100% relative humidity for 24 hours prior to the addition of the peptide.
- Adherent cells should be at a density of 90-95% the day of treatment and were plated in DMEM:
- Nb adherent Nb suspension well (cm 2 ) Medium cells cells 96 well 0.3 100-200 ⁇ l 8′000-30′000 100′000 24 well 2 500-1000 ⁇ l 100′000-200′000 500′000-1′000′000 35 mm (P35)/6 well 10 2.4 ml 250′000-2′100′000 2′400′000 60 mm (P60) 20 3.5 ml 15 * 10 5 1′000′000/ml 10 cm (P100) 60 10 ml 15-60 * 10 5
- the cells were treated with the desired concentration of FITC labeled peptide (stock solution at a concentration of 10 mM in H 2 O).
- the cells were incubated 0 to 24 hours (e.g. 30 min, 1, 6 or 24 hours) at 37° C., CO 2 5% and 100% relative humidity.
- the extracts were cooled on ice.
- Suspension cells (or cells, which don attach well to the dish):
- the lysed cells were then centrifuged 30 min at 10000 g at 4° C. to remove the cellular debris.
- each protein extract was determined by a standard BCA assay (Kit N° 23225, Pierce), following the instructions of the manufacturer.
- the relative fluorescence of each sample is determined after reading 10 ⁇ l of each sample in a fluorescence plate reader (Fusion Alpha, Perkin Elmer), background subtraction and normalization by protein concentration.
- TAT derived sequences as shown in Table 4 are preferred, which exhibit an Y in position 2, particularly when the sequence exhibits 9 aa and has the consensus sequence rXXXrXXXr (SEQ ID NO: 31).
- Sandwich ELISA allows measuring the amount of antigen between two layers of antibodies (i.e. capture and detection antibody).
- the antigen to be measured must contain at least two antigenic sites capable of binding to antibody, since at least two antibodies act in the sandwich.
- Either monoclonal or polyclonal antibodies can be used as the capture and detection antibodies in Sandwich ELISA systems.
- Monoclonal antibodies recognize a single epitope that allows fine detection and quantification of small differences in antigen.
- a polyclonal is often used as the capture antibody to pull down as much of the antigen as possible.
- Sandwich ELISA is that the sample does not have to be purified before analysis, and the assay can be very sensitive (up to 2 to 5 times more sensitive than direct or indirect).
- the method may be used to determine the effect of the JNK inhibitors of the present invention in vitro/cell culture.
- compound efficacy is indicated by the decrease of the cytokine levels (the variation of optical density (absorbance at 450 nm)) as compared to non-treated samples and is monitored by ELISA. Results are express in ng/ml.
- the data are presented in pg/ml of cytokine release or in %, compared to the induced condition without inhibitor treatment.
- THP1 cells were stimulated ex-vivo by different ligands for the readout of cytokine release.
- JNK inhibitor efficacy is indicated by the decrease of the cytokine levels as compared to non-treated samples and is monitored by ELISA.
- the toxicity of the compound are evaluated by the reduction of a tetrazolium salt (MTS) to formazan, giving a purple colour.
- MTS tetrazolium salt
- the plates had been coated with 200 l of poly D-Lysine (1 ⁇ ) and incubated 2 hours at 37° C., CO 2 5% and 100% relative humidity.
- the cells were counted. The desired number of cells was taken and resuspended in the amount of media necessary to get a dilution of 1′000′000 cells/ml. 100 nM of PMA was added to induce the differentiation of the THP1 from suspension monocytes to adherent macrophages. The cells were plated into the wells in 100 l medium at plating densities of 100'000 cells/well. After inoculation, the plates were incubated at 37° C., 5% CO2 and 100% relative humidity 3 days to let them differentiate, prior to the addition of experimental drugs.
- Experimental drug were prepared at the concentration of 10 mM in H 2 O or DMSO and stored at ⁇ 80° C. Prior to each daily use, one aliquot of JNK inhibitor was defrost and diluted to reach a 4 ⁇ concentrated solution (120 M) in RPMI medium and then to the desired concentration in RPMI. The SP600125 was diluted to reach a 4 ⁇ concentrated solution (40 M) in RPMI medium and then to the desired concentration in RPMI containing 0.8% DMSO.
- the plates were treated with 50 l of medium or a solution of 4 ⁇ the final desired drug concentration (0, 100 nM, 1, 3, 10 or 30 M final for JNK compound or at 0, 10, 100 nM, 1, 3 or 10 M final for the SP600125 positive control). Following drug addition, the plates were incubated for an additional 1 h at 37° C., 5% CO 2 and 100% relative humidity.
- the cytotoxic effect of the compounds was evaluated by MTS absorbance (e.g. see example 4) and cells were observed using an inverted microscope (Axiovert 40 CFL; Zeiss; 10 ⁇ ).
- Analyses of the data are performed as indicated in the ELISA (see example 4). Briefly, for ELISA: Average the triplicate readings for each standard control and each sample. Subtract the average zero standard optical density (O.D). Create a standard curve plotting the log of the cytokine concentration versus the log of the O.D and the best fit line can be determined by regression analysis. If samples have been diluted, the concentration read from the standard curve must be multiplied by the dilution factor. A standard curve should be generated for each set of samples assayed. The outliers data were avoid using Grugg's test. Then the data which weret in the interval of two times the SD, were discard. The independent experiments are taken into account if the positive control showed data as previously observed. The independent experiments are pooled (N>3).
- Whole blood is collected from anesthetized rat or human healthy volunteers using a venipuncture connected to a pre-labeled vacuum tube containing sodium citrate. Tubes are gently mixed by inversion 7-8 times; and are then kept at RT until stimulation.
- JNK inhibitor of SEQ ID NO: 172 is prepared 6 times concentrated in PBS, and 30 ⁇ l/well of mix is added into 96-well plate.
- Whole blood is diluted by 1:2 in PBS and 120 ⁇ l of diluted blood is added in each well where either PBS alone or JNK inhibitor of SEQ ID NO: 172 has been previously added.
- Whole blood is incubated at 37° C.; 85 rpm (Stuart Orbital incubator SI500) for 60 min.
- Activators are the prepared, 30 ⁇ l/well of LPS, 6 times concentrated. After 60 min incubation, LPS is added to the blood, blood is mixed by pipetting up and down, and then kept for 4 h under agitation (85 rpm), at 37° C. After the 4 h incubation, the plates are centrifuged at about 770 g, 4° C. for 15 min in a pre-cooled centrifuge. Supernatants are finally collected and kept at ⁇ 20° C. until cytokine measurement. Cytokine (IL-6, IL-2, IFN ⁇ and TNF ⁇ ) were then measured using standard Elisa kits (e.g. from R&D Systems: DuoSet Elisas; or from BD Biosciences: BD Opteia Set Elisa). Results are expressed as pg/ml of supernatant of the measured cytokine.
- the JNK inhibitors with the sequence of SEQ ID NOs: 196, 197, and 172 were digested in human serum (10 and 50% in PBS 1 ⁇ ). The experiment was performed as described by Tugyi et al. (Proc Natl Acad Sci USA, 2005, 413-418). The remaining intact peptide was quantified by UPLC-MS. Stability was assessed for SEQ ID NOs: 196, 197, and 172 identically but in two separate assays. While the JNK inhibitor with SEQ ID NO: 196 was totally degraded into amino acids residues within 6 hours, the JNK inhibitor with SEQ ID NO: 172 was completely degraded only after 14 days. The JNK inhibitor with SEQ ID NO: 197 was still stable after 30 days.
- lymph nodes were harvested and kept in complete RPMI medium. LN were smashed with complete RPMI on 70 ⁇ m filter using a 5 ml piston. A few drops of media were added to keep strainer wet. Cells were centrifuged for 7 min at 450 g and 4° c. Pellet was resuspended in 5 ml fresh medium. Cells were passed again through cell strainer. An aliquot of cells was counted, while cells were centrifuged again 10 min at 1400 rpm and 4° c. Cells were resuspended in MACS buffer (80 ⁇ l of MACS buffer per 10 7 cells).
- Eluted T cells were centrifuges for 7 min at 700 g and 4° C. Resuspended cells were counted and plated at density of 200000 cells/well in 100 ⁇ l of complete medium. Plates were precoated the day before experiment with 2 ⁇ g/mL of CD3 antibody, and the day of experiment plates were washed three times with PBS. Cells were treated with 100 ⁇ l of (poly-)peptide JNK inhibitor (SEQ ID NO: 172), two times concentrated for 1 h before ligand activation. After 1 h of pretreatment with (poly-)peptide JNK inhibitor (SEQ ID NO: 172), cells were then stimulated with 2 ⁇ g/mL of anti CD28 antibody for 24 h. After 24 h of stimulation; supernatant were collected and stored at ⁇ 20° C. until analysis. Cytokines were then measured using standard Elisa kits. Results are expressed as pg/ml of supernatant of the measured cytokine.
- ligands 50 ⁇ l/well of ligands diluted in RPMI+P/S was prepared, corresponding to the final dilution 10 times concentrated. After 60 min of incubation, ligand was added; wells were then mixed by pipetting up and down the blood. Whole blood was incubated for 3 days at 37° C. (wells were mixed by pipetting each well up and down once per day). At the end of incubation, plates were mixed and then centrifuged at 2500 rpm, 4° C. for 15 min in a pre-cooled centrifuge. Cytokine were then measured using standard Elisa kits. Results are expressed as pg/ml of supernatant of the measured cytokine.
- CD3/CD8 stimulation CD3 antibody was coated at 2 ⁇ g/mL in PBS overnight at 4° C. The day of experiment, wells were washed three times with PBS and left in PBS until use at 37° C. CD28 antibody was added 1 h after SEQ ID NO: 172 at final concentration of 2 ⁇ g/mL; supernatants were collected after 3 days of stimulation.
- the anti-inflammatory potency of the JNK inhibitor of SEQ ID NO: 172 was tested in albino rats following intravenous administration (EIU/LPS model). The aim of this study was to determine the effects of single intravenous injections of SEQ ID NO: 172 (0.015, 0.18, and 1.80 mg/kg) on the inflammatory response in an endotoxins-induced uveitis albino rat model and to compare these affects to those obtained with prior art JNK inhibitor of SEQ ID NO: 197 (2 mg/kg). As a further control served phosphate sodic dexamethasone.
- EIU was induced by footpad injection of lipopolysaccharide (LPS, 1 mg/kg).
- NaCl 0.8%
- SEQ ID NO: 197 at 2 mg/kg
- SEQ ID NO: 172 at three concentrations (1.80 mg/kg, 0.18 mg/kg and 0.015 mg/kg) were administered by intravenous injection.
- Phosphate sodic dexamethasone (20 ⁇ g/eye) was administered by sub-conjunctival injection in both eyes. 24 hours after LPS injection, inflammatory response was evaluated by clinical scoring.
- the intensity of clinical ocular inflammation was scored on a scale from 0 to 4 for each eye:
- Rat collagen arthritis is an experimental model of polyarthritis that has been widely used for preclinical testing of numerous anti-arthritic agents that are either under preclinical or clinical investigation or are currently used as therapeutics in this disease.
- the hallmarks of this model are reliable onset and progression of robust, easily measurable polyarticular inflammation, marked cartilage destruction in association with pannus formation, and mild to moderate bone resorption and periosteal bone proliferation.
- IV efficacy of the JNK inhibitor of SEQ ID NO: 172 administered daily (QD) for 14 days (arthritis d1-14) for inhibition of the inflammation (paw swelling), cartilage destruction, and bone resorption that occurs in established type II collagen arthritis in rats was determined in said experimental model.
- Body weight loss was observed in all disease groups whereas the normal control group had a weight increase. Body weight loss was significantly (25%, p ⁇ 0.05 by ANOVA) inhibited for rats treated with 5 mg/kg SEQ ID NO: 172 as compared to vehicle treated disease controls. When compared to disease controls using a Student's t-test, inhibition of body weight loss was also significant for rats treated with 1 mg/kg SEQ ID NO: 172 (21%, p ⁇ 0.05) or Dex (21%, p ⁇ 0.05). Results of treatment with SEQ ID NO: 172 were dose responsive for this parameter.
- Ankle diameter AUC was significantly (p ⁇ 0.05 by ANOVA) reduced toward normal for rats treated with 5 mg/kg SEQ ID NO: 172 (43% reduction), 1 mg/kg SEQ ID NO: 172 (27%), or Dex (97%) as compared to disease controls. Results of treatment with SEQ ID NO: 172 were dose responsive for this parameter.
- Relative liver weights were not significantly (by ANOVA) affected for rats in any treatment group as compared to disease controls.
- Spleen weights relative to body weight were significantly (p ⁇ 0.05 by ANOVA) reduced for rats treated with Dex as compared to disease controls. Relative spleen weights for Dex treated rats were also significantly reduced as compared to normal controls. Relative spleen weights were not significantly affected for rats treated with SEQ ID NO: 172.
- Thymus weights relative to body weight were significantly (p ⁇ 0.05 by ANOVA) reduced for rats treated with Dex as compared to disease controls. Relative thymus weights for Dex treated rats were also significantly reduced as compared to normal controls. Relative thymus weights were not significantly affected for rats treated with SEQ ID NO: 172.
- the objective of this study was to assess the effects of two different compounds, the all-D-retro-inverso JNK-inhibitor (poly-)peptide of SEQ ID NO: 197 and the JNK inhibitor (poly-)peptide of SEQ ID NO: 172, at three dose levels in a mouse model of scopolamine-induced dry eye.
- the peptides of SEQ ID NO: 197 and SEQ ID NO: 172 were tested for efficacy in this murine model of dry eye.
- the peptides were both tested at a low, medium and a high dose.
- concentrations measured in the formulation samples for low, medium and high dose levels were 0.06% (w/v), 0.25% (w/v) and 0.6% (w/v), respectively
- concentrations measured in the formulation samples for the low, medium and high dose levels were 0.05% (w/v), 0.2% (w/v) and 0.6% (w/v), respectively.
- the study consisted of a total of 9 groups of female C57BL/6 mice, comprising 8 groups of 12 mice each and an additional group of 4 mice.
- Bilateral short-term dry eye was induced by a combination of scopolamine hydrobromide (Sigma-Aldrich Corp., St. Louis, Mo.) injection (subcutaneous (SC), four times daily, 0.5 mg/dose, Days 0-21) and by exposing mice to the drying environment of constant air draft.
- scopolamine hydrobromide Sigma-Aldrich Corp., St. Louis, Mo.
- mice of Groups 1-8 were treated three times daily (TID) for 21 days with bilateral topical ocular (oculus uterque; OU) administration (5 ⁇ L/eye/dose) of vehicle (0.9% sterile saline; negative control article); the peptide of SEQ ID NO: 197 (0.06%, 0.25% and 0.6%), the peptide of SEQ ID NO: 172 (0.05%, 0.2% and 0.6%); or cyclosporine (0.05%; positive control, an immunosuppressant drug used to reduce the activity of the immune system).
- Mice of Group 9 were maintained as un-induced, (no dry eye) untreated controls.
- the (poly-)peptide of SEQ ID NO: 197 was obtained from Polypeptide Laboratories (France) as a 1.5-mL clear plastic microfuge vial containing 300.65 mg of dry powder.
- the (poly-)peptide of SEQ ID NO: 172 was obtained from Polypeptide Laboratories (France) as a 1.5-mL clear plastic microfuge vial containing 302.7 mg of dry powder.
- the (poly-)peptides of SEQ ID NO: 172 and of SEQ ID NO: 197 were formulated in sterile saline (vehicle). Dosing solutions at each concentration were sterilized using 0.2- ⁇ m filters, aliquoted to multiple pre-labeled vials, and frozen at ⁇ 20° C. The concentrations measured in the formulation samples for the peptide of SEQ ID NO: 197 were 0.058%, 0.25% and 0.624%, rounded to 0.06%, 0.25% and 0.6%. The concentrations measured in the formulation samples for the peptide of SEQ ID NO: 172 were 0.053%, 0.217% and 0.562%, rounded to 0.05, 0.2% and 0.6%.
- each animal Prior to entry into the study, each animal underwent a SLE and indirect ophthalmic examination using topically-applied fluorescein. Ocular findings were recorded using the Draize scale ocular scoring. SLE and Draize scoring were repeated three times a week during the in-life period.
- the TBUT test was conducted three times weekly by measuring the time elapsed in seconds between a complete blink after application of fluorescein to the cornea and the appearance of the first random dry spot in the tear film.
- 0.1% liquid sodium fluorescein was dropped into the conjunctival sac, the eyelids were manually closed three times and then held open revealing a continuous fluorescein-containing tear film covering the cornea, and the time (in seconds) required for the film to break (appearance of a dry spot or streak) was recorded.
- corneal epithelial damage was graded using a slit-lamp with a cobalt blue filter after another drop of 0.1% fluorescein was reapplied to the cornea; the cornea then was scored per the Draize ocular scale.
- Tear production was measured three times a week in both eyes using PRTT test strips (Zone-Quick; Menicon, Nagoya, Japan). Prior to the first treatment of the day, a thread was applied to the lateral canthus of the conjunctival formix of each eye for 30 seconds under slit-lamp biomicroscopy. Tear migration up the tread (i.e., the length of the wetted cotton thread) was measured using a millimeter scale.
- both eyes from each animal including the globes, lacrimal glands, eyelids, and conjunctivae, were excised.
- the right eye and associated tissues were fixed by overnight submersion in modified Davidson's solution followed by transfer to 10% neutral buffered formalin (NBF).
- NBF neutral buffered formalin
- the fixed tissues of the right eye were dehydrated, embedded in paraffin, sectioned at 3 to 5- ⁇ m thicknesses, and slide-mounted tissues were stained with hematoxylin and eosin (H & E). Stained slides were evaluated via light microscopy.
- Detailed and complete histopathologic assessment was conducted on all parts of the eye, with at least two section levels being examined histopathologically for each right eye.
- cornea epithelia (including goblet cells) of the conjunctiva and cornea, as well as the lacrimal gland.
- These tissues were scored for injury based upon a 0-4 scale, with 0 being normal, 1 being minimal, 2 being mild, 3 being moderate, and 4 being severe.
- scores were based on corneal epithelium thickness, and corneal inflammation.
- Conjunctivae were scored for erosion and inflammation as well as presence or absence of goblet cells.
- TBUTs tear break-up time tests were performed prior to the induction of dry eye, and again on Days 2, 4, 7, 9, 11, 14, 16, 18 and 21 after dry eye induction.
- TBUT mean values began to decrease in all animals, but appeared to decrease more slowly in Group 6 (mid-dose of SEQ ID NO: 172).
- TBUT means of these groups increased to a peak on Day 9.
- Groups 6 and 7 SEQ ID NO: 172 mid and high-dose groups
- TBUT means rose to higher values (10.0 ⁇ 0.7 s and 9.9 ⁇ 0.8 s, respectively) than Group 8, the cyclosporine group (8.5 ⁇ 0.3 s), while the peak TBUT mean of Group 5, the low-dose of SEQ ID NO: 172 (8.0 ⁇ 0.4 s) was slightly below that of Group 8 (cyclosporine).
- the low, medium and high-dose TBUT means of SEQ ID NO: 172-treated animals (Groups 2, 3 and 4, respectively) were above the vehicle group and generally below the low, mid and high-dose group means of SEQ ID NO: 172-treated animals.
- Groups treated with low, mid and high dose levels of the peptide of SEQ ID NO: 197 showed slight generally dose-dependent increases in TBUT which started to increase approximately two days later than animals treated with SEQ ID NO: 172 or cyclosporine.
- PRTT tests were performed prior to the induction of dry eye, and again on Days 2, 4, 7, 9, 11, 14, 16, 18 and 21.
- PRTT values from Day 0 to Day 4 decreased in all mice that had dry eye induced, indicating a decrease in tear production after the administration of scopolamine and exposure to a drying environment of increased air draft created by the blowers.
- the nadir in PRTT in most groups occurred at approximately Day 7.
- PRTT kept decreasing in the vehicle control group (Group 1) reaching a nadir on Day 14. After the nadir, there was an increase in all dry eye groups.
- Groups treated with low, mid and high dose levels of the peptide of SEQ ID NO: 197 (0.06%, 0.25% and 0.6%, Groups 2, 3 and 4, respectively) showed generally dose-dependent increases in PRTT.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Diabetes (AREA)
- Oncology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Ophthalmology & Optometry (AREA)
- Physical Education & Sports Medicine (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Communicable Diseases (AREA)
- Pain & Pain Management (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Endocrinology (AREA)
- Pulmonology (AREA)
- Obesity (AREA)
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EPPCT/EP2011/006481 | 2011-12-21 | ||
PCT/EP2011/006481 WO2013091670A1 (en) | 2011-12-21 | 2011-12-21 | Novel jnk inhibitor molecules for treatment of various diseases |
PCT/EP2012/005362 WO2013091896A1 (en) | 2011-12-21 | 2012-12-21 | Novel jnk inhibitor molecules for treatment of various diseases |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2012/005362 A-371-Of-International WO2013091896A1 (en) | 2011-12-21 | 2012-12-21 | Novel jnk inhibitor molecules for treatment of various diseases |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/217,326 Division US10596223B2 (en) | 2011-12-21 | 2016-07-22 | JNK inhibitor molecules for treatment of various diseases |
Publications (1)
Publication Number | Publication Date |
---|---|
US20150133393A1 true US20150133393A1 (en) | 2015-05-14 |
Family
ID=47471695
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/367,706 Abandoned US20150133393A1 (en) | 2011-12-21 | 2012-12-21 | Novel JNK Inhibitor Molecules for Treatment of Various Diseases |
US15/217,326 Expired - Fee Related US10596223B2 (en) | 2011-12-21 | 2016-07-22 | JNK inhibitor molecules for treatment of various diseases |
US16/751,439 Abandoned US20200206301A1 (en) | 2011-12-21 | 2020-01-24 | JNK Inhibitor Molecules For Treatment Of Various Diseases |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/217,326 Expired - Fee Related US10596223B2 (en) | 2011-12-21 | 2016-07-22 | JNK inhibitor molecules for treatment of various diseases |
US16/751,439 Abandoned US20200206301A1 (en) | 2011-12-21 | 2020-01-24 | JNK Inhibitor Molecules For Treatment Of Various Diseases |
Country Status (16)
Country | Link |
---|---|
US (3) | US20150133393A1 (zh) |
EP (2) | EP2793919B1 (zh) |
JP (1) | JP6149044B2 (zh) |
KR (1) | KR20140108308A (zh) |
CN (1) | CN104080469B (zh) |
AU (3) | AU2012359164A1 (zh) |
BR (1) | BR112014014783A2 (zh) |
CA (1) | CA2855226C (zh) |
EA (1) | EA201491221A1 (zh) |
ES (1) | ES2784551T3 (zh) |
HK (1) | HK1198943A1 (zh) |
IL (1) | IL232763A0 (zh) |
MX (1) | MX2014007566A (zh) |
PL (1) | PL2793919T3 (zh) |
SG (2) | SG11201402432WA (zh) |
WO (2) | WO2013091670A1 (zh) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20160115200A1 (en) * | 2013-06-26 | 2016-04-28 | Xigen Inflammation Ltd. | New Use for JNK Inhibitor Molecules for Treatment of Various Diseases |
US20170290877A1 (en) * | 2013-06-26 | 2017-10-12 | Xigen Inflammation Ltd. | Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Various Diseases |
US10596223B2 (en) | 2011-12-21 | 2020-03-24 | Xigen Inflammation Ltd. | JNK inhibitor molecules for treatment of various diseases |
US10624948B2 (en) | 2013-06-26 | 2020-04-21 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
US10967038B2 (en) | 2010-10-14 | 2021-04-06 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
US11331364B2 (en) | 2014-06-26 | 2022-05-17 | Xigen Inflammation Ltd. | Use for JNK inhibitor molecules for treatment of various diseases |
Families Citing this family (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2007031098A1 (en) | 2005-09-12 | 2007-03-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the jnk signal transduction pathway |
WO2009143865A1 (en) | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
WO2009143864A1 (en) | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
WO2010072228A1 (en) | 2008-12-22 | 2010-07-01 | Xigen S.A. | Novel transporter constructs and transporter cargo conjugate molecules |
WO2011160653A1 (en) | 2010-06-21 | 2011-12-29 | Xigen S.A. | Novel jnk inhibitor molecules |
WO2015197098A1 (en) * | 2014-06-26 | 2015-12-30 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
WO2016055160A2 (en) * | 2014-10-08 | 2016-04-14 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
EP3160989A2 (en) * | 2014-06-26 | 2017-05-03 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
CN106714821B (zh) * | 2014-06-26 | 2021-07-23 | 埃克西金炎症有限公司 | Jnk信号转导途径的细胞穿透肽抑制剂用于治疗多种疾病的新用途 |
EP3313428A1 (en) * | 2015-06-26 | 2018-05-02 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of mild cognitive impairment |
WO2018029336A1 (en) | 2016-08-12 | 2018-02-15 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for determining whether a subject was administered with an activator of the ppar beta/delta pathway. |
KR101772449B1 (ko) * | 2016-12-27 | 2017-08-30 | 주식회사 하이센스바이오 | 신규한 펩타이드 |
CN107216371B (zh) * | 2017-05-27 | 2020-09-18 | 浙江师范大学 | 一种成人t细胞白血病的特异性靶向多肽及其应用 |
CN109303782A (zh) * | 2018-10-24 | 2019-02-05 | 厦门大学 | Jnk-in-8在制备干性年龄相关性黄斑变性的神经保护剂中的应用 |
CN112022852A (zh) * | 2020-09-30 | 2020-12-04 | 郑州大学 | 蝙蝠葛苏林碱在制备抗肿瘤药物中的应用 |
WO2023215616A2 (en) * | 2022-05-05 | 2023-11-09 | Aion Healthspan, Inc. | Nanomaterial-stem cell compositions and methods of use |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20070060514A1 (en) * | 2005-09-12 | 2007-03-15 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US8981052B2 (en) * | 2010-06-21 | 2015-03-17 | Xigen Inflammation Ltd. | JNK inhibitor molecules |
Family Cites Families (145)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IT1195304B (it) | 1981-12-22 | 1988-10-12 | Anic Spa | Metodo per la preparazione di gem-diammino derivati n-monoacilati |
US4631211A (en) | 1985-03-25 | 1986-12-23 | Scripps Clinic & Research Foundation | Means for sequential solid phase organic synthesis and methods using the same |
US4698327A (en) | 1985-04-25 | 1987-10-06 | Eli Lilly And Company | Novel glycopeptide derivatives |
IT1190389B (it) | 1985-09-19 | 1988-02-16 | Eniricerche Spa | Esapeptidi ad attivita' ipotensiva |
US5169933A (en) | 1988-08-15 | 1992-12-08 | Neorx Corporation | Covalently-linked complexes and methods for enhanced cytotoxicity and imaging |
IT1227907B (it) | 1988-12-23 | 1991-05-14 | Eniricerche S P A Milano Sclav | Procedimento per la sintesi di peptidi retro-inversi e nuovi intermediin tale procedimento |
US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
US5652122A (en) | 1989-12-21 | 1997-07-29 | Frankel; Alan | Nucleic acids encoding and methods of making tat-derived transport polypeptides |
US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
US5840313A (en) | 1990-09-27 | 1998-11-24 | Syntello Vaccine Development Kb | Peptides for use in vaccination and induction of neutralizing antibodies against human immunodeficiency virus |
AU1753892A (en) | 1991-04-10 | 1992-11-17 | General Hospital Corporation, The | Mammalian gap-43 compositions and methods of use |
US5350835A (en) | 1991-11-05 | 1994-09-27 | Board Of Regents, University Of Texas | Cellular nucleic acid binding protein and uses thereof in regulating gene expression and in the treatment of aids |
US5994108A (en) | 1991-11-05 | 1999-11-30 | Board Of Regents, The University Of Texas System | Mutant TAR virus and transdominant tat mutants as pharmacological agents |
CA2131620A1 (en) | 1992-03-20 | 1993-09-30 | Louis C. Smith | A dna transporter system and method of use |
ATE260679T1 (de) | 1992-04-03 | 2004-03-15 | Univ California | Selbstorganisierendes system zur verabreichung von polynukleotiden enthaltend ein amphiphatisches peptid |
WO1994004562A1 (en) | 1992-08-13 | 1994-03-03 | The General Hospital Corporation | Mammalian gap-43 compositions and methods of use |
NZ255831A (en) | 1992-08-21 | 1997-04-24 | Biogen Inc | Fusion proteins comprising biologically active cargo moiety and transport peptides from the hiv tat protein, their preparation and use |
BR9306984A (pt) | 1992-08-27 | 1999-01-12 | Deakin Res Ltd | Análogo de antígeno de peptídeo de um antígeno de peptídeo nativo vacina anticorpo processo para vacinar um hospedeiro necessitando deste tratamento estojo diagnóstico processos para preparar um análogo de um antiígeno de um antígeno de peptídeo nativo para preparar uma vacina para analisar uma amostra para um antígeno de peptídeo nativo e para analisar uma amostra para um anticorpo |
US5545551A (en) | 1992-08-28 | 1996-08-13 | Mt. Sinai School Of Medicine Of The City University Of New York | Cloning and expression of pur protein |
WO1994023751A1 (de) | 1993-04-14 | 1994-10-27 | Boehringer Mannheim Gmbh | Nukleinsäure-transferpeptide und deren verwendung zur einschleusung von nukleinsäuren in eukaryontische zellen |
AU8116494A (en) | 1993-11-12 | 1995-06-13 | Kenichi Matsubara | Gene signature |
US5595756A (en) | 1993-12-22 | 1997-01-21 | Inex Pharmaceuticals Corporation | Liposomal compositions for enhanced retention of bioactive agents |
US5807746A (en) | 1994-06-13 | 1998-09-15 | Vanderbilt University | Method for importing biologically active molecules into cells |
JPH10508205A (ja) | 1995-04-25 | 1998-08-18 | バクスター インターナショナル インコーポレイテッド | 肝細胞および膵臓ランゲルハンス島細胞を単離するためのコラーゲナーゼおよびキモパパインを含有する組成物 |
ATE365808T1 (de) | 1995-07-28 | 2007-07-15 | Marie Curie Cancer Care | Transportproteine und deren verwendungen |
WO1997010836A1 (en) | 1995-09-21 | 1997-03-27 | Innapharma, Inc. | Peptides and peptidomimetics inhibiting the oncogenic action of p21 ras |
IE80466B1 (en) | 1995-11-10 | 1998-07-29 | Elan Corp Plc | Peptides which enhance transport across tissues and methods of identifying and using the same |
US5877282A (en) | 1996-09-20 | 1999-03-02 | Bristol-Myers Squibb Company | Peptide inhibitors of nuclear protein translocation having nuclear localization sequences and methods of use thereof |
US6187817B1 (en) | 1996-10-03 | 2001-02-13 | Southern Illinois University School Of Medicine | Therapeutic use of d-methionine to reduce the toxicity of platinum-containing anti-tumor compounds |
US6361938B1 (en) | 1996-11-08 | 2002-03-26 | Elan Corporation, Plc | Peptides which enhance transport across tissues and methods of identifying and using the same |
WO1998023781A1 (en) | 1996-11-26 | 1998-06-04 | Johns Hopkins University | Ligand detection system and methods of use thereof |
US5989814A (en) | 1997-04-01 | 1999-11-23 | Reagents Of The University Of California | Screening methods in eucaryotic cells |
US5880261A (en) | 1997-04-03 | 1999-03-09 | Waeber; Gerard | Transcription factor Islet-Brain 1 (IB1) |
AU6972798A (en) | 1997-04-18 | 1998-11-13 | University Of Medicine And Dentistry Of New Jersey | Inhibition of hiv-1 replication by a tat rna-binding domain peptide analog |
US6043083A (en) | 1997-04-28 | 2000-03-28 | Davis; Roger J. | Inhibitors of the JNK signal transduction pathway and methods of use |
CA2290756A1 (en) | 1997-05-15 | 1998-11-19 | Cytogen Corporation | Random peptides that bind to gastro-intestinal tract (git) transport receptors and related methods |
US20040152084A1 (en) | 2003-01-31 | 2004-08-05 | Slattum Paul M. | Compounds and processes for single-pot attachment of a label to nucleic acid |
JP2002502376A (ja) | 1997-05-21 | 2002-01-22 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティ | 生物学的膜を横切る輸送を増強するための組成物および方法 |
FR2767323B1 (fr) | 1997-08-12 | 2001-01-05 | Synt Em | Peptides lineaires derives de peptides antibiotiques, leur preparation et leur utilisation pour vectoriser des substances actives |
EP0897002A3 (en) | 1997-08-14 | 2001-10-04 | Smithkline Beecham Plc | U62317, a protein having a JNK-binding domain |
WO1999016787A1 (en) | 1997-09-26 | 1999-04-08 | Washington University | Cell death agonists |
US6420031B1 (en) | 1997-11-03 | 2002-07-16 | The Trustees Of Princeton University | Highly transparent non-metallic cathodes |
AU745579B2 (en) | 1997-10-20 | 2002-03-21 | F. Hoffmann-La Roche Ag | Bicyclic kinase inhibitors |
US6270956B1 (en) | 1997-12-11 | 2001-08-07 | The Salk Institute For Biological Studies | Transcriptional coactivator that interacts with Tat protein and regulates its binding to TAR RNA, methods for modulating Tat transactivation, and uses therefor |
EP0947524A1 (en) | 1998-03-30 | 1999-10-06 | Upither B.V. | Novel peptides for the treatment of autoimmune diseases |
US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
EP1082310A4 (en) | 1998-04-29 | 2001-09-12 | Univ Georgetown | METHODS RELATING TO THE IDENTIFICATION AND USE OF COMPOUNDS THAT BIND TO HLA MOLECULES AS AGONISTS OR ANTAGONISTS TO HLA |
EP1076711A2 (en) | 1998-05-13 | 2001-02-21 | Incyte Pharmaceuticals, Inc. | Human apoptosis associated proteins |
WO1999058561A1 (fr) | 1998-05-14 | 1999-11-18 | Pasteur Merieux Serums & Vaccins | Mimotopes du virus de l'hepatite c |
US6811992B1 (en) | 1998-05-14 | 2004-11-02 | Ya Fang Liu | Method for identifying MLK inhibitors for the treatment of neurological conditions |
AU4289399A (en) | 1998-06-18 | 2000-01-05 | Dnavec Research Inc. | Nucleic acid transfer phage |
US6589503B1 (en) | 1998-06-20 | 2003-07-08 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
AU755564B2 (en) | 1998-06-20 | 2002-12-12 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
US8038984B2 (en) | 1998-06-20 | 2011-10-18 | Washington University | Membrane-permeant peptide complexes for treatment of sepsis |
EP1107998B1 (en) | 1998-08-28 | 2004-02-04 | Gryphon Sciences | Method for the preparation of polyamide chains of precise length, their conjugates with proteins |
ATE361752T1 (de) | 1998-09-25 | 2007-06-15 | Cephalon Inc | Methoden zur prophylaxe und behandlung von schäden der wahrnehmungshärchenzellen und der cochlearen neuronen |
US20020090696A1 (en) | 1998-12-08 | 2002-07-11 | Miller Carol A. | Treating neurological disorders using human apoptosis inhibiting protein |
US6656474B1 (en) | 1999-01-15 | 2003-12-02 | Regeneron Pharmaceuticals, Inc. | Methods of using a neurotrophin and its analogues for the treatment of gastrointestinal hypomotility disorders |
US6673908B1 (en) | 1999-02-22 | 2004-01-06 | Nuvelo, Inc. | Tumor necrosis factor receptor 2 |
EP1181306A4 (en) | 1999-05-28 | 2003-06-18 | Apoptosis Technology Inc | COMPOUNDS AND METHODS FOR REGULATING APOPTOSIS, AND METHODS OF MAKING AND SCREENING REGULATORY COMPOUNDS FOR APOPTOSIS |
US7510824B2 (en) | 1999-06-02 | 2009-03-31 | Nono Inc. | Method of screening peptides useful in treating traumatic injury to the brain or spinal cord |
AU5316900A (en) | 1999-06-03 | 2000-12-28 | Vertex Pharmaceuticals Incorporated | Inhibitors of c-jun n-terminal kinases (jnk) |
DK1102785T3 (da) | 1999-06-07 | 2013-05-13 | Arrowhead Res Corp | Sammensætninger til lægemiddeltilførsel ved anvendelse af pH-følsomme molekyler |
US6669951B2 (en) | 1999-08-24 | 2003-12-30 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
EP1210121A2 (en) | 1999-08-24 | 2002-06-05 | Cellgate Inc. | Enhancing drug delivery across and into epithelial tissues using oligo arginine moieties |
EP1210362A2 (en) | 1999-09-01 | 2002-06-05 | University Of Pittsburgh Of The Commonwealth System Of Higher Education | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, dna and viruses |
US20030104622A1 (en) | 1999-09-01 | 2003-06-05 | Robbins Paul D. | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses |
US8183339B1 (en) | 1999-10-12 | 2012-05-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US6610820B1 (en) | 1999-10-12 | 2003-08-26 | University Of Lausanne | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US20040082509A1 (en) * | 1999-10-12 | 2004-04-29 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US20030108539A1 (en) | 2000-02-14 | 2003-06-12 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US20010046489A1 (en) | 1999-12-06 | 2001-11-29 | Habener Joel E. | Stem cells of the islets of langerhans and their use in treating diabetes mellitus |
ES2415708T3 (es) | 1999-12-16 | 2013-07-26 | Biogen Idec Ma Inc. | Métodos de tratamiento de la lesión isquémica o hemorrágica del sistema nervioso central mediante el uso de antagonistas anti-integrina alfa4 |
JP4624639B2 (ja) * | 2000-06-16 | 2011-02-02 | ジーランド ファーマ アクティーゼルスカブ | 短い荷電ペプチド鎖によってn及び/又はc末端が修飾されたペプチド |
US6586403B1 (en) | 2000-07-20 | 2003-07-01 | Salpep Biotechnology, Inc. | Treating allergic reactions and inflammatory responses with tri-and dipeptides |
US6897231B2 (en) | 2000-07-31 | 2005-05-24 | Signal Pharmaceuticals, Inc. | Indazole derivatives as JNK inhibitors and compositions and methods related thereto |
JP4387669B2 (ja) | 2000-10-13 | 2009-12-16 | ザイジェン エス.アー. | 新規なトランスポーターペプチド配列による生物学的エフェクターの細胞内送達 |
US7033597B2 (en) | 2000-10-13 | 2006-04-25 | Université de Lausanne | Intracellular delivery of biological effectors |
AU1112202A (en) | 2000-10-17 | 2002-04-29 | Diatranz Ltd | Preparation and xenotransplantation or porcine islets |
US20030077826A1 (en) | 2001-02-02 | 2003-04-24 | Lena Edelman | Chimeric molecules containing a module able to target specific cells and a module regulating the apoptogenic function of the permeability transition pore complex (PTPC) |
CA2437248A1 (en) | 2001-02-02 | 2002-08-15 | Takeda Chemical Industries, Ltd. | Jnk inhibitor |
US20030091640A1 (en) | 2001-02-08 | 2003-05-15 | Srinivasan Ramanathan | Enhanced oral and transcompartmental delivery of therapeutic or diagnostic agents |
JP2005508832A (ja) | 2001-02-16 | 2005-04-07 | セルゲイト, インコーポレイテッド | 間隔を開けてアルギニン部分を含むトランスポーター |
DE10117281A1 (de) | 2001-04-06 | 2002-10-24 | Inst Molekulare Biotechnologie | Peptid zur Diagnose und Therapie der Alzheimer-Demenz |
WO2002081504A2 (en) | 2001-04-06 | 2002-10-17 | Thomas Jefferson University | Multimerization of hiv-1 vif protein as a therapeutic target |
WO2003008553A2 (en) | 2001-07-17 | 2003-01-30 | Incyte Genomics, Inc. | Proteins associated with cell growth, differentiation, and death |
WO2004045535A2 (en) | 2002-11-14 | 2004-06-03 | Arbor Vita Corporation | Molecular interactions in neurons |
IL160915A0 (en) | 2001-09-19 | 2004-08-31 | Aventis Pharma Sa | Indolizines inhibiting kinase proteins |
JP2005525096A (ja) | 2002-01-09 | 2005-08-25 | ユニバーシティ オブ ローザンヌ | Jnkシグナル伝達経路の細胞浸透性ペプチドインヒビター |
CA2478338A1 (en) | 2002-03-08 | 2003-09-18 | Signal Pharmaceuticals, Inc. | Combination therapy for treating, preventing or managing proliferative disorders and cancers |
SE0201863D0 (en) | 2002-06-18 | 2002-06-18 | Cepep Ab | Cell penetrating peptides |
AU2003267124A1 (en) | 2002-09-09 | 2004-03-29 | Dana-Farber Cancer Institute, Inc. | Bh3 peptides and method of use thereof |
PL374700A1 (en) * | 2002-09-20 | 2005-10-31 | Alcon, Inc. | Use of cytokine synthesis inhibitors for the treatment of dry eye disorders |
ATE350480T1 (de) | 2002-10-11 | 2007-01-15 | Imvision Gmbh | Moduläre antigen-transporter moleküle (mat- moleküle) zur modulierung von immunreaktionen, zugehörige konstrukte, verfahren und verwendungen |
WO2004037196A2 (en) | 2002-10-24 | 2004-05-06 | Sangstat Medical Corporation | Cytomodulating peptides and methods for treating neurological disorders |
BR0316256A (pt) | 2002-11-18 | 2005-10-04 | Celgene Corp | Métodos de inibir a produção de tnf-alfa e a atividade de pde4, de tratar ou prevenir uma doença ou um distúrbio, de controlar os nìveis de camp em uma célula e de produzir um composto, composição farmacêutica e composto |
US20050019366A1 (en) * | 2002-12-31 | 2005-01-27 | Zeldis Jerome B. | Drug-coated stents and methods of use therefor |
US7166692B2 (en) | 2003-03-04 | 2007-01-23 | Canbrex Bio Science Walkersville, Inc. | Intracellular delivery of small molecules, proteins, and nucleic acids |
EP2295433A3 (en) | 2003-03-06 | 2011-07-06 | Eisai R&D Management Co., Ltd. | JNK inhibitors |
WO2004092339A2 (en) | 2003-04-11 | 2004-10-28 | Ilex Products, Inc. | Modulation of muc1 mediated signal transduction |
AU2004235396B2 (en) | 2003-04-29 | 2010-11-25 | Sarepta Therapeutics, Inc. | Compositions for enhancing transport and antisense efficacy of nucleic acid analog into cells |
US20060222657A1 (en) | 2003-06-20 | 2006-10-05 | Dowdy Steven F | Polypeptide transduction and fusogenic peptides |
KR100685345B1 (ko) | 2004-03-27 | 2007-02-22 | 학교법인조선대학교 | 세포사 유도 펩타이드 |
US20080039377A1 (en) | 2004-04-08 | 2008-02-14 | Applied Research Systems Ars Holding N.V. | Composition Comprising a Jnk Inhibitor and Cyclosporin |
EP1786781A2 (en) | 2004-08-27 | 2007-05-23 | GPC Biotech AG | Pyrimidine derivatives |
US20060094753A1 (en) | 2004-10-29 | 2006-05-04 | Alcon, Inc. | Use of inhibitors of Jun N-terminal kinases for the treatment of glaucomatous retinopathy and ocular diseases |
EP1656951A1 (en) | 2004-11-12 | 2006-05-17 | Xigen S.A. | Conjugates with enhanced cell uptake activity |
US20100256041A1 (en) | 2004-11-12 | 2010-10-07 | Christophe Bonny | Conjugate Molecule Compounds With Enhanced Cell Uptake Activity |
EP1661912A1 (en) | 2004-11-29 | 2006-05-31 | Xigen S.A. | Fusion protein comprising a BH3-domain of a BH3-only protein |
EP1676574A3 (en) | 2004-12-30 | 2006-07-26 | Johnson & Johnson Vision Care, Inc. | Methods for promoting survival of transplanted tissues and cells |
US20060223807A1 (en) | 2005-03-29 | 2006-10-05 | University Of Massachusetts Medical School, A Massachusetts Corporation | Therapeutic methods for type I diabetes |
US20060258706A1 (en) | 2005-04-29 | 2006-11-16 | Manohar Saindane | Solid forms of a JNK inhibitor |
US20070015779A1 (en) | 2005-04-29 | 2007-01-18 | John Griffin | Compositions and treatments for inhibiting kinase and/or hmg-coa reductase |
US20070003531A1 (en) | 2005-06-30 | 2007-01-04 | University Of Connecticut | Methods for improving immunotherapy by enhancing survival of antigen-specific cytotoxic T lymphocytes |
WO2007031098A1 (en) * | 2005-09-12 | 2007-03-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the jnk signal transduction pathway |
WO2008006046A1 (en) | 2006-07-06 | 2008-01-10 | Case Western Reserve University | Ceramide composition and use thereof in treatment of ocular diseases |
EP1884521A1 (en) | 2006-07-31 | 2008-02-06 | Xigen S.A. | Fusion peptide for inhibiting interaction of neuronal NMDA receptor (NMDAR) and NMDAR interacting proteins |
WO2008094208A2 (en) | 2006-08-02 | 2008-08-07 | Northwestern University | Protein kinase targeted therapeutics |
AU2007293917B2 (en) | 2006-09-08 | 2013-01-31 | F. Hoffmann-La Roche Ag | Benzotriazole kinase modulators |
CA2663545A1 (en) | 2006-09-19 | 2008-03-27 | Phylogica Limited | Neuroprotective peptide inhibitors of ap-1 signaling and uses thereof |
GB0702259D0 (en) | 2007-02-06 | 2007-03-14 | Eisai London Res Lab Ltd | 7-azaindole derivatives |
MX2010011880A (es) | 2008-04-29 | 2011-05-25 | Pharnext | Nuevos enfoques terapeuticos para tratar la enfermedad del alzheimer y trastornos relacionados mediante una modulacion de la respuesta de estres celular. |
CN102112177A (zh) * | 2008-05-02 | 2011-06-29 | 梅德特龙尼克有限公司 | 自膨胀式电极套 |
RU2510274C2 (ru) | 2008-05-07 | 2014-03-27 | Дзе Реджентс Оф Дзе Юниверсити Оф Калифорния | Терапевтическое восстановление и усиление увлажнения поверхности глаза |
WO2009143864A1 (en) | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
WO2009143865A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
US20100183633A1 (en) | 2008-12-04 | 2010-07-22 | University Of Massachusetts | Interleukin 6 and tumor necrosis factor alpha as biomarkers of jnk inhibition |
WO2010072228A1 (en) | 2008-12-22 | 2010-07-01 | Xigen S.A. | Novel transporter constructs and transporter cargo conjugate molecules |
EP2381934A2 (en) | 2008-12-23 | 2011-11-02 | Carmel - Haifa University Economic Corp Ltd. | Improving cognitive function |
SG173584A1 (en) | 2009-02-06 | 2011-09-29 | Elan Pharm Inc | Inhibitors of jun n-terminal kinase |
KR20120022721A (ko) | 2009-03-30 | 2012-03-12 | 산텐 세이야꾸 가부시키가이샤 | JNK(c-Jun 아미노 말단 키나제) 저해 펩티드를 이용한 망막 질환의 예방 또는 치료제, 망막 질환의 예방 또는 치료 방법, 및 이 펩티드의 용도 |
WO2010151638A1 (en) | 2009-06-25 | 2010-12-29 | Medical College Of Georgia Research Institute, Inc. | Jnk inhibitors for use in treating spinal muscular atrophy |
MX2012004638A (es) | 2009-10-22 | 2012-07-04 | Genentech Inc | Modulacion de degeneracion de axones. |
WO2011082328A1 (en) * | 2009-12-31 | 2011-07-07 | Stealth Peptides International, Inc. | Methods for performing a coronary artery bypass graft procedure |
WO2012048721A1 (en) * | 2010-10-14 | 2012-04-19 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
PL2902035T3 (pl) | 2010-10-14 | 2019-04-30 | Xigen Inflammation Ltd | Przechodzące przez komórkę peptydowe inhibitory szlaku przekazywania sygnałów przez JNK do zastosowania w leczeniu chorób zapalnych oka |
US8471027B2 (en) | 2011-04-06 | 2013-06-25 | Hoffmann-La Roche Inc. | Adamantyl compounds |
KR20140099526A (ko) | 2011-11-30 | 2014-08-12 | 자이겐 인플라메이션 리미티드 | 안구 건조증의 치료를 위한 jnk 신호 전달 경로의 세포-투과성 펩타이드 억제자의 용도 |
WO2013091670A1 (en) | 2011-12-21 | 2013-06-27 | Xigen S.A. | Novel jnk inhibitor molecules for treatment of various diseases |
CA2903275A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
WO2014206427A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
WO2014206426A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
JP2015197193A (ja) | 2014-04-02 | 2015-11-09 | トヨタ自動車株式会社 | 車両用無段変速機の油圧制御装置 |
EP3160989A2 (en) | 2014-06-26 | 2017-05-03 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
EP3313428A1 (en) | 2015-06-26 | 2018-05-02 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of mild cognitive impairment |
-
2011
- 2011-12-21 WO PCT/EP2011/006481 patent/WO2013091670A1/en active Application Filing
-
2012
- 2012-12-21 KR KR1020147020417A patent/KR20140108308A/ko not_active Application Discontinuation
- 2012-12-21 ES ES12809126T patent/ES2784551T3/es active Active
- 2012-12-21 EA EA201491221A patent/EA201491221A1/ru unknown
- 2012-12-21 PL PL12809126T patent/PL2793919T3/pl unknown
- 2012-12-21 US US14/367,706 patent/US20150133393A1/en not_active Abandoned
- 2012-12-21 EP EP12809126.1A patent/EP2793919B1/en active Active
- 2012-12-21 WO PCT/EP2012/005362 patent/WO2013091896A1/en active Application Filing
- 2012-12-21 CN CN201280063545.6A patent/CN104080469B/zh active Active
- 2012-12-21 MX MX2014007566A patent/MX2014007566A/es unknown
- 2012-12-21 SG SG11201402432WA patent/SG11201402432WA/en unknown
- 2012-12-21 SG SG10201605098UA patent/SG10201605098UA/en unknown
- 2012-12-21 CA CA2855226A patent/CA2855226C/en active Active
- 2012-12-21 JP JP2014547766A patent/JP6149044B2/ja not_active Expired - Fee Related
- 2012-12-21 BR BR112014014783A patent/BR112014014783A2/pt not_active IP Right Cessation
- 2012-12-21 AU AU2012359164A patent/AU2012359164A1/en not_active Abandoned
- 2012-12-21 EP EP20000027.1A patent/EP3718555A1/en not_active Withdrawn
-
2014
- 2014-05-22 IL IL232763A patent/IL232763A0/en unknown
- 2014-12-16 HK HK14112613.6A patent/HK1198943A1/zh unknown
-
2016
- 2016-07-22 US US15/217,326 patent/US10596223B2/en not_active Expired - Fee Related
-
2017
- 2017-11-23 AU AU2017265115A patent/AU2017265115B2/en not_active Ceased
-
2019
- 2019-12-23 AU AU2019284035A patent/AU2019284035A1/en not_active Abandoned
-
2020
- 2020-01-24 US US16/751,439 patent/US20200206301A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20070060514A1 (en) * | 2005-09-12 | 2007-03-15 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
US8981052B2 (en) * | 2010-06-21 | 2015-03-17 | Xigen Inflammation Ltd. | JNK inhibitor molecules |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10967038B2 (en) | 2010-10-14 | 2021-04-06 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
US10596223B2 (en) | 2011-12-21 | 2020-03-24 | Xigen Inflammation Ltd. | JNK inhibitor molecules for treatment of various diseases |
US20160115200A1 (en) * | 2013-06-26 | 2016-04-28 | Xigen Inflammation Ltd. | New Use for JNK Inhibitor Molecules for Treatment of Various Diseases |
US20170290877A1 (en) * | 2013-06-26 | 2017-10-12 | Xigen Inflammation Ltd. | Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Various Diseases |
US10624948B2 (en) | 2013-06-26 | 2020-04-21 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
US11779628B2 (en) * | 2013-06-26 | 2023-10-10 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
US11331364B2 (en) | 2014-06-26 | 2022-05-17 | Xigen Inflammation Ltd. | Use for JNK inhibitor molecules for treatment of various diseases |
Also Published As
Publication number | Publication date |
---|---|
EP2793919A1 (en) | 2014-10-29 |
US20170056466A1 (en) | 2017-03-02 |
PL2793919T3 (pl) | 2020-07-13 |
CA2855226A1 (en) | 2013-06-27 |
JP2015502372A (ja) | 2015-01-22 |
EA201491221A1 (ru) | 2014-11-28 |
EP2793919B1 (en) | 2020-01-22 |
CN104080469B (zh) | 2019-01-04 |
AU2019284035A1 (en) | 2020-01-23 |
AU2012359164A1 (en) | 2014-05-29 |
MX2014007566A (es) | 2014-11-21 |
US20200206301A1 (en) | 2020-07-02 |
KR20140108308A (ko) | 2014-09-05 |
IL232763A0 (en) | 2014-07-31 |
ES2784551T3 (es) | 2020-09-28 |
CA2855226C (en) | 2022-06-07 |
BR112014014783A2 (pt) | 2019-09-24 |
CN104080469A (zh) | 2014-10-01 |
US10596223B2 (en) | 2020-03-24 |
EP3718555A1 (en) | 2020-10-07 |
WO2013091896A1 (en) | 2013-06-27 |
AU2017265115A1 (en) | 2017-12-14 |
AU2017265115B2 (en) | 2019-10-31 |
WO2013091670A1 (en) | 2013-06-27 |
HK1198943A1 (zh) | 2015-06-19 |
SG11201402432WA (en) | 2014-09-26 |
SG10201605098UA (en) | 2016-07-28 |
JP6149044B2 (ja) | 2017-06-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200206301A1 (en) | JNK Inhibitor Molecules For Treatment Of Various Diseases | |
US20160115200A1 (en) | New Use for JNK Inhibitor Molecules for Treatment of Various Diseases | |
EP1811033B1 (en) | Cell-permeable peptide inhibitors of the JNK signal transduction pathway | |
EP2224941B1 (en) | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases | |
WO2015197193A2 (en) | New use for jnk inhibitor molecules for treatment of various diseases | |
WO2014206563A2 (en) | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases | |
EP3160489B9 (en) | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of cystitis | |
US11331364B2 (en) | Use for JNK inhibitor molecules for treatment of various diseases | |
KR102017973B1 (ko) | 항-b형 간염 바이러스 x 단백질 폴리펩티드 약제 | |
JP2021514183A (ja) | 改変免疫調節ペプチド | |
KR20230006581A (ko) | 고형암의 치료에 사용하기 위한 pcna 상호작용 모티프를 함유하는 펩티드 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |