US20140342094A1 - Use of Specially Coated Powdered Coating Materials and Coating Methods Using Such Coating Materials - Google Patents
Use of Specially Coated Powdered Coating Materials and Coating Methods Using Such Coating Materials Download PDFInfo
- Publication number
- US20140342094A1 US20140342094A1 US14/234,833 US201214234833A US2014342094A1 US 20140342094 A1 US20140342094 A1 US 20140342094A1 US 201214234833 A US201214234833 A US 201214234833A US 2014342094 A1 US2014342094 A1 US 2014342094A1
- Authority
- US
- United States
- Prior art keywords
- coating
- coating material
- particles
- spraying
- named
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000576 coating method Methods 0.000 title claims abstract description 397
- 239000011248 coating agent Substances 0.000 title claims abstract description 325
- 239000000463 material Substances 0.000 title claims abstract description 170
- 239000002245 particle Substances 0.000 claims abstract description 131
- 239000000654 additive Substances 0.000 claims abstract description 118
- 230000000996 additive effect Effects 0.000 claims abstract description 99
- 238000000034 method Methods 0.000 claims abstract description 89
- 238000007750 plasma spraying Methods 0.000 claims abstract description 49
- 238000010285 flame spraying Methods 0.000 claims abstract description 47
- 238000005507 spraying Methods 0.000 claims abstract description 19
- 238000009826 distribution Methods 0.000 claims description 48
- 239000000203 mixture Substances 0.000 claims description 47
- 239000000758 substrate Substances 0.000 claims description 47
- 239000001993 wax Substances 0.000 claims description 30
- 125000004432 carbon atom Chemical group C* 0.000 claims description 26
- 229910052751 metal Inorganic materials 0.000 claims description 26
- 239000002184 metal Substances 0.000 claims description 26
- 229920000642 polymer Polymers 0.000 claims description 24
- BLRPTPMANUNPDV-UHFFFAOYSA-N Silane Chemical compound [SiH4] BLRPTPMANUNPDV-UHFFFAOYSA-N 0.000 claims description 21
- 229910052782 aluminium Inorganic materials 0.000 claims description 20
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 claims description 20
- 238000000354 decomposition reaction Methods 0.000 claims description 20
- 229910000077 silane Inorganic materials 0.000 claims description 20
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 claims description 19
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 claims description 19
- 239000010949 copper Substances 0.000 claims description 19
- 229910052802 copper Inorganic materials 0.000 claims description 19
- 230000008569 process Effects 0.000 claims description 18
- 239000000178 monomer Substances 0.000 claims description 17
- 150000001735 carboxylic acids Chemical class 0.000 claims description 15
- CERQOIWHTDAKMF-UHFFFAOYSA-M Methacrylate Chemical compound CC(=C)C([O-])=O CERQOIWHTDAKMF-UHFFFAOYSA-M 0.000 claims description 14
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 claims description 13
- 150000004756 silanes Chemical class 0.000 claims description 13
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 claims description 12
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 claims description 12
- 239000011135 tin Substances 0.000 claims description 12
- 229910052718 tin Inorganic materials 0.000 claims description 12
- 238000009835 boiling Methods 0.000 claims description 11
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 claims description 10
- 229910052709 silver Inorganic materials 0.000 claims description 10
- 239000004332 silver Substances 0.000 claims description 10
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 claims description 9
- 150000001875 compounds Chemical class 0.000 claims description 9
- 150000003009 phosphonic acids Chemical class 0.000 claims description 9
- 229910052725 zinc Inorganic materials 0.000 claims description 9
- 239000011701 zinc Substances 0.000 claims description 9
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 8
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 claims description 7
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 claims description 7
- 229910052737 gold Inorganic materials 0.000 claims description 7
- 239000010931 gold Substances 0.000 claims description 7
- 229910052710 silicon Inorganic materials 0.000 claims description 7
- 239000010703 silicon Substances 0.000 claims description 7
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 claims description 6
- RTAQQCXQSZGOHL-UHFFFAOYSA-N Titanium Chemical compound [Ti] RTAQQCXQSZGOHL-UHFFFAOYSA-N 0.000 claims description 6
- 239000000956 alloy Substances 0.000 claims description 6
- 229910045601 alloy Inorganic materials 0.000 claims description 6
- 229910052742 iron Inorganic materials 0.000 claims description 6
- 229910052759 nickel Inorganic materials 0.000 claims description 6
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 claims description 6
- 239000010936 titanium Substances 0.000 claims description 6
- 229910052719 titanium Inorganic materials 0.000 claims description 6
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 claims description 5
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 claims description 5
- 239000000443 aerosol Substances 0.000 claims description 5
- 229910052799 carbon Inorganic materials 0.000 claims description 5
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 claims description 5
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 claims description 4
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 claims description 4
- 239000005642 Oleic acid Substances 0.000 claims description 4
- 235000021355 Stearic acid Nutrition 0.000 claims description 4
- 239000002923 metal particle Substances 0.000 claims description 4
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 claims description 4
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 claims description 4
- 239000008117 stearic acid Substances 0.000 claims description 4
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 claims description 3
- 229910052787 antimony Inorganic materials 0.000 claims description 3
- WATWJIUSRGPENY-UHFFFAOYSA-N antimony atom Chemical compound [Sb] WATWJIUSRGPENY-UHFFFAOYSA-N 0.000 claims description 3
- 229910052804 chromium Inorganic materials 0.000 claims description 3
- 239000011651 chromium Substances 0.000 claims description 3
- 229910017052 cobalt Inorganic materials 0.000 claims description 3
- 239000010941 cobalt Substances 0.000 claims description 3
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 claims description 3
- 229910052732 germanium Inorganic materials 0.000 claims description 3
- GNPVGFCGXDBREM-UHFFFAOYSA-N germanium atom Chemical compound [Ge] GNPVGFCGXDBREM-UHFFFAOYSA-N 0.000 claims description 3
- WPBNNNQJVZRUHP-UHFFFAOYSA-L manganese(2+);methyl n-[[2-(methoxycarbonylcarbamothioylamino)phenyl]carbamothioyl]carbamate;n-[2-(sulfidocarbothioylamino)ethyl]carbamodithioate Chemical compound [Mn+2].[S-]C(=S)NCCNC([S-])=S.COC(=O)NC(=S)NC1=CC=CC=C1NC(=S)NC(=O)OC WPBNNNQJVZRUHP-UHFFFAOYSA-L 0.000 claims description 3
- 229910052763 palladium Inorganic materials 0.000 claims description 3
- 229910052697 platinum Inorganic materials 0.000 claims description 3
- 229910052720 vanadium Inorganic materials 0.000 claims description 3
- GPPXJZIENCGNKB-UHFFFAOYSA-N vanadium Chemical compound [V]#[V] GPPXJZIENCGNKB-UHFFFAOYSA-N 0.000 claims description 3
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical compound OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 claims 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 claims 1
- 239000007789 gas Substances 0.000 description 56
- 239000010410 layer Substances 0.000 description 46
- -1 C20 carboxylic acids Chemical class 0.000 description 40
- 229920003023 plastic Polymers 0.000 description 31
- 239000004033 plastic Substances 0.000 description 31
- 210000002381 plasma Anatomy 0.000 description 25
- 239000000843 powder Substances 0.000 description 21
- 229920003002 synthetic resin Polymers 0.000 description 19
- 239000000057 synthetic resin Substances 0.000 description 19
- 239000000126 substance Substances 0.000 description 18
- 125000003118 aryl group Chemical group 0.000 description 16
- 229920000193 polymethacrylate Polymers 0.000 description 14
- 229920000058 polyacrylate Polymers 0.000 description 13
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 12
- 229920001577 copolymer Polymers 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 229910044991 metal oxide Inorganic materials 0.000 description 12
- 150000004706 metal oxides Chemical class 0.000 description 12
- 125000000524 functional group Chemical group 0.000 description 11
- 229920006395 saturated elastomer Polymers 0.000 description 10
- 239000003570 air Substances 0.000 description 9
- 239000011521 glass Substances 0.000 description 9
- 150000002739 metals Chemical class 0.000 description 9
- 150000004676 glycans Chemical class 0.000 description 8
- 229910052760 oxygen Inorganic materials 0.000 description 8
- 229920001282 polysaccharide Polymers 0.000 description 8
- 239000005017 polysaccharide Substances 0.000 description 8
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 7
- 239000004698 Polyethylene Substances 0.000 description 7
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 7
- 229920002678 cellulose Polymers 0.000 description 7
- 229910052739 hydrogen Inorganic materials 0.000 description 7
- 239000001257 hydrogen Substances 0.000 description 7
- 238000005259 measurement Methods 0.000 description 7
- 239000001301 oxygen Substances 0.000 description 7
- 229920000412 polyarylene Polymers 0.000 description 7
- 229920000573 polyethylene Polymers 0.000 description 7
- 229920001187 thermosetting polymer Polymers 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 229910052786 argon Inorganic materials 0.000 description 6
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 6
- 238000002485 combustion reaction Methods 0.000 description 6
- 150000001991 dicarboxylic acids Chemical class 0.000 description 6
- 235000014113 dietary fatty acids Nutrition 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- 125000001033 ether group Chemical group 0.000 description 6
- 239000000194 fatty acid Substances 0.000 description 6
- 229930195729 fatty acid Natural products 0.000 description 6
- 150000004665 fatty acids Chemical class 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 150000002734 metacrylic acid derivatives Chemical class 0.000 description 6
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 5
- 239000004743 Polypropylene Substances 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 239000001913 cellulose Substances 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 239000000470 constituent Substances 0.000 description 5
- 229920001971 elastomer Polymers 0.000 description 5
- 239000000806 elastomer Substances 0.000 description 5
- 229910052736 halogen Inorganic materials 0.000 description 5
- 150000002367 halogens Chemical class 0.000 description 5
- 125000001072 heteroaryl group Chemical group 0.000 description 5
- 125000004435 hydrogen atom Chemical class [H]* 0.000 description 5
- 229910052500 inorganic mineral Inorganic materials 0.000 description 5
- 239000011707 mineral Substances 0.000 description 5
- 229910052757 nitrogen Inorganic materials 0.000 description 5
- 230000003647 oxidation Effects 0.000 description 5
- 238000007254 oxidation reaction Methods 0.000 description 5
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 5
- 229920001155 polypropylene Polymers 0.000 description 5
- 229920001169 thermoplastic Polymers 0.000 description 5
- 239000004416 thermosoftening plastic Substances 0.000 description 5
- 125000000923 (C1-C30) alkyl group Chemical group 0.000 description 4
- XDLMVUHYZWKMMD-UHFFFAOYSA-N 3-trimethoxysilylpropyl 2-methylprop-2-enoate Chemical compound CO[Si](OC)(OC)CCCOC(=O)C(C)=C XDLMVUHYZWKMMD-UHFFFAOYSA-N 0.000 description 4
- UZNLHJCCGYKCIL-UHFFFAOYSA-N 6-ethoxy-6-oxohexanoic acid Chemical compound CCOC(=O)CCCCC(O)=O UZNLHJCCGYKCIL-UHFFFAOYSA-N 0.000 description 4
- 239000004793 Polystyrene Substances 0.000 description 4
- 229910000831 Steel Inorganic materials 0.000 description 4
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 4
- 229920000122 acrylonitrile butadiene styrene Polymers 0.000 description 4
- 239000004676 acrylonitrile butadiene styrene Substances 0.000 description 4
- XECAHXYUAAWDEL-UHFFFAOYSA-N acrylonitrile butadiene styrene Chemical compound C=CC=C.C=CC#N.C=CC1=CC=CC=C1 XECAHXYUAAWDEL-UHFFFAOYSA-N 0.000 description 4
- WNLRTRBMVRJNCN-UHFFFAOYSA-N adipic acid Chemical compound OC(=O)CCCCC(O)=O WNLRTRBMVRJNCN-UHFFFAOYSA-N 0.000 description 4
- 125000006193 alkinyl group Chemical group 0.000 description 4
- 125000003710 aryl alkyl group Chemical group 0.000 description 4
- 238000005474 detonation Methods 0.000 description 4
- TVIDDXQYHWJXFK-UHFFFAOYSA-N dodecanedioic acid Chemical compound OC(=O)CCCCCCCCCCC(O)=O TVIDDXQYHWJXFK-UHFFFAOYSA-N 0.000 description 4
- ZQPPMHVWECSIRJ-MDZDMXLPSA-N elaidic acid Chemical compound CCCCCCCC\C=C\CCCCCCCC(O)=O ZQPPMHVWECSIRJ-MDZDMXLPSA-N 0.000 description 4
- 238000001033 granulometry Methods 0.000 description 4
- 239000001307 helium Substances 0.000 description 4
- 229910052734 helium Inorganic materials 0.000 description 4
- SWQJXJOGLNCZEY-UHFFFAOYSA-N helium atom Chemical compound [He] SWQJXJOGLNCZEY-UHFFFAOYSA-N 0.000 description 4
- 150000004679 hydroxides Chemical class 0.000 description 4
- 239000010954 inorganic particle Substances 0.000 description 4
- 238000002844 melting Methods 0.000 description 4
- 230000008018 melting Effects 0.000 description 4
- 239000013528 metallic particle Substances 0.000 description 4
- BDJRBEYXGGNYIS-UHFFFAOYSA-N nonanedioic acid Chemical compound OC(=O)CCCCCCCC(O)=O BDJRBEYXGGNYIS-UHFFFAOYSA-N 0.000 description 4
- 229920000098 polyolefin Polymers 0.000 description 4
- 229920002223 polystyrene Polymers 0.000 description 4
- CXMXRPHRNRROMY-UHFFFAOYSA-N sebacic acid Chemical compound OC(=O)CCCCCCCCC(O)=O CXMXRPHRNRROMY-UHFFFAOYSA-N 0.000 description 4
- 239000007858 starting material Substances 0.000 description 4
- 239000010959 steel Substances 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 229920002725 thermoplastic elastomer Polymers 0.000 description 4
- JLGLQAWTXXGVEM-UHFFFAOYSA-N triethylene glycol monomethyl ether Chemical compound COCCOCCOCCO JLGLQAWTXXGVEM-UHFFFAOYSA-N 0.000 description 4
- 239000002966 varnish Substances 0.000 description 4
- XLYMOEINVGRTEX-ONEGZZNKSA-N (e)-4-ethoxy-4-oxobut-2-enoic acid Chemical compound CCOC(=O)\C=C\C(O)=O XLYMOEINVGRTEX-ONEGZZNKSA-N 0.000 description 3
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 239000001856 Ethyl cellulose Substances 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 3
- 239000004952 Polyamide Substances 0.000 description 3
- 229920002614 Polyether block amide Polymers 0.000 description 3
- OKKRPWIIYQTPQF-UHFFFAOYSA-N Trimethylolpropane trimethacrylate Chemical compound CC(=C)C(=O)OCC(CC)(COC(=O)C(C)=C)COC(=O)C(C)=C OKKRPWIIYQTPQF-UHFFFAOYSA-N 0.000 description 3
- 125000001931 aliphatic group Chemical group 0.000 description 3
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 3
- 239000012159 carrier gas Substances 0.000 description 3
- 230000007797 corrosion Effects 0.000 description 3
- 238000005260 corrosion Methods 0.000 description 3
- 125000000753 cycloalkyl group Chemical group 0.000 description 3
- 150000004985 diamines Chemical class 0.000 description 3
- 150000002170 ethers Chemical class 0.000 description 3
- 229920001249 ethyl cellulose Polymers 0.000 description 3
- 235000019325 ethyl cellulose Nutrition 0.000 description 3
- STVZJERGLQHEKB-UHFFFAOYSA-N ethylene glycol dimethacrylate Substances CC(=C)C(=O)OCCOC(=O)C(C)=C STVZJERGLQHEKB-UHFFFAOYSA-N 0.000 description 3
- QFXZANXYUCUTQH-UHFFFAOYSA-N ethynol Chemical group OC#C QFXZANXYUCUTQH-UHFFFAOYSA-N 0.000 description 3
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 3
- 238000001704 evaporation Methods 0.000 description 3
- 230000008020 evaporation Effects 0.000 description 3
- 239000000446 fuel Substances 0.000 description 3
- XLYMOEINVGRTEX-UHFFFAOYSA-N fumaric acid monoethyl ester Natural products CCOC(=O)C=CC(O)=O XLYMOEINVGRTEX-UHFFFAOYSA-N 0.000 description 3
- 150000004820 halides Chemical class 0.000 description 3
- 125000000592 heterocycloalkyl group Chemical group 0.000 description 3
- 229920005669 high impact polystyrene Polymers 0.000 description 3
- 239000004797 high-impact polystyrene Substances 0.000 description 3
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 3
- 238000000691 measurement method Methods 0.000 description 3
- 150000001247 metal acetylides Chemical class 0.000 description 3
- 229940074369 monoethyl fumarate Drugs 0.000 description 3
- 150000004767 nitrides Chemical class 0.000 description 3
- 235000021313 oleic acid Nutrition 0.000 description 3
- 229920002647 polyamide Polymers 0.000 description 3
- 239000004417 polycarbonate Substances 0.000 description 3
- 229920000515 polycarbonate Polymers 0.000 description 3
- 229920000728 polyester Polymers 0.000 description 3
- 238000006116 polymerization reaction Methods 0.000 description 3
- 239000004800 polyvinyl chloride Substances 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 125000001294 (C1-C30) cycloalkyl group Chemical group 0.000 description 2
- 125000006527 (C1-C5) alkyl group Chemical group 0.000 description 2
- XFCMNSHQOZQILR-UHFFFAOYSA-N 2-[2-(2-methylprop-2-enoyloxy)ethoxy]ethyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCOCCOC(=O)C(C)=C XFCMNSHQOZQILR-UHFFFAOYSA-N 0.000 description 2
- HCLJOFJIQIJXHS-UHFFFAOYSA-N 2-[2-[2-(2-prop-2-enoyloxyethoxy)ethoxy]ethoxy]ethyl prop-2-enoate Chemical compound C=CC(=O)OCCOCCOCCOCCOC(=O)C=C HCLJOFJIQIJXHS-UHFFFAOYSA-N 0.000 description 2
- FGSFVBRPCKXYDI-UHFFFAOYSA-N 2-triethoxysilylethyl 2-methylprop-2-enoate Chemical compound CCO[Si](OCC)(OCC)CCOC(=O)C(C)=C FGSFVBRPCKXYDI-UHFFFAOYSA-N 0.000 description 2
- RDCTZTAAYLXPDJ-UHFFFAOYSA-N 2-trimethoxysilylethyl 2-methylprop-2-enoate Chemical compound CO[Si](OC)(OC)CCOC(=O)C(C)=C RDCTZTAAYLXPDJ-UHFFFAOYSA-N 0.000 description 2
- URDOJQUSEUXVRP-UHFFFAOYSA-N 3-triethoxysilylpropyl 2-methylprop-2-enoate Chemical compound CCO[Si](OCC)(OCC)CCCOC(=O)C(C)=C URDOJQUSEUXVRP-UHFFFAOYSA-N 0.000 description 2
- DBCAQXHNJOFNGC-UHFFFAOYSA-N 4-bromo-1,1,1-trifluorobutane Chemical compound FC(F)(F)CCCBr DBCAQXHNJOFNGC-UHFFFAOYSA-N 0.000 description 2
- 125000000739 C2-C30 alkenyl group Chemical group 0.000 description 2
- 229920001780 ECTFE Polymers 0.000 description 2
- 208000032365 Electromagnetic interference Diseases 0.000 description 2
- UQSXHKLRYXJYBZ-UHFFFAOYSA-N Iron oxide Chemical compound [Fe]=O UQSXHKLRYXJYBZ-UHFFFAOYSA-N 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- VVQNEPGJFQJSBK-UHFFFAOYSA-N Methyl methacrylate Chemical compound COC(=O)C(C)=C VVQNEPGJFQJSBK-UHFFFAOYSA-N 0.000 description 2
- 239000002033 PVDF binder Substances 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- PPBRXRYQALVLMV-UHFFFAOYSA-N Styrene Chemical compound C=CC1=CC=CC=C1 PPBRXRYQALVLMV-UHFFFAOYSA-N 0.000 description 2
- KKEYFWRCBNTPAC-UHFFFAOYSA-N Terephthalic acid Chemical compound OC(=O)C1=CC=C(C(O)=O)C=C1 KKEYFWRCBNTPAC-UHFFFAOYSA-N 0.000 description 2
- 239000004433 Thermoplastic polyurethane Substances 0.000 description 2
- BZHJMEDXRYGGRV-UHFFFAOYSA-N Vinyl chloride Chemical compound ClC=C BZHJMEDXRYGGRV-UHFFFAOYSA-N 0.000 description 2
- YBUIRAZOPRQNDE-UHFFFAOYSA-N [dimethoxy(methyl)silyl]methyl 2-methylprop-2-enoate Chemical compound CO[Si](C)(OC)COC(=O)C(C)=C YBUIRAZOPRQNDE-UHFFFAOYSA-N 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 239000001361 adipic acid Substances 0.000 description 2
- 235000011037 adipic acid Nutrition 0.000 description 2
- MBMBGCFOFBJSGT-KUBAVDMBSA-N all-cis-docosa-4,7,10,13,16,19-hexaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCC(O)=O MBMBGCFOFBJSGT-KUBAVDMBSA-N 0.000 description 2
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 2
- 125000005013 aryl ether group Chemical group 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 229920001400 block copolymer Polymers 0.000 description 2
- WERYXYBDKMZEQL-UHFFFAOYSA-N butane-1,4-diol Chemical compound OCCCCO WERYXYBDKMZEQL-UHFFFAOYSA-N 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000004020 conductor Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 230000001186 cumulative effect Effects 0.000 description 2
- 125000004093 cyano group Chemical group *C#N 0.000 description 2
- 125000000392 cycloalkenyl group Chemical group 0.000 description 2
- 125000001316 cycloalkyl alkyl group Chemical group 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-N decanoic acid Chemical compound CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000000151 deposition Methods 0.000 description 2
- 230000008021 deposition Effects 0.000 description 2
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N diphenyl Chemical compound C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- UKMSUNONTOPOIO-UHFFFAOYSA-N docosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCC(O)=O UKMSUNONTOPOIO-UHFFFAOYSA-N 0.000 description 2
- SNRUBQQJIBEYMU-UHFFFAOYSA-N dodecane Chemical compound CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 2
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 125000004185 ester group Chemical group 0.000 description 2
- 229920000840 ethylene tetrafluoroethylene copolymer Polymers 0.000 description 2
- 239000002737 fuel gas Substances 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- KEMQGTRYUADPNZ-UHFFFAOYSA-N heptadecanoic acid Chemical compound CCCCCCCCCCCCCCCCC(O)=O KEMQGTRYUADPNZ-UHFFFAOYSA-N 0.000 description 2
- 125000004446 heteroarylalkyl group Chemical group 0.000 description 2
- 125000005885 heterocycloalkylalkyl group Chemical group 0.000 description 2
- XMHIUKTWLZUKEX-UHFFFAOYSA-N hexacosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCC(O)=O XMHIUKTWLZUKEX-UHFFFAOYSA-N 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- VKOBVWXKNCXXDE-UHFFFAOYSA-N icosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCC(O)=O VKOBVWXKNCXXDE-UHFFFAOYSA-N 0.000 description 2
- 125000005462 imide group Chemical group 0.000 description 2
- QQVIHTHCMHWDBS-UHFFFAOYSA-N isophthalic acid Chemical compound OC(=O)C1=CC=CC(C(O)=O)=C1 QQVIHTHCMHWDBS-UHFFFAOYSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 2
- 125000004433 nitrogen atom Chemical group N* 0.000 description 2
- ISYWECDDZWTKFF-UHFFFAOYSA-N nonadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCCC(O)=O ISYWECDDZWTKFF-UHFFFAOYSA-N 0.000 description 2
- 239000003960 organic solvent Substances 0.000 description 2
- SECPZKHBENQXJG-FPLPWBNLSA-N palmitoleic acid Chemical compound CCCCCC\C=C/CCCCCCCC(O)=O SECPZKHBENQXJG-FPLPWBNLSA-N 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- 238000005240 physical vapour deposition Methods 0.000 description 2
- 239000000049 pigment Substances 0.000 description 2
- WLJVNTCWHIRURA-UHFFFAOYSA-N pimelic acid Chemical compound OC(=O)CCCCCC(O)=O WLJVNTCWHIRURA-UHFFFAOYSA-N 0.000 description 2
- 229920002493 poly(chlorotrifluoroethylene) Polymers 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 2
- 229920001707 polybutylene terephthalate Polymers 0.000 description 2
- 239000005023 polychlorotrifluoroethylene (PCTFE) polymer Substances 0.000 description 2
- 229920000139 polyethylene terephthalate Polymers 0.000 description 2
- 239000005020 polyethylene terephthalate Substances 0.000 description 2
- 239000004926 polymethyl methacrylate Substances 0.000 description 2
- 229920006324 polyoxymethylene Polymers 0.000 description 2
- 229920001955 polyphenylene ether Polymers 0.000 description 2
- 229920001343 polytetrafluoroethylene Polymers 0.000 description 2
- 239000004810 polytetrafluoroethylene Substances 0.000 description 2
- 229920000915 polyvinyl chloride Polymers 0.000 description 2
- 229920002620 polyvinyl fluoride Polymers 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 238000012805 post-processing Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 229910052814 silicon oxide Inorganic materials 0.000 description 2
- 238000005245 sintering Methods 0.000 description 2
- 238000003980 solgel method Methods 0.000 description 2
- 229920000468 styrene butadiene styrene block copolymer Polymers 0.000 description 2
- TYFQFVWCELRYAO-UHFFFAOYSA-N suberic acid Chemical compound OC(=O)CCCCCCC(O)=O TYFQFVWCELRYAO-UHFFFAOYSA-N 0.000 description 2
- 125000000542 sulfonic acid group Chemical group 0.000 description 2
- 229920002397 thermoplastic olefin Polymers 0.000 description 2
- 229920006346 thermoplastic polyester elastomer Polymers 0.000 description 2
- 229920002803 thermoplastic polyurethane Polymers 0.000 description 2
- VHOCUJPBKOZGJD-UHFFFAOYSA-N triacontanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC(O)=O VHOCUJPBKOZGJD-UHFFFAOYSA-N 0.000 description 2
- SZHOJFHSIKHZHA-UHFFFAOYSA-N tridecanoic acid Chemical compound CCCCCCCCCCCCC(O)=O SZHOJFHSIKHZHA-UHFFFAOYSA-N 0.000 description 2
- 238000002604 ultrasonography Methods 0.000 description 2
- ZDPHROOEEOARMN-UHFFFAOYSA-N undecanoic acid Chemical compound CCCCCCCCCCC(O)=O ZDPHROOEEOARMN-UHFFFAOYSA-N 0.000 description 2
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 2
- 229920002554 vinyl polymer Polymers 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 239000002023 wood Substances 0.000 description 2
- 229910052724 xenon Inorganic materials 0.000 description 2
- FHNFHKCVQCLJFQ-UHFFFAOYSA-N xenon atom Chemical compound [Xe] FHNFHKCVQCLJFQ-UHFFFAOYSA-N 0.000 description 2
- BITHHVVYSMSWAG-KTKRTIGZSA-N (11Z)-icos-11-enoic acid Chemical compound CCCCCCCC\C=C/CCCCCCCCCC(O)=O BITHHVVYSMSWAG-KTKRTIGZSA-N 0.000 description 1
- GWHCXVQVJPWHRF-KTKRTIGZSA-N (15Z)-tetracosenoic acid Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCCCC(O)=O GWHCXVQVJPWHRF-KTKRTIGZSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- CUXYLFPMQMFGPL-UHFFFAOYSA-N (9Z,11E,13E)-9,11,13-Octadecatrienoic acid Natural products CCCCC=CC=CC=CCCCCCCCC(O)=O CUXYLFPMQMFGPL-UHFFFAOYSA-N 0.000 description 1
- OYHQOLUKZRVURQ-NTGFUMLPSA-N (9Z,12Z)-9,10,12,13-tetratritiooctadeca-9,12-dienoic acid Chemical compound C(CCCCCCC\C(=C(/C\C(=C(/CCCCC)\[3H])\[3H])\[3H])\[3H])(=O)O OYHQOLUKZRVURQ-NTGFUMLPSA-N 0.000 description 1
- 125000004209 (C1-C8) alkyl group Chemical group 0.000 description 1
- 125000006552 (C3-C8) cycloalkyl group Chemical group 0.000 description 1
- PBBJBFOOHLPWOV-UHFFFAOYSA-N 1,1'-biphenyl;carbonic acid Chemical compound OC(O)=O.C1=CC=CC=C1C1=CC=CC=C1 PBBJBFOOHLPWOV-UHFFFAOYSA-N 0.000 description 1
- MYWOJODOMFBVCB-UHFFFAOYSA-N 1,2,6-trimethylphenanthrene Chemical compound CC1=CC=C2C3=CC(C)=CC=C3C=CC2=C1C MYWOJODOMFBVCB-UHFFFAOYSA-N 0.000 description 1
- BGJSXRVXTHVRSN-UHFFFAOYSA-N 1,3,5-trioxane Chemical compound C1OCOCO1 BGJSXRVXTHVRSN-UHFFFAOYSA-N 0.000 description 1
- VDYWHVQKENANGY-UHFFFAOYSA-N 1,3-Butyleneglycol dimethacrylate Chemical compound CC(=C)C(=O)OC(C)CCOC(=O)C(C)=C VDYWHVQKENANGY-UHFFFAOYSA-N 0.000 description 1
- ZDQNWDNMNKSMHI-UHFFFAOYSA-N 1-[2-(2-prop-2-enoyloxypropoxy)propoxy]propan-2-yl prop-2-enoate Chemical compound C=CC(=O)OC(C)COC(C)COCC(C)OC(=O)C=C ZDQNWDNMNKSMHI-UHFFFAOYSA-N 0.000 description 1
- RTBFRGCFXZNCOE-UHFFFAOYSA-N 1-methylsulfonylpiperidin-4-one Chemical compound CS(=O)(=O)N1CCC(=O)CC1 RTBFRGCFXZNCOE-UHFFFAOYSA-N 0.000 description 1
- FRPZMMHWLSIFAZ-UHFFFAOYSA-N 10-undecenoic acid Chemical compound OC(=O)CCCCCCCCC=C FRPZMMHWLSIFAZ-UHFFFAOYSA-N 0.000 description 1
- HYQASEVIBPSPMK-UHFFFAOYSA-N 12-(2-methylprop-2-enoyloxy)dodecyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCCCCCCCCCCCOC(=O)C(C)=C HYQASEVIBPSPMK-UHFFFAOYSA-N 0.000 description 1
- GOXQRTZXKQZDDN-UHFFFAOYSA-N 2-Ethylhexyl acrylate Chemical compound CCCCC(CC)COC(=O)C=C GOXQRTZXKQZDDN-UHFFFAOYSA-N 0.000 description 1
- YIJYFLXQHDOQGW-UHFFFAOYSA-N 2-[2,4,6-trioxo-3,5-bis(2-prop-2-enoyloxyethyl)-1,3,5-triazinan-1-yl]ethyl prop-2-enoate Chemical compound C=CC(=O)OCCN1C(=O)N(CCOC(=O)C=C)C(=O)N(CCOC(=O)C=C)C1=O YIJYFLXQHDOQGW-UHFFFAOYSA-N 0.000 description 1
- HWSSEYVMGDIFMH-UHFFFAOYSA-N 2-[2-[2-(2-methylprop-2-enoyloxy)ethoxy]ethoxy]ethyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCOCCOCCOC(=O)C(C)=C HWSSEYVMGDIFMH-UHFFFAOYSA-N 0.000 description 1
- LTHJXDSHSVNJKG-UHFFFAOYSA-N 2-[2-[2-[2-(2-methylprop-2-enoyloxy)ethoxy]ethoxy]ethoxy]ethyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCOCCOCCOCCOC(=O)C(C)=C LTHJXDSHSVNJKG-UHFFFAOYSA-N 0.000 description 1
- FDSUVTROAWLVJA-UHFFFAOYSA-N 2-[[3-hydroxy-2,2-bis(hydroxymethyl)propoxy]methyl]-2-(hydroxymethyl)propane-1,3-diol;prop-2-enoic acid Chemical compound OC(=O)C=C.OC(=O)C=C.OC(=O)C=C.OC(=O)C=C.OC(=O)C=C.OCC(CO)(CO)COCC(CO)(CO)CO FDSUVTROAWLVJA-UHFFFAOYSA-N 0.000 description 1
- CUGQQXKZSRAAEC-UHFFFAOYSA-N 2-[dimethoxy(methyl)silyl]ethyl prop-2-enoate Chemical compound CO[Si](C)(OC)CCOC(=O)C=C CUGQQXKZSRAAEC-UHFFFAOYSA-N 0.000 description 1
- TURITJIWSQEMDB-UHFFFAOYSA-N 2-methyl-n-[(2-methylprop-2-enoylamino)methyl]prop-2-enamide Chemical compound CC(=C)C(=O)NCNC(=O)C(C)=C TURITJIWSQEMDB-UHFFFAOYSA-N 0.000 description 1
- RUMACXVDVNRZJZ-UHFFFAOYSA-N 2-methylpropyl 2-methylprop-2-enoate Chemical compound CC(C)COC(=O)C(C)=C RUMACXVDVNRZJZ-UHFFFAOYSA-N 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- BUJVPKZRXOTBGA-UHFFFAOYSA-N 2-trimethoxysilylethyl prop-2-enoate Chemical compound CO[Si](OC)(OC)CCOC(=O)C=C BUJVPKZRXOTBGA-UHFFFAOYSA-N 0.000 description 1
- MCDBEBOBROAQSH-UHFFFAOYSA-N 3-[dimethoxy(methyl)silyl]propyl prop-2-enoate Chemical compound CO[Si](C)(OC)CCCOC(=O)C=C MCDBEBOBROAQSH-UHFFFAOYSA-N 0.000 description 1
- MLOKHANBEXWBKS-UHFFFAOYSA-N 3-triacetyloxysilylpropyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCC[Si](OC(C)=O)(OC(C)=O)OC(C)=O MLOKHANBEXWBKS-UHFFFAOYSA-N 0.000 description 1
- KBQVDAIIQCXKPI-UHFFFAOYSA-N 3-trimethoxysilylpropyl prop-2-enoate Chemical compound CO[Si](OC)(OC)CCCOC(=O)C=C KBQVDAIIQCXKPI-UHFFFAOYSA-N 0.000 description 1
- HGEKXQRHZRDGKO-UHFFFAOYSA-N 3-tripropoxysilylpropyl prop-2-enoate Chemical compound CCCO[Si](OCCC)(OCCC)CCCOC(=O)C=C HGEKXQRHZRDGKO-UHFFFAOYSA-N 0.000 description 1
- YBRVSVVVWCFQMG-UHFFFAOYSA-N 4,4'-diaminodiphenylmethane Chemical compound C1=CC(N)=CC=C1CC1=CC=C(N)C=C1 YBRVSVVVWCFQMG-UHFFFAOYSA-N 0.000 description 1
- VPWNQTHUCYMVMZ-UHFFFAOYSA-N 4,4'-sulfonyldiphenol Chemical class C1=CC(O)=CC=C1S(=O)(=O)C1=CC=C(O)C=C1 VPWNQTHUCYMVMZ-UHFFFAOYSA-N 0.000 description 1
- PIFPCDRPHCQLSJ-WYIJOVFWSA-N 4,8,12,15,19-Docosapentaenoic acid Chemical compound CC\C=C\CC\C=C\C\C=C\CC\C=C\CC\C=C\CCC(O)=O PIFPCDRPHCQLSJ-WYIJOVFWSA-N 0.000 description 1
- XOJWAAUYNWGQAU-UHFFFAOYSA-N 4-(2-methylprop-2-enoyloxy)butyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCCCOC(=O)C(C)=C XOJWAAUYNWGQAU-UHFFFAOYSA-N 0.000 description 1
- DZIHTWJGPDVSGE-UHFFFAOYSA-N 4-[(4-aminocyclohexyl)methyl]cyclohexan-1-amine Chemical compound C1CC(N)CCC1CC1CCC(N)CC1 DZIHTWJGPDVSGE-UHFFFAOYSA-N 0.000 description 1
- BDBZTOMUANOKRT-UHFFFAOYSA-N 4-[2-(4-aminocyclohexyl)propan-2-yl]cyclohexan-1-amine Chemical compound C1CC(N)CCC1C(C)(C)C1CCC(N)CC1 BDBZTOMUANOKRT-UHFFFAOYSA-N 0.000 description 1
- ZYEDGEXYGKWJPB-UHFFFAOYSA-N 4-[2-(4-aminophenyl)propan-2-yl]aniline Chemical compound C=1C=C(N)C=CC=1C(C)(C)C1=CC=C(N)C=C1 ZYEDGEXYGKWJPB-UHFFFAOYSA-N 0.000 description 1
- SAPGBCWOQLHKKZ-UHFFFAOYSA-N 6-(2-methylprop-2-enoyloxy)hexyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCCCCCOC(=O)C(C)=C SAPGBCWOQLHKKZ-UHFFFAOYSA-N 0.000 description 1
- FIHBHSQYSYVZQE-UHFFFAOYSA-N 6-prop-2-enoyloxyhexyl prop-2-enoate Chemical compound C=CC(=O)OCCCCCCOC(=O)C=C FIHBHSQYSYVZQE-UHFFFAOYSA-N 0.000 description 1
- 235000021357 Behenic acid Nutrition 0.000 description 1
- 229930185605 Bisphenol Natural products 0.000 description 1
- DPUOLQHDNGRHBS-UHFFFAOYSA-N Brassidinsaeure Natural products CCCCCCCCC=CCCCCCCCCCCCC(O)=O DPUOLQHDNGRHBS-UHFFFAOYSA-N 0.000 description 1
- 125000004648 C2-C8 alkenyl group Chemical group 0.000 description 1
- UUEYEUDSRFNIQJ-UHFFFAOYSA-N CCOC(N)=O.CCOC(N)=O.CC(=C)C(O)=O.CC(=C)C(O)=O Chemical compound CCOC(N)=O.CCOC(N)=O.CC(=C)C(O)=O.CC(=C)C(O)=O UUEYEUDSRFNIQJ-UHFFFAOYSA-N 0.000 description 1
- 239000005632 Capric acid (CAS 334-48-5) Substances 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- DQEFEBPAPFSJLV-UHFFFAOYSA-N Cellulose propionate Chemical compound CCC(=O)OCC1OC(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C1OC1C(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C(COC(=O)CC)O1 DQEFEBPAPFSJLV-UHFFFAOYSA-N 0.000 description 1
- PIFPCDRPHCQLSJ-UHFFFAOYSA-N Clupanodonic acid Natural products CCC=CCCC=CCC=CCCC=CCCC=CCCC(O)=O PIFPCDRPHCQLSJ-UHFFFAOYSA-N 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 229910000881 Cu alloy Inorganic materials 0.000 description 1
- 239000004921 DEGALAN® Substances 0.000 description 1
- 229920002943 EPDM rubber Polymers 0.000 description 1
- 239000004593 Epoxy Substances 0.000 description 1
- UAUDZVJPLUQNMU-UHFFFAOYSA-N Erucasaeureamid Natural products CCCCCCCCC=CCCCCCCCCCCCC(N)=O UAUDZVJPLUQNMU-UHFFFAOYSA-N 0.000 description 1
- URXZXNYJPAJJOQ-UHFFFAOYSA-N Erucic acid Natural products CCCCCCC=CCCCCCCCCCCCC(O)=O URXZXNYJPAJJOQ-UHFFFAOYSA-N 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 229920000181 Ethylene propylene rubber Polymers 0.000 description 1
- YCKRFDGAMUMZLT-UHFFFAOYSA-N Fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 1
- 208000033962 Fontaine progeroid syndrome Diseases 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 238000012696 Interfacial polycondensation Methods 0.000 description 1
- 239000004166 Lanolin Substances 0.000 description 1
- 239000005639 Lauric acid Substances 0.000 description 1
- 235000021353 Lignoceric acid Nutrition 0.000 description 1
- CQXMAMUUWHYSIY-UHFFFAOYSA-N Lignoceric acid Natural products CCCCCCCCCCCCCCCCCCCCCCCC(=O)OCCC1=CC=C(O)C=C1 CQXMAMUUWHYSIY-UHFFFAOYSA-N 0.000 description 1
- 229920003091 Methocel™ Polymers 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 229920001730 Moisture cure polyurethane Polymers 0.000 description 1
- HSHXDCVZWHOWCS-UHFFFAOYSA-N N'-hexadecylthiophene-2-carbohydrazide Chemical compound CCCCCCCCCCCCCCCCNNC(=O)c1cccs1 HSHXDCVZWHOWCS-UHFFFAOYSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- XJXROGWVRIJYMO-SJDLZYGOSA-N Nervonic acid Natural products O=C(O)[C@@H](/C=C/CCCCCCCC)CCCCCCCCCCCC XJXROGWVRIJYMO-SJDLZYGOSA-N 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 229920000299 Nylon 12 Polymers 0.000 description 1
- 229920002292 Nylon 6 Polymers 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 235000021319 Palmitoleic acid Nutrition 0.000 description 1
- 239000004962 Polyamide-imide Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004642 Polyimide Substances 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- HXWJFEZDFPRLBG-UHFFFAOYSA-N Timnodonic acid Natural products CCCC=CC=CCC=CCC=CCC=CCCCC(O)=O HXWJFEZDFPRLBG-UHFFFAOYSA-N 0.000 description 1
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 1
- DAKWPKUUDNSNPN-UHFFFAOYSA-N Trimethylolpropane triacrylate Chemical compound C=CC(=O)OCC(CC)(COC(=O)C=C)COC(=O)C=C DAKWPKUUDNSNPN-UHFFFAOYSA-N 0.000 description 1
- WGLPBDUCMAPZCE-UHFFFAOYSA-N Trioxochromium Chemical compound O=[Cr](=O)=O WGLPBDUCMAPZCE-UHFFFAOYSA-N 0.000 description 1
- 239000012963 UV stabilizer Substances 0.000 description 1
- UWHZIFQPPBDJPM-FPLPWBNLSA-M Vaccenic acid Natural products CCCCCC\C=C/CCCCCCCCCC([O-])=O UWHZIFQPPBDJPM-FPLPWBNLSA-M 0.000 description 1
- 235000021322 Vaccenic acid Nutrition 0.000 description 1
- ULQMPOIOSDXIGC-UHFFFAOYSA-N [2,2-dimethyl-3-(2-methylprop-2-enoyloxy)propyl] 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCC(C)(C)COC(=O)C(C)=C ULQMPOIOSDXIGC-UHFFFAOYSA-N 0.000 description 1
- HVVWZTWDBSEWIH-UHFFFAOYSA-N [2-(hydroxymethyl)-3-prop-2-enoyloxy-2-(prop-2-enoyloxymethyl)propyl] prop-2-enoate Chemical compound C=CC(=O)OCC(CO)(COC(=O)C=C)COC(=O)C=C HVVWZTWDBSEWIH-UHFFFAOYSA-N 0.000 description 1
- FDLQZKYLHJJBHD-UHFFFAOYSA-N [3-(aminomethyl)phenyl]methanamine Chemical compound NCC1=CC=CC(CN)=C1 FDLQZKYLHJJBHD-UHFFFAOYSA-N 0.000 description 1
- NOZAQBYNLKNDRT-UHFFFAOYSA-N [diacetyloxy(ethenyl)silyl] acetate Chemical compound CC(=O)O[Si](OC(C)=O)(OC(C)=O)C=C NOZAQBYNLKNDRT-UHFFFAOYSA-N 0.000 description 1
- GXDZOSLIAABYHM-UHFFFAOYSA-N [diethoxy(methyl)silyl]methyl 2-methylprop-2-enoate Chemical compound CCO[Si](C)(OCC)COC(=O)C(C)=C GXDZOSLIAABYHM-UHFFFAOYSA-N 0.000 description 1
- 230000009102 absorption Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- VEBCLRKUSAGCDF-UHFFFAOYSA-N ac1mi23b Chemical compound C1C2C3C(COC(=O)C=C)CCC3C1C(COC(=O)C=C)C2 VEBCLRKUSAGCDF-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000003302 alkenyloxy group Chemical group 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 1
- 125000004457 alkyl amino carbonyl group Chemical group 0.000 description 1
- 125000005195 alkyl amino carbonyloxy group Chemical group 0.000 description 1
- 125000004471 alkyl aminosulfonyl group Chemical group 0.000 description 1
- 125000004448 alkyl carbonyl group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 125000004414 alkyl thio group Chemical group 0.000 description 1
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 1
- CUXYLFPMQMFGPL-SUTYWZMXSA-N all-trans-octadeca-9,11,13-trienoic acid Chemical compound CCCC\C=C\C=C\C=C\CCCCCCCC(O)=O CUXYLFPMQMFGPL-SUTYWZMXSA-N 0.000 description 1
- DTOSIQBPPRVQHS-PDBXOOCHSA-N alpha-linolenic acid Chemical compound CC\C=C/C\C=C/C\C=C/CCCCCCCC(O)=O DTOSIQBPPRVQHS-PDBXOOCHSA-N 0.000 description 1
- 235000020661 alpha-linolenic acid Nutrition 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 125000004397 aminosulfonyl group Chemical group NS(=O)(=O)* 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N anhydrous glutaric acid Natural products OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 239000012164 animal wax Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- 229940114079 arachidonic acid Drugs 0.000 description 1
- 125000003435 aroyl group Chemical group 0.000 description 1
- 125000000732 arylene group Chemical group 0.000 description 1
- 125000004104 aryloxy group Chemical group 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 229940116226 behenic acid Drugs 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- QUZSUMLPWDHKCJ-UHFFFAOYSA-N bisphenol A dimethacrylate Chemical compound C1=CC(OC(=O)C(=C)C)=CC=C1C(C)(C)C1=CC=C(OC(=O)C(C)=C)C=C1 QUZSUMLPWDHKCJ-UHFFFAOYSA-N 0.000 description 1
- 229910052810 boron oxide Inorganic materials 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- CQEYYJKEWSMYFG-UHFFFAOYSA-N butyl acrylate Chemical compound CCCCOC(=O)C=C CQEYYJKEWSMYFG-UHFFFAOYSA-N 0.000 description 1
- 239000004204 candelilla wax Substances 0.000 description 1
- 235000013868 candelilla wax Nutrition 0.000 description 1
- 229940073532 candelilla wax Drugs 0.000 description 1
- KHAVLLBUVKBTBG-UHFFFAOYSA-N caproleic acid Natural products OC(=O)CCCCCCCC=C KHAVLLBUVKBTBG-UHFFFAOYSA-N 0.000 description 1
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 1
- 125000001951 carbamoylamino group Chemical group C(N)(=O)N* 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000011111 cardboard Substances 0.000 description 1
- 239000004203 carnauba wax Substances 0.000 description 1
- 235000013869 carnauba wax Nutrition 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229920006218 cellulose propionate Polymers 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 229910000420 cerium oxide Inorganic materials 0.000 description 1
- KJDZDTDNIULJBE-QXMHVHEDSA-N cetoleic acid Chemical compound CCCCCCCCCC\C=C/CCCCCCCCCC(O)=O KJDZDTDNIULJBE-QXMHVHEDSA-N 0.000 description 1
- 239000002800 charge carrier Substances 0.000 description 1
- 238000005229 chemical vapour deposition Methods 0.000 description 1
- VNNRSPGTAMTISX-UHFFFAOYSA-N chromium nickel Chemical compound [Cr].[Ni] VNNRSPGTAMTISX-UHFFFAOYSA-N 0.000 description 1
- 229910000423 chromium oxide Inorganic materials 0.000 description 1
- PMMYEEVYMWASQN-IMJSIDKUSA-N cis-4-Hydroxy-L-proline Chemical compound O[C@@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-IMJSIDKUSA-N 0.000 description 1
- SECPZKHBENQXJG-UHFFFAOYSA-N cis-palmitoleic acid Natural products CCCCCCC=CCCCCCCCC(O)=O SECPZKHBENQXJG-UHFFFAOYSA-N 0.000 description 1
- GWHCXVQVJPWHRF-UHFFFAOYSA-N cis-tetracosenoic acid Natural products CCCCCCCCC=CCCCCCCCCCCCCCC(O)=O GWHCXVQVJPWHRF-UHFFFAOYSA-N 0.000 description 1
- 239000000567 combustion gas Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- QYQADNCHXSEGJT-UHFFFAOYSA-N cyclohexane-1,1-dicarboxylate;hydron Chemical class OC(=O)C1(C(O)=O)CCCCC1 QYQADNCHXSEGJT-UHFFFAOYSA-N 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000010283 detonation spraying Methods 0.000 description 1
- 125000004473 dialkylaminocarbonyl group Chemical group 0.000 description 1
- JKWMSGQKBLHBQQ-UHFFFAOYSA-N diboron trioxide Chemical compound O=BOB=O JKWMSGQKBLHBQQ-UHFFFAOYSA-N 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- QUEUTYIFYSKYKR-UHFFFAOYSA-N dimethoxymethyl(ethenyl)silane ethenyl(trimethoxy)silane Chemical compound COC(OC)[SiH2]C=C.CO[Si](OC)(OC)C=C QUEUTYIFYSKYKR-UHFFFAOYSA-N 0.000 description 1
- 150000002009 diols Chemical class 0.000 description 1
- 235000020669 docosahexaenoic acid Nutrition 0.000 description 1
- 229940090949 docosahexaenoic acid Drugs 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 1
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 1
- 229940108623 eicosenoic acid Drugs 0.000 description 1
- BITHHVVYSMSWAG-UHFFFAOYSA-N eicosenoic acid Natural products CCCCCCCCC=CCCCCCCCCCC(O)=O BITHHVVYSMSWAG-UHFFFAOYSA-N 0.000 description 1
- 230000005288 electromagnetic effect Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- UAUDZVJPLUQNMU-KTKRTIGZSA-N erucamide Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCC(N)=O UAUDZVJPLUQNMU-KTKRTIGZSA-N 0.000 description 1
- DPUOLQHDNGRHBS-KTKRTIGZSA-N erucic acid Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCC(O)=O DPUOLQHDNGRHBS-KTKRTIGZSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- HQQADJVZYDDRJT-UHFFFAOYSA-N ethene;prop-1-ene Chemical group C=C.CC=C HQQADJVZYDDRJT-UHFFFAOYSA-N 0.000 description 1
- FWDBOZPQNFPOLF-UHFFFAOYSA-N ethenyl(triethoxy)silane Chemical compound CCO[Si](OCC)(OCC)C=C FWDBOZPQNFPOLF-UHFFFAOYSA-N 0.000 description 1
- NKSJNEHGWDZZQF-UHFFFAOYSA-N ethenyl(trimethoxy)silane Chemical compound CO[Si](OC)(OC)C=C NKSJNEHGWDZZQF-UHFFFAOYSA-N 0.000 description 1
- WOXXJEVNDJOOLV-UHFFFAOYSA-N ethenyl-tris(2-methoxyethoxy)silane Chemical compound COCCO[Si](OCCOC)(OCCOC)C=C WOXXJEVNDJOOLV-UHFFFAOYSA-N 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- FARYTWBWLZAXNK-WAYWQWQTSA-N ethyl (z)-3-(methylamino)but-2-enoate Chemical compound CCOC(=O)\C=C(\C)NC FARYTWBWLZAXNK-WAYWQWQTSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000002360 explosive Substances 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 1
- 239000000156 glass melt Substances 0.000 description 1
- 229920001112 grafted polyolefin Polymers 0.000 description 1
- 239000010439 graphite Substances 0.000 description 1
- 229910002804 graphite Inorganic materials 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- IUJAMGNYPWYUPM-UHFFFAOYSA-N hentriacontane Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC IUJAMGNYPWYUPM-UHFFFAOYSA-N 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- QVTWBMUAJHVAIJ-UHFFFAOYSA-N hexane-1,4-diol Chemical compound CCC(O)CCCO QVTWBMUAJHVAIJ-UHFFFAOYSA-N 0.000 description 1
- XXMIOPMDWAUFGU-UHFFFAOYSA-N hexane-1,6-diol Chemical compound OCCCCCCO XXMIOPMDWAUFGU-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- OAKJQQAXSVQMHS-UHFFFAOYSA-N hydrazine group Chemical group NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 1
- 238000005984 hydrogenation reaction Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 125000004464 hydroxyphenyl group Chemical group 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- YAQXGBBDJYBXKL-UHFFFAOYSA-N iron(2+);1,10-phenanthroline;dicyanide Chemical compound [Fe+2].N#[C-].N#[C-].C1=CN=C2C3=NC=CC=C3C=CC2=C1.C1=CN=C2C3=NC=CC=C3C=CC2=C1 YAQXGBBDJYBXKL-UHFFFAOYSA-N 0.000 description 1
- 229910052743 krypton Inorganic materials 0.000 description 1
- DNNSSWSSYDEUBZ-UHFFFAOYSA-N krypton atom Chemical compound [Kr] DNNSSWSSYDEUBZ-UHFFFAOYSA-N 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 235000019388 lanolin Nutrition 0.000 description 1
- 229960004488 linolenic acid Drugs 0.000 description 1
- KQQKGWQCNNTQJW-UHFFFAOYSA-N linolenic acid Natural products CC=CCCC=CCC=CCCCCCCCC(O)=O KQQKGWQCNNTQJW-UHFFFAOYSA-N 0.000 description 1
- 239000000155 melt Substances 0.000 description 1
- 125000005641 methacryl group Chemical group 0.000 description 1
- DCUFMVPCXCSVNP-UHFFFAOYSA-N methacrylic anhydride Chemical compound CC(=C)C(=O)OC(=O)C(C)=C DCUFMVPCXCSVNP-UHFFFAOYSA-N 0.000 description 1
- 238000010327 methods by industry Methods 0.000 description 1
- ZQMHJBXHRFJKOT-UHFFFAOYSA-N methyl 2-[(1-methoxy-2-methyl-1-oxopropan-2-yl)diazenyl]-2-methylpropanoate Chemical compound COC(=O)C(C)(C)N=NC(C)(C)C(=O)OC ZQMHJBXHRFJKOT-UHFFFAOYSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 235000019426 modified starch Nutrition 0.000 description 1
- 229910000476 molybdenum oxide Inorganic materials 0.000 description 1
- 239000012170 montan wax Substances 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 235000021290 n-3 DPA Nutrition 0.000 description 1
- KYTZHLUVELPASH-UHFFFAOYSA-N naphthalene-1,2-dicarboxylic acid Chemical compound C1=CC=CC2=C(C(O)=O)C(C(=O)O)=CC=C21 KYTZHLUVELPASH-UHFFFAOYSA-N 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 229910052754 neon Inorganic materials 0.000 description 1
- GKAOGPIIYCISHV-UHFFFAOYSA-N neon atom Chemical compound [Ne] GKAOGPIIYCISHV-UHFFFAOYSA-N 0.000 description 1
- SLCVBVWXLSEKPL-UHFFFAOYSA-N neopentyl glycol Chemical compound OCC(C)(C)CO SLCVBVWXLSEKPL-UHFFFAOYSA-N 0.000 description 1
- 229910001120 nichrome Inorganic materials 0.000 description 1
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 125000000962 organic group Chemical group 0.000 description 1
- 235000013873 oxidized polyethylene wax Nutrition 0.000 description 1
- TWNQGVIAIRXVLR-UHFFFAOYSA-N oxo(oxoalumanyloxy)alumane Chemical compound O=[Al]O[Al]=O TWNQGVIAIRXVLR-UHFFFAOYSA-N 0.000 description 1
- BMMGVYCKOGBVEV-UHFFFAOYSA-N oxo(oxoceriooxy)cerium Chemical compound [Ce]=O.O=[Ce]=O BMMGVYCKOGBVEV-UHFFFAOYSA-N 0.000 description 1
- PQQKPALAQIIWST-UHFFFAOYSA-N oxomolybdenum Chemical compound [Mo]=O PQQKPALAQIIWST-UHFFFAOYSA-N 0.000 description 1
- RVTZCBVAJQQJTK-UHFFFAOYSA-N oxygen(2-);zirconium(4+) Chemical compound [O-2].[O-2].[Zr+4] RVTZCBVAJQQJTK-UHFFFAOYSA-N 0.000 description 1
- 239000005022 packaging material Substances 0.000 description 1
- 239000000123 paper Substances 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 235000019809 paraffin wax Nutrition 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 239000012169 petroleum derived wax Substances 0.000 description 1
- 235000019381 petroleum wax Nutrition 0.000 description 1
- JTJMJGYZQZDUJJ-UHFFFAOYSA-N phencyclidine Chemical class C1CCCCN1C1(C=2C=CC=CC=2)CCCCC1 JTJMJGYZQZDUJJ-UHFFFAOYSA-N 0.000 description 1
- FSDNTQSJGHSJBG-UHFFFAOYSA-N piperidine-4-carbonitrile Chemical compound N#CC1CCNCC1 FSDNTQSJGHSJBG-UHFFFAOYSA-N 0.000 description 1
- 238000004157 plasmatron Methods 0.000 description 1
- 239000006223 plastic coating Substances 0.000 description 1
- 239000002985 plastic film Substances 0.000 description 1
- 229920006255 plastic film Polymers 0.000 description 1
- 229920002492 poly(sulfone) Polymers 0.000 description 1
- 229920002312 polyamide-imide Polymers 0.000 description 1
- 229920001601 polyetherimide Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920001721 polyimide Polymers 0.000 description 1
- 229920002959 polymer blend Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- FBCQUCJYYPMKRO-UHFFFAOYSA-N prop-2-enyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCC=C FBCQUCJYYPMKRO-UHFFFAOYSA-N 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 239000004170 rice bran wax Substances 0.000 description 1
- 235000019384 rice bran wax Nutrition 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 229920005573 silicon-containing polymer Polymers 0.000 description 1
- 239000012791 sliding layer Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000004544 sputter deposition Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 229920006132 styrene block copolymer Polymers 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 125000006836 terphenylene group Chemical group 0.000 description 1
- 229920001897 terpolymer Polymers 0.000 description 1
- ISXSCDLOGDJUNJ-UHFFFAOYSA-N tert-butyl prop-2-enoate Chemical compound CC(C)(C)OC(=O)C=C ISXSCDLOGDJUNJ-UHFFFAOYSA-N 0.000 description 1
- 150000000000 tetracarboxylic acids Chemical class 0.000 description 1
- TUNFSRHWOTWDNC-HKGQFRNVSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCC[14C](O)=O TUNFSRHWOTWDNC-HKGQFRNVSA-N 0.000 description 1
- BFKJFAAPBSQJPD-UHFFFAOYSA-N tetrafluoroethene Chemical group FC(F)=C(F)F BFKJFAAPBSQJPD-UHFFFAOYSA-N 0.000 description 1
- 238000002411 thermogravimetry Methods 0.000 description 1
- 229920006345 thermoplastic polyamide Polymers 0.000 description 1
- 229920006342 thermoplastic vulcanizate Polymers 0.000 description 1
- 238000005011 time of flight secondary ion mass spectroscopy Methods 0.000 description 1
- XOLBLPGZBRYERU-UHFFFAOYSA-N tin dioxide Chemical compound O=[Sn]=O XOLBLPGZBRYERU-UHFFFAOYSA-N 0.000 description 1
- 229910001887 tin oxide Inorganic materials 0.000 description 1
- OGIDPMRJRNCKJF-UHFFFAOYSA-N titanium oxide Inorganic materials [Ti]=O OGIDPMRJRNCKJF-UHFFFAOYSA-N 0.000 description 1
- UWHZIFQPPBDJPM-BQYQJAHWSA-N trans-vaccenic acid Chemical compound CCCCCC\C=C\CCCCCCCCCC(O)=O UWHZIFQPPBDJPM-BQYQJAHWSA-N 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 150000003628 tricarboxylic acids Chemical class 0.000 description 1
- GQIUQDDJKHLHTB-UHFFFAOYSA-N trichloro(ethenyl)silane Chemical compound Cl[Si](Cl)(Cl)C=C GQIUQDDJKHLHTB-UHFFFAOYSA-N 0.000 description 1
- UZIAQVMNAXPCJQ-UHFFFAOYSA-N triethoxysilylmethyl 2-methylprop-2-enoate Chemical compound CCO[Si](OCC)(OCC)COC(=O)C(C)=C UZIAQVMNAXPCJQ-UHFFFAOYSA-N 0.000 description 1
- UKISEGKOQFKCQA-UHFFFAOYSA-N trifluoro(nitrosulfonylperoxy)methane Chemical compound FC(OOS(=O)(=O)[N+](=O)[O-])(F)F UKISEGKOQFKCQA-UHFFFAOYSA-N 0.000 description 1
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 1
- UOKUUKOEIMCYAI-UHFFFAOYSA-N trimethoxysilylmethyl 2-methylprop-2-enoate Chemical compound CO[Si](OC)(OC)COC(=O)C(C)=C UOKUUKOEIMCYAI-UHFFFAOYSA-N 0.000 description 1
- UONOETXJSWQNOL-UHFFFAOYSA-N tungsten carbide Chemical compound [W+]#[C-] UONOETXJSWQNOL-UHFFFAOYSA-N 0.000 description 1
- 229960002703 undecylenic acid Drugs 0.000 description 1
- 238000009827 uniform distribution Methods 0.000 description 1
- 239000012178 vegetable wax Substances 0.000 description 1
- 239000005050 vinyl trichlorosilane Substances 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 229940100445 wheat starch Drugs 0.000 description 1
- 229910001928 zirconium oxide Inorganic materials 0.000 description 1
- 239000004711 α-olefin Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
- C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
- C23C4/00—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
- C23C4/04—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
- C23C4/06—Metallic material
-
- C—CHEMISTRY; METALLURGY
- C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
- C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
- C23C24/00—Coating starting from inorganic powder
- C23C24/02—Coating starting from inorganic powder by application of pressure only
- C23C24/04—Impact or kinetic deposition of particles
-
- C—CHEMISTRY; METALLURGY
- C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
- C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
- C23C4/00—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
- C23C4/04—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
-
- C—CHEMISTRY; METALLURGY
- C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
- C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
- C23C4/00—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
- C23C4/12—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the method of spraying
-
- C23C4/124—
-
- C23C4/127—
Definitions
- the present invention relates to the use of specially equipped powdered coating materials. Furthermore, the present invention comprises methods for substrate coating using specially equipped powdered coating materials. Furthermore, the present invention comprises powdered coating materials which are suitable for the above-named uses and/or methods.
- a large number of coating methods for different substrates are already known. For example, metals or precursors thereof are deposited on a substrate surface from the gas phase, see e.g. PVD or CVD methods. Furthermore, corresponding substances can be deposited for example from a solution by means of galvanic methods. In addition, it is possible to apply coatings for example in the form of varnishes to the surface.
- all the methods have specific advantages and disadvantages. For example, in the case of deposition in the form of varnishes, large amounts of water and/or organic solvents are required, a drying time is needed, the coating material to be applied must be compatible with the base varnish, and a residue of the base varnish likewise remains on the substrate. For example, application by means of PVD methods requires large amounts of energy in order to bring non-volatile substances into the gas phase.
- a large number of coating methods have been developed to provide the properties desired for the respective intended use.
- Known methods use, for example, kinetic energy, thermal energy or mixtures thereof to produce the coatings, wherein the thermal energy can originate for example from a conventional combustion flame or a plasma flame.
- the latter are further divided into thermal and non-thermal plasmas, by which is meant that a gas has been partially or completely separated into free charge carriers such as ions or electrons.
- the coating is formed by applying a powder to a substrate surface, wherein the powder particles are greatly accelerated.
- a heated process gas is accelerated to ultrasonic speed by expansion in a de Laval nozzle and then the powder is injected.
- the particles form a dense layer when they strike the substrate surface.
- WO 2010/003396 A1 discloses the use of cold gas spraying as a coating method for applying wear-protection coatings. Furthermore, disclosures of the cold gas spraying method are found for example in EP 1 363 811 A1, EP 0 911 425 B1 and U.S. Pat. No. 7,740,905 B2.
- Flame spraying belongs to the group of thermal coating methods.
- a powdered coating material is introduced into the flame of a fuel gas/oxygen mixture.
- temperatures of up to approximately 3200° C. can be reached for example with oxyacetylene flames. Details of the method can be learned from publications such as e.g. EP 830 464 B1 and U.S. Pat. No. 5,207,382 A.
- thermal plasma spraying a powdered coating material is injected into a thermal plasma.
- temperatures of up to approx. 20,000 K are reached, whereby the injected powder is melted and deposited on a substrate as coating.
- thermal plasma spraying and specific embodiments, as well as method parameters are known to a person skilled in the art.
- reference is made to WO 2004/016821 which describes the use of thermal plasma spraying to apply an amorphous coating.
- EP 0 344 781 for example discloses the use of flame spraying and thermal plasma spraying as coating methods using a tungsten carbide powder mixture.
- Specific devices for use in plasma spraying methods are described multiple times in the literature, such as for example in EP 0 342 428 A2, U.S. Pat. No. 7,678,428 B2, U.S. Pat. No. 7,928,338 B2 and EP 1 287 898 A2.
- a fuel is combusted under high pressure, wherein fuel gases, liquid fuels and mixtures thereof can all be used as fuel.
- a powdered coating material is injected into the highly accelerated flame. This method is known for being characterized by relatively dense spray coatings.
- High-speed flame spraying is also well known to a person skilled in the art and has already been described in numerous publications.
- EP 0 825 272 A2 discloses a substrate coating with a copper alloy using high-speed flame spraying.
- WO 2010/037548 A1 and EP 0 492 384 A1 for example disclose the method of high-speed flame spraying and devices to be used therein.
- Non-thermal plasma spraying is carried out largely analogously to thermal plasma spraying and flame spraying.
- a powdered coating material is injected into a non-thermal plasma and deposited with it onto a substrate surface.
- this method is characterized by a particularly low thermal load of the coated substrate.
- EP 2 104 750 A2 describes the use of this method and a device for carrying it out.
- DE 103 20 379 A1 describes the production of an electrically heatable element using this method.
- powdered coating materials form agglomerates which form a non-uniform coating when applied to the substrate surface.
- An object of the present invention is to improve existing methods for substrate coating and to make possible novel methods for substrate coating.
- problems caused by agglomerates of the powdered coating material are to be minimized or eliminated by the present invention.
- the methods according to the invention are to make new coatings available and/or make it possible to produce known coatings of particularly high quality.
- a further object of the present invention is to provide a powdered coating material which is particularly suitable for one of the above-named uses in coating methods.
- the present invention relates to the use of a particle-containing powdered coating material, the surface of which is equipped with at least one coating additive which has a boiling point or decomposition temperature of below 500° C., in a coating method selected from the group consisting of cold gas spraying, flame spraying, high-speed flame spraying, thermal plasma spraying and non-thermal plasma spraying.
- the weight proportion of the at least one coating additive is at least 0.01 wt.-%, relative to the total weight of the coating material and the coating additive.
- the weight proportion of the at least one coating additive is at most 80 wt.-%, relative to the total weight of the coating material and the coating additive.
- the particles of the powdered coating material comprise or are metal particles, wherein the metal is selected from the group consisting of silver, gold, platinum, palladium, vanadium, chromium, manganese, cobalt, germanium, antimony, aluminum, zinc, tin, iron, copper, nickel, titanium, silicon, alloys and mixtures thereof.
- the carbon content of the powdered coating material is from 0.01 wt.-% to 15 wt.-%, in each case relative to the total weight of the coating material and the coating additive.
- the compounds used as coating additive have at least 6 carbon atoms.
- the coating method is selected from the group consisting of flame spraying and non-thermal plasma spraying.
- the coating method is preferably non-thermal plasma spraying.
- the at least one coating additive is selected from the group consisting of polymers, monomers, silanes, waxes, oxidized waxes, carboxylic acids, phosphonic acids, derivatives of the above-named and mixtures thereof.
- the at least one coating additive comprises no stearic acid and/or oleic acid and preferably no saturated or unsaturated C18 carboxylic acids, more preferably no saturated or unsaturated C14 to C18 carboxylic acids, still more preferably no saturated or unsaturated C12 to C18 carboxylic acids and most preferably no saturated or unsaturated C10 to C20 carboxylic acids.
- the coating additive was applied to the particles mechanically.
- the powdered coating material has a particle-size distribution with a D 50 value from a range of from 1.5 to 53 ⁇ m.
- the present invention relates to methods for coating a substrate selected from the group consisting of cold gas spraying, flame spraying, high-speed flame spraying, thermal plasma spraying and non-thermal plasma spraying, in which a particle-containing powdered coating material is used, wherein the particles are equipped with at least one coating additive which has a boiling point or decomposition temperature of below 500° C.
- the method is selected from the group consisting of flame spraying and non-thermal plasma spraying.
- the coating method is preferably non-thermal plasma spraying.
- the powdered coating material is conveyed as an aerosol.
- the medium directed onto the substrate is air or has been produced from air.
- the term “powdered coating material” within the meaning of the present invention relates to a particle mixture which is applied to the substrate as coating.
- the equipping of the surface of the particles of the powdered coating material according to the invention need not be unbroken here.
- the inventors are of the view that even a small application to or a small coverage of the surface of the particles of the powdered coating material is sufficient to break up agglomerates under the conditions of the coating method.
- the inventors are of the view that, because of the large gas volume of the coating additive applied according to the invention to the particles or of its decomposition products, even small quantities of the coating additive are sufficient to break up any agglomerates present.
- the at least one coating additive according to the invention is here applied to the surface of the particles of the powdered coating material.
- This provides the advantage that variations in the properties of the powdered coating material according to the invention as a result of an incomplete mixing of the constituents of the coating additive before application to the particles are prevented.
- the substances used according to the invention as coating additive can, for example, be physically and/or chemically bound to the surface of the particles.
- the coating additive can completely or partially envelop the particles of the powdered coating material for example in the form of coatings.
- any agglomerates that have formed can be broken up in the course of the coating method and particularly high-quality coatings are obtained.
- the use of the powdered coating material according to the invention allows a more uniform coating, with the result that for example the production of particularly thin coatings is made possible.
- Methods according to the invention which can be used to build up coatings are cold gas spraying, thermal plasma spraying, non-thermal plasma spraying, flame spraying and high-speed flame spraying.
- evaporation or decomposition of the coating additive is necessary, however, the variants of cold gas spraying according to the invention are limited to embodiments in which a heated gas stream is used, with the result that sufficient thermal energy for the evaporation or decomposition of the coating additive is available.
- the temperature of the gas stream is at least 250° C., preferably at least 350° C., more preferably at least 450° C. and still more preferably at least 500° C.
- the method is selected from the group consisting of thermal plasma spraying, non-thermal plasma spraying and flame spraying.
- the additional outlay associated with the application of the coating additive according to the invention to the surface of the particles of the powdered coating material is uneconomical in particular cases, for example if no particularly uniform coating is to be achieved.
- the method is therefore selected from the group consisting of cold gas spraying, non-thermal plasma spraying, flame spraying and high-speed flame spraying, preferably from the group consisting of non-thermal plasma spraying and flame spraying.
- the coating method is therefore selected from the group consisting of thermal plasma spraying and non-thermal plasma spraying.
- the method is non-thermal plasma spraying.
- the coating additive applied according to the invention to the surface of the particles of the powdered coating material is characterized by the above-named upper limit of the boiling point or decomposition temperature. If the substance in question has both a boiling point and a decomposition temperature, only the lower temperature is considered. It is not strictly necessary here that a gas is released when the coating additive decomposes. Without being understood as limiting the invention, any agglomerates present also appear to disintegrate during decomposition without releasing a gas. The inventors are of the view that, due to the decomposition of the coating additive, its surface properties change and this change in turn leads to a disintegration of the agglomerates.
- the coating additive used releases a gas which forces open any agglomerates present.
- the boiling point or decomposition temperature can be determined by means of methods known to a person skilled in the art.
- the decomposition temperature of polymers can be determined by means of thermogravimetry according to DIN EN ISO 11358.
- the decomposition temperature or boiling point of the coating additive to be applied according to the invention to the surface of the particles lies below 500° C., preferably below 470° C., more preferably below 440° C. and still more preferably below 420° C.
- the decomposition temperature or boiling point of the substances applied to the surface of the particles lies below 400° C., preferably below 380° C., more preferably below 360° C. and still more preferably below 340° C.
- the coating additives applied to the surface of the particles according to the invention need not be bound to the surface of the particles. However, in particular embodiments, it is preferred that the coating additives according to the invention are chemically and/or physically bound to the surface of the particles. For example, in cases where the powder must be able to be subjected even to larger mechanical loads, it can be preferred that the coating additives are bound particularly securely to the surface of the particles. In particular embodiments, therefore, it is preferred that the coating additives are bound to the surface with at least one type of chemical bond. Examples of chemical bonds are covalent and ionic bonds. In further cases, where the coating additive must be able to be released again particularly easily, it can be preferred in contrast that the coating additives are bound to the surface of the particles only by means of physical bonds.
- the binding of the coating additives to the surface of the particles takes place only by means of physical bonds.
- the coating additive forms a stable shell around the particles according to the invention, with the result that for example no physical or chemical bonds are necessary to hold the particles inside this shell.
- the inventors are of the view that such a coating additive in the form of a stable shell without strong bonds to the particles can be released particularly easily, as the shell can already be released easily after a partial evaporation or decomposition.
- the coating additive forms a stable shell around the particles, wherein this shell does not have an opening that would be large enough for the particles to find their way out of the shell through it.
- stable shell within the meaning of the present invention describes that the coating additive forms a shell around the particles of the powdered coating material which is not destroyed under the conditions of storage and conveying.
- the coating additives according to the invention can be applied to the particles by means of a wide variety of methods.
- coatings of the particles can be obtained by polymerization of a monomer and/or from sol-gel processes.
- stable shells consisting of the coating additive can be obtained here.
- the coating additives according to the invention can be applied to the surface of the particles for example by deposition from a supersaturated solution or by mechanical forces. Such methods are particularly suitable for applying coating additives to large quantities of powdered coating material in a simple and cost-effective manner.
- the inventors are of the view that the use of coating additives with a high carbon content following the release of CO 2 makes possible a particularly good breakup of the agglomerates.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is at least 0.01 wt.-%, preferably at least 0.05 wt.-%, more preferably at least 0.1 wt.-% and still more preferably at least 0.17 wt.-%.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is at least 0.22 wt.-%, preferably at least 0.28 wt.-%, more preferably at least 0.34 wt.-% and still more preferably at least 0.4 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material according to the invention and the coating additive.
- the weight proportion of the carbon atoms to the total weight of the powdered coating material according to the invention is determined for example with a CS 200 device from Leco Instruments GmbH.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is at most 15 wt.-%, preferably at most 10 wt.-%, more preferably at most 7 wt.-% and still more preferably at most 5 wt.-%.
- the carbon content is at most 4 wt.-%, preferably at most 3 wt.-%, more preferably at most 2 wt.-% and still more preferably at most 1 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material according to the invention and the coating additive.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is from a range of between 0.01 wt.-% and 15 wt.-%, preferably from a range of between 0.05 wt.-% and 10 wt.-%, more preferably from a range of between 0.1 wt.-% and 7 wt.-% and still more preferably from a range of between 0.17 wt.-% and 5 wt.-%.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is from a range of between 0.22 wt.-% and 4 wt.-%, preferably from a range of between 0.28 wt.-% and 3 wt.-%, more preferably from a range of between 0.34 wt.-% and 2 wt.-% and still more preferably from a range of between 0.4 wt.-% and 1 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material according to the invention and the coating additive.
- the compounds used as coating additive contain at least 6 carbon atoms, preferably at least 7 carbon atoms, more preferably at least 8 carbon atoms and still more preferably at least 9 carbon atoms.
- the compounds used as coating additive contain at least 10 carbon atoms, preferably at least 11 carbon atoms, more preferably at least 12 carbon atoms and still more preferably at least 13 carbon atoms.
- the number of carbon atoms contained in the coating additive according to the invention can be determined for example by determining the respective coating additive. All methods known to a person skilled in the art for determining a substance can be used here.
- a coating additive can be removed from the particles of the powdered coating material using organic and/or aqueous solvents and then identified by means of HPLC, GCMS, NMR, CHN or combinations of the above-named with each other or with other routinely used methods.
- the quantity of coating additive is at most 80 wt.-%, preferably at most 70 wt.-%, more preferably at most 65 wt.-% and still more preferably at most 62 wt.-%.
- the quantity of coating additive is at most 59 wt.-%, preferably at most 57 wt.-%, more preferably at most 55 wt.-% and still more preferably at most 53 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material including the coating additive.
- the quantity of coating additive is at least 0.02 wt.-%, preferably at least 0.08 wt.-%, more preferably at least 0.17 wt.-% and still more preferably at least 0.30 wt.-%.
- the quantity of coating additive is at least 0.35 wt.-%, preferably at least 0.42 wt.-%, more preferably at least 0.54 wt.-% and still more preferably at least 0.62 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material including the coating additive.
- the weight proportion of the coating additive is from a range of between 0.02 wt.-% and 80 wt.-%, preferably from a range of between 0.08 wt.-% and 70 wt.-%, more preferably from a range of between 0.17 wt.-% and 65 wt.-% and still more preferably from a range of between 0.30 wt.-% and 62 wt.-%.
- the weight proportion of the carbon atoms in the powdered coating material according to the invention is from a range of between 0.35 wt.-% and 59 wt.-%, preferably from a range of between 0.42 wt.-% and 57 wt.-%, more preferably from a range of between 0.54 wt.-% and 55 wt.-% and still more preferably from a range of between 0.62 wt.-% and 53 wt.-%.
- the above-named wt.-% are based on the total weight of the coating material according to the invention including the coating additive.
- polymers e.g. polysaccharides, plastics
- monomers silanes, waxes, oxidized waxes, carboxylic acids (e.g. fatty acids), phosphonic acids, derivatives of the above-named (in particular carboxylic acid derivatives and phosphoric acid derivatives) and mixtures thereof.
- polysaccharides, plastics, silanes, waxes, oxidized waxes, carboxylic acids (e.g. fatty acids) carboxylic acid derivatives, phosphonic acids, phosphoric acid derivatives or mixtures thereof preferably polysaccharides, silanes, waxes, oxidized waxes, carboxylic acids (e.g.
- fatty acids carboxylic acid derivatives, phosphonic acids, phosphoric acid derivatives or mixtures thereof, more preferably polysaccharides, silanes, waxes, oxidized waxes, carboxylic acids (e.g. fatty acids), carboxylic acid derivatives, phosphonic acids, phosphoric acid derivatives or mixtures thereof, and still more preferably polysaccharides, silanes, waxes, oxidized waxes, phosphonic acids, phosphoric acid derivatives or mixtures thereof, are used as coating additive.
- the above-named waxes comprise both natural waxes and synthetic waxes.
- waxes are paraffin waxes, petroleum waxes, montan waxes, animal waxes (e.g. beeswax, shellac, wool wax), vegetable waxes (e.g. carnauba wax, candelilla wax, rice bran wax), fatty acid amide waxes (such as e.g. erucamide), polyolefin waxes (such as e.g. polyethylene waxes, polypropylene waxes), grafted polyolefin waxes, Fischer-Tropsch waxes, and oxidized polyethylene waxes and modified polyethylene and polypropylene waxes (e.g.
- waxes according to the invention are bound only via physical bonds in particular preferred embodiments. However, it is not ruled out that in further particular embodiments the waxes have functional groups which alternatively or additionally make a chemical bond, in particular an ionic and/or covalent bond, possible.
- polymer within the meaning of the present invention also comprises oligomers.
- the polymers used according to the invention are, however, preferably built up of at least 25 monomer units, more preferably of at least 35 monomer units, still more preferably of at least 45 monomer units and most preferably of at least 50 monomer units.
- the polymers can be bound here to the particles of the powdered coating material without covalent or ionic bonds being formed.
- the coating additive according to the invention can form at least one ionic or covalent bond with the particles of the powdered coating material.
- such a binding preferably takes place via a phosphoric acid, carboxylic acid, silane or sulfonic acid group contained in the polymer.
- polysaccharide within the meaning of the present invention also comprises oligosaccharides.
- the polysaccharides used according to the invention are, however, preferably built up of at least 4 monomer units, more preferably of at least 8 monomer units, still more preferably of at least 10 monomer units and most preferably of at least 12 monomer units.
- particularly preferred polysaccharides are cellulose, cellulose derivatives such as e.g. methyl cellulose, ethyl cellulose, carboxymethyl cellulose, hydroxyethyl cellulose, hydroxypropyl methylcellulose, nitrocellulose (e.g.
- cellulose esters e.g. cellulose acetate, cellulose acetobutyrate, and cellulose propionate
- starches such as e.g. corn starch, potato starch and wheat starch and modified starches.
- the plastic used according to the invention is therefore a thermoplastic.
- Corresponding plastics which are characterized by a corresponding decomposition temperature or boiling point are known to a person skilled in the art and are found for example in the Kunststoff-Taschenbuch, ed. Saechtling, 25th edition, Hanser-Verlag, Kunststoff, 1992, as well as references cited therein, and in the Kunststoff-Handbuch, ed. G. Becker and D. Braun, volumes 1 to 11, Hanser-Verlag, Kunststoff, 1966 to 1996.
- plastics are to be named by way of example for illustration: polycarbonates (PC), polyoxyalkylenes, polyolefins such as polyethylene or polypropylene (PP), polyarylene ethers such as polyphenylene ether (PPE), polysulfones, polyurethanes, polylactides, polyamides, vinylaromatic (co)polymers such as polystyrene, impact-modified polystyrene (such as HIPS) or ASA, ABS or AES polymers, halogen-containing polymers, polyesters such as polybutylene terephthalate (PBT) or polyethylene terephthalate (PET), polymers containing imide groups, cellulose esters, poly(meth)acrylates, silicone polymers and thermoplastic elastomers.
- PC polycarbonates
- PP polyoxyalkylenes
- polyolefins such as polyethylene or polypropylene (PP)
- PPE polyarylene ethers
- polysulfones
- the coating method is not non-thermal plasma spraying if the additive is a plastic, in particular if the additive is a thermosetting plastic or elastomer. In particular ones of the above-named embodiments, it is preferred in particular that the coating method is not non-thermal plasma spraying if the additive is a thermosetting plastic.
- the poly(meth)acrylates used according to the invention can be present as homopolymers or as block polymers.
- Examples are polymethyl methacrylate (PMMA) and copolymers based on methyl methacrylate with up to 40 wt.-% further copolymerizable monomers, such as e.g. n-butyl acrylate, t-butyl acrylate or 2-ethylhexyl acrylate.
- particularly preferred plastic layers are synthetic resin layers of organofunctional silane and acrylate and/or methacrylate compound(s).
- Such coatings according to the invention of the particles of the powdered coating material additionally display a particular stability against mechanical shearing forces, in addition to the above-named advantages. Furthermore, such coatings protect, for example, metal pigments against chemicals, strongly aggressive and/or corrosive media.
- the above-named synthetic resin layer can be relatively thin.
- it can have an average layer thickness in a range of from 10 nm to 300 nm, preferably from 15 nm to 220 nm.
- the average layer thickness lies in a range of from 25 to 170 nm, more preferably in a range of from 35 to 145 nm.
- the average layer thickness is determined by measuring the layer thicknesses of at least 30 randomly selected particles by means of SEM.
- the organofunctional silane here is in the polyacrylate and/or polymethacrylate before and/or is incorporated by polymerization.
- the plastic layer in particular the synthetic resin layer, has no inorganic network.
- a pure and homogeneous plastic coating, and in particular a pure and homogeneous synthetic resin coating, has proved to be sufficient to provide the corrosion stability and chemicals stability necessary under the conditions to be expected of storage, preparation, etc. which precede a use in the one coating method. At the same time, the necessity to remove the inorganic network under the conditions of the coating method is avoided.
- the above-named organofunctional silane contained in a synthetic resin layer has at least one functional group which can be reacted chemically with an acrylate group and/or methacrylate group of polyacrylate and/or polymethacrylate. Radically polymerizable organic functional groups have proved to be very suitable.
- the at least one functional group is selected from the group which consists of acryl, methacryl, vinyl, allyl, ethinyl as well as further organic groups with unsaturated functions.
- the organofunctional silane has at least one acrylate and/or methacrylate group, because these can be reacted with the acrylate or methacrylate compounds used to produce the polyacrylate and/or polymethacrylate completely problem-free, accompanied by the formation of a homogeneous plastic layer.
- the organofunctional silane can be present as a monomer or also as a polymer. It is important that the, monomeric or polymeric, organofunctional silane has at least one functional group which allows a chemical reaction with an acrylate and/or methacrylate group. Mixtures of different monomeric and/or polymeric organofunctional silanes can also be contained in the synthetic resin layer.
- organofunctional silane For the production of particularly high-quality synthetic resin layers it has been shown that there must be a homogeneous mixing of the organofunctional silane with the polyacrylate and/or polymethacrylate. In contrast, it is not necessary here that the organofunctional silane is completely reacted chemically with the polyacrylate and/or polymethacrylate.
- the chemical reaction between organofunctional silane and polyacrylate and/or polymethacrylate can therefore be carried out only partially, with the result that for example only 30% or 40% of the organofunctional silane present, relative to the total weight of organofunctional silane, is reacted with polyacrylate and/or polymethacrylate.
- At least 60%, further preferably at least 70%, still further preferably at least 80% of the organofunctional silane present, in each case relative to the total weight of the organofunctional silane, is reacted with polyacrylate and/or polymethacrylate.
- at least 90% or at least 95% of the organofunctional silane is preferably present in a form reacted with polyacrylate and/or polymethacrylate.
- the polyacrylate and/or polymethacrylate is built up with or of compounds with several acrylate and/or methacrylate groups.
- the acrylate and/or methacrylate starting compounds used have two or more acrylate and/or methacrylate groups.
- the above-named synthetic resin coatings according to the invention can contain further monomers and/or polymers in addition to the above-named acrylate and/or methacrylate compounds.
- the proportion of acrylate and/or methacrylate compounds including organofunctional silane is preferably at least 70 wt.-%, further preferably at least 80 wt.-%, still further preferably at least 90 wt.-%, in each case relative to the total weight of the synthetic resin coating.
- the synthetic resin coating is built up exclusively of acrylate and/or methacrylate compounds and one or more organofunctional silanes, wherein additives such as corrosion inhibitors, colored pigments, dyes, UV stabilizers, etc. or mixtures thereof can also additionally be contained in the synthetic resin coating.
- the synthetic resin layers according to the invention with several acrylate groups and/or methacrylate groups have in each case at least three acrylate and/or methacrylate groups.
- these starting compounds can preferably also have in each case four or five acrylate and/or methacrylate groups.
- polyfunctional acrylates and/or methacrylates are used for the production of the synthetic resin layer according to the invention.
- the synthetic resin layers according to the invention in which 2 to 4 acrylate and/or methacrylate groups are contained per acrylate and/or methacrylate starting compound surprisingly have an exceptional density and strength, without being brittle.
- 3 acrylate and/or methacrylate groups per acrylate and/or methacrylate starting compound have proved to be extremely suitable.
- Such optimized properties have proved to be particularly advantageous in order to provide a synthetic resin coating which is also suitable for conveying methods in which the particles is led through pipes for example in the form of an aerosol and in which multiple impacts of the individual particles on the pipe walls occur.
- the weight ratio of polyacrylate and/or polymethacrylate to organofunctional silane is 10:1 to 0.5:1.
- the weight ratio of polyacrylate and/or polymethacrylate to organofunctional silane preferably lies in a range of from 7:1 to 1:1.
- difunctional acrylates are: allyl methacrylate, bisphenol A dimethacrylate, 1,3-butanediol dimethacrylate, 1,4-butanediol dimethacrylate, ethylene glycol dimethacrylate, 1,6-hexanediol diacrylate, 1,6-hexanediol dimethacrylate, diethylene glycol dimethacrylate, diurethane dimethacrylate, dipropylene glycol diacrylate, 1,12-dodecanediol dimethacrylate, ethylene glycol dimethacrylate, methacrylic acid anhydride, N,N-methylene-bis-methacrylamide neopentyl glycol dimethacrylate, polyethylene glycol dimethacrylate, polyethylene glycol-200-diacrylate, polyethylene glycol-400-diacrylate, polyethylene glycol-400-dimethacrylate, tetraethylene glycol diacrylate, te
- pentaerythritol triacrylate e.g. pentaerythritol triacrylate, trimethylolpropane triacrylate, trimethylolpropane trimethacrylate, tris-(2-hydroxyethyl)isocyanurate triacrylate, pentaerythritol tetraacrylate, dipentaerythritol pentaacrylate or of mixtures thereof can be used as higher functional acrylates.
- Trifunctional acrylates and/or methacrylates are particularly preferred.
- Acrylate- and/or methacrylate-functional silanes are particularly preferred.
- 2-methacryloxyethyltrimethoxysilane, 2-methacryloxyethyltriethoxysilane, 3-methacryloxypropyltriethoxysilane, 3-methacryloxypropyltrimethoxysilane, (methacryloxymethyl)methyldimethoxysilane, vinyltrimethoxysilane or mixtures thereof in particular have proved to be particularly suitable organofunctional silanes.
- polycarbonates examples of polycarbonates and the production thereof can be found in DE 1 300 266 B1 (interfacial polycondensation) or DE 14 95 730 A1 (reaction of biphenyl carbonate with bisphenols).
- the polymer main chain has at least 50 mol.-% recurring units of —CH 2 O—.
- a particular example of this plastic group is constituted by (co)polyoxymethylenes (POM).
- POM polyoxymethylenes
- the homopolymers can be produced, preferably catalytically, for example by polymerization of formaldehyde or trioxane.
- polyolefins examples are polyethylene and polypropylene as well as copolymers based on ethylene or propylene, optionally also with higher ⁇ -olefins.
- polyolefin within the meaning of the present invention also comprises in particular ethylene-propylene elastomers and ethylene-propylene terpolymers.
- polyarylene ethers examples are polyarylene ethers per se, polyarylene ether sulfides, polyarylene ether sulfones and polyarylene ether ketones.
- the arylene groups here can be the same or different, and independently of each other can be for example an aromatic radical with 6 to 18 C atoms.
- Arylene radicals named by way of example are phenylene, bisphenylene, terphenylene, 1,5-naphthylene, 1,6-naphthylene, 1,5-anthrylene, 9,10-anthrylene or 2,6-anthrylene. Specific information in respect of the production of polyarylene ether sulfones is found for example in EP 113 112 A1 and EP 135 130 A2.
- copolymers or block copolymers based on lactic acid and further monomers as polylactides.
- Dicarboxylic acids which can be reacted with the above-named diamines are for example alkanedicarboxylic acids with 6 to 12, in particular 6 to 10 carbon atoms and aromatic dicarboxylic acids.
- Suitable diamines are for example alkanediamines with 6 to 12, in particular 6 to 8 carbon atoms, as well as m-xylylenediamine, di-(4-aminophenyl)methane, di-(4-aminocyclohexyl)methane, 2,2-di-(4-aminophenyl)propane or 2,2-di-(4-aminocyclohexyl)propane.
- halogen-containing polymers are polymers of vinyl chloride, in particular polyvinyl chloride (PVC) such as hard PVC and soft PVC, and copolymers of vinyl chloride such as PVC-U molding compounds.
- PVC polyvinyl chloride
- PVC-U molding compounds copolymers of vinyl chloride
- Polyester plastics which can be selected according to the invention are likewise known per se and described in the literature.
- the polyesters can be produced by reacting aromatic dicarboxylic acids, esters thereof or other ester-forming derivatives of same with aliphatic dihydroxy compounds in a manner known per se.
- naphthalene dicarboxylic acid, terephthalic acid and isophthalic acid or mixtures thereof are used as dicarboxylic acids.
- aromatic dicarboxylic acids can be replaced by aliphatic or cycloaliphatic dicarboxylic acids such as adipic acid, azelaic acid, sebacic acid, dodecane diacids and cyclohexane dicarboxylic acids.
- aliphatic dihydroxy compounds are diols with 2 to 6 carbon atoms, in particular 1,2-ethanediol, 1,4-butanediol, 1,6-hexanediol, 1,4-hexanediol, 1,4-cyclohexanediol and neopentyl glycol or mixtures thereof.
- polymers containing imide groups examples include polyimides, polyetherimides, and polyamide-imides. Such polymers are described for example in Römpp Chemie Lexikon, CD-ROM version 1.0, Thieme Verlag Stuttgart 1995.
- fluorine-containing polymers such as polytetrafluoroethylene (PTFE), tetrafluoroethylene-perfluoropropylene copolymers (FEP), copolymers of tetrafluoroethylene with perfluoroalkyl vinyl ether, ethylene-tetrafluoroethylene copolymers (ETFE), polyvinylidene fluoride (PVDF), polyvinyl fluoride (PVF), polychlorotrifluoroethylene (PCTFE) and ethylene-chlorotrifluoroethylene copolymers (ECTFE) can be used.
- PTFE polytetrafluoroethylene
- FEP tetrafluoroethylene-perfluoropropylene copolymers
- EFE ethylene-tetrafluoroethylene copolymers
- PVDF polyvinylidene fluoride
- PVF polyvinyl fluoride
- PCTFE polychlorotrifluoroethylene copolymers
- ECTFE
- thermoplastic elastomers are characterized in that they can be processed like thermoplastics but have rubber-elastic properties. More detailed information is found for example in G. Holden et al., Thermoplastic Elastomers, 2 nd edition, Hanser Verlag, Kunststoff 1996.
- thermoplastic polyurethane elastomers TPE-U or TPU
- styrene oligoblock copolymers TPE-S
- SBS styrene-butadiene-styrene-oxy block copolymer
- SEES styrene-ethylene-butylene-styrene block copolymer, obtainable by hydrogenation of SBS
- thermoplastic polyolefin elastomers TPE-O
- thermoplastic polyester elastomers TPE-E
- thermoplastic polyamide elastomers TPE-A
- thermoplastic vulcanizates TPE-V
- the polymers used as coating additives have a molecular weight of at most 200,000, preferably of at most 170,000, more preferably of at most 150,000 and still more preferably at most 130,000.
- the compounds used as coating additives have a molecular weight of at most 110,000, preferably of at most 90,000, more preferably of at most 70,000 and still more preferably of at most 50,000.
- carboxylic acids used as coating additive also comprise in particular dicarboxylic acids, tricarboxylic acids and tetracarboxylic acids in particular embodiments.
- dicarboxylic acids are succinic acid, glutaric acid, adipic acid, pimelic acid, suberic acid, azelaic acid and sebacic acid.
- the above-named carboxylic acid derivatives are directed in particular towards carboxylic acid esters.
- fatty acids examples include capric acid, undecanoic acid, lauric acid, tridecanoic acid, myristic acid, pentadecanoic acid, palmitic acid, margaric acid, nonadecanoic acid, arachidic acid, behenic acid, lignoceric acid, cerotic acid, melissic acid, undecylenic acid, palmitoleic acid, elaidic acid, vaccenic acid, eicosenoic acid, cetoleic acid, erucic acid, nervonic acid, sorbic acid, linoleic acid, linolenic acid, eleostearic acid, arachidonic acid, timnodonic acid, clupanodonic acid, docosahexaenoic acid, stearic acid and oleic acid.
- the coating additives comprise no stearic acid or oleic acid, preferably no saturated or unsaturated C18 carboxylic acids, more preferably no saturated or unsaturated C14 to C18 carboxylic acids, still more preferably no saturated or unsaturated C12 to C18 carboxylic acids and most preferably no saturated or unsaturated C10 to C20 carboxylic acids.
- the term “C” followed by a number relates within the meaning of the present invention to the carbon atoms contained in a molecule or molecule constituent, wherein the number expresses the quantity of carbon atoms.
- X can be the same or different and is hydrogen, hydroxy, halogen or —NR′ 2
- R′ can be the same or different and is hydrogen, a substituted or unsubstituted C1-C9 alkyl group or a substituted or unsubstituted aryl group
- Y can be the same or different and is —O—, —S—, —NH— or —NR— and R can be the same or different and is selected from the group consisting of C1-C30 alkyl groups, C2-C30 alkenyl groups, C2-C30 alkinyl groups, C5-C30 aryl groups, C6-C30 arylalkyl groups, C4-C30 heteroaryl groups, C5-C30 heteroarylalkyl groups, C3-C30 cycloalkyl groups, C4-C30 cycloalkylalkyl groups, C2-C30 heterocycloalkyl groups, C2-C30 heterocycloalkyl groups, C2-C
- substituted within the meaning of the present invention describes that at least one hydrogen atom of the relevant group by a halogen, hydroxy, cyano, C1-C8 alkyl, C2-C8 alkenyl, C2-C8 alkinyl, C1-C5 alkanoyl, C3-C8 cycloalkyl, heterocyclic, aryl, heteroaryl, C1-C7 alkylcarbonyl, C1-C7 alkoxy, C2-C7 alkenyloxy, C2-C7 alkinyloxy, aryloxy, acyl, C1-C7 acryloxy, C1-C7 methacryloxy, C1-C7 epoxy, C1-C7 vinyl, C1-C5 alkoxycarbonyl, aroyl, aminocarbonyl, alkylaminocarbonyl, dialkylaminocarbonyl, amincarbonyloxy, C1-C7 alkylaminocarbonyloxy, C1-C7 dial
- cycloalkyl group and “heterocycloalkyl group” within the meaning of the present invention comprise saturated, partially saturated and unsaturated systems, apart from aromatic systems, which are called “aryl groups” or “heteroaryl groups”.
- alkyl within the meaning of the present invention, unless otherwise indicated, preferably represents straight or branched C1 to C27, more preferably straight or branched C1 to C25 and still more preferably straight or branched C1 to C20 carbon chains.
- alkenyl and alkinyl within the meaning of the present invention, unless otherwise indicated, preferably represent straight or branched C2 to C27, more preferably straight or branched C2 to C25 and still more preferably straight or branched C2 to C20 carbon chains.
- aryl within the meaning of the present invention represents aromatic carbon rings, preferably aromatic carbon rings with at most 7 carbon atoms, more preferably the phenyl ring, wherein the above-named aromatic carbon rings can be a constituent of a condensed ring system.
- aryl groups are phenyl, hydroxyphenyl, biphenyl and naphthyl.
- heteroaryl within the meaning of the present invention represents aromatic rings, in which a carbon atom of an analogous aryl ring has formally been replaced by a heteroatom, preferably by an atom selected from the group consisting of O, S and N.
- silanes are characterized by a structure according to Formula (II):
- X can be the same or different and is hydrogen, hydroxy, halogen or —NR′ 2
- R′ can be the same or different and is hydrogen, a substituted or unsubstituted C1-C9 alkyl group or a substituted or unsubstituted aryl group and R can be the same or different and is selected from the group consisting of C1-C30 alkyl groups, C2-C30 alkenyl groups, C2-C30 alkinyl groups, C5-C30 aryl groups, C6-C30 arylalkyl groups, C4-C30 heteroaryl groups, C5-C30 heteroarylalkyl groups, C3-C30 cycloalkyl groups, C4-C30 cycloalkylalkyl groups, C2-C30 heterocycloalkyl groups, C3-C30 heterocycloalkylalkyl groups, C1-C30 ester groups, C1-C30 alkyl ether groups,
- the coating additive can be bound for example chemically or physically to the surface of the particles of the powdered coating material. It is not necessary here that an unbroken surface coverage of the particles is carried out, even if this is preferred in particular embodiments of the present invention.
- the coating additives are bound as weakly as possible to the surface of the particles of the powdered coating material.
- the coating additives used according to the invention carry no functional group.
- the term “functional group” within the meaning of the present invention denotes molecular groups in molecules which decisively influence the substance properties and the reaction behavior of the molecules. Examples of such functional groups are: carboxylic acid groups, sulfonic acid groups, phosphoric acid groups, silane groups, carbonyl groups, hydroxyl groups, amine groups, hydrazine groups, halogen groups and nitro groups.
- the coating additives cannot be removed from the surface too easily, for example as a result of friction.
- the coating additives used according to the invention carry at least one functional group, preferably at least two functional groups, more preferably at least three functional groups.
- the use of the powdered coating material according to the invention with a surface coverage according to the invention can also be used coating materials with an unexpectedly high melting point.
- the inventors are of the view that the more uniform conveying of the particles with reduced tendency to agglomerate allows the individual particles to strike the substrate surface and the kinetic energy present to be able to be utilized fully to shape the particle.
- some of the kinetic energy is possibly used up by the breakup of the agglomerate and particles that strike later are cushioned by coating material already present at this site, but not yet solidified. If the powdered coating material is passed through a flame beforehand, the thermal energy is furthermore probably better transferred to the particles in the case of uniform fed-in particles without agglomerates.
- powdered coating materials covered according to the invention with at least one coating additive can also be used to produce homogeneous layers if the melting point, measured in [K], of the coating material is up to 50%, preferably up to 60%, more preferably up to 65% and still more preferably up to 70% of the temperature, measured in [K], of the medium used in the coating method directed onto the substrate, for example the gas stream, the combustion flame and/or the plasma flame.
- furthermore powdered coating materials covered according to the invention with at least one coating additive can also be used to produce homogeneous layers if the melting point, measured in [K], of the coating material is up to 75%, preferably up to 80%, more preferably up to 85% and still more preferably up to 90% of the temperature, measured in [K], of the medium used in the coating method directed onto the substrate, for example the gas stream, the combustion flame and/or the plasma flame.
- the above-named percentages relate to the ratio of the melting temperature of the coating material to the temperature of the gas stream in cold gas spraying, the combustion flame in flame spraying and high-speed flame spraying or the plasma flame in non-thermal or thermal plasma spraying in [K].
- the thus-obtained coating has only a few free particle or grain structures, preferably none.
- the above-named homogeneous layers are characterized in that the produced layers have less than 10%, preferably less than 5%, more preferably less than 3%, still more preferably less than 1% and most preferably less than 0.1% cavities. In particular, it is preferred that no cavities at all are recognizable.
- the above-named term “cavity” within the meaning of the present invention describes the proportion of holes, incorporated in the coating, on the two-dimensional surface of a cross-section of the coated substrate, relative to the coating contained in the two-dimensional surface. A determination of this proportion is carried out by means of SEM at 30 randomly selected sites on the coating, wherein for example a length of 100 ⁇ m of the substrate coating is examined.
- homogeneous coatings could also be produced from materials which have a strong tendency to form agglomerates for example because of their particle-size distributions and which tend to form non-homogeneous coatings as a result of a lack of breakup of the above-named agglomerates.
- the size distribution of the particles is preferably determined by means of laser granulometry.
- the particles can be measured in the form of a powder.
- the scattering of the irradiated laser light is detected in different spatial directions and evaluated according to the Fraunhofer diffraction theory.
- the particles are treated computationally as spheres.
- the determined diameters always relate to the equivalent spherical diameter determined over all spatial directions, irrespective of the actual shape of the particles.
- the size distribution is determined, calculated in the form of a volume average relative to the equivalent spherical diameter.
- This volume-averaged size distribution can be represented as a cumulative frequency distribution.
- the cumulative frequency distribution is characterized in a simplified manner by different characteristic values, for example the D 10 , D 50 or D 90 value.
- the measurements can be carried out for example with the particle-size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany.
- a dry powder can be dispersed using a dispersing unit of the Rodos T4.1 type at a primary pressure of for example 4 bar.
- a size distribution curve of the particles can be measured, for example, with a device from Quantachrome (device: Cilas 1064) according to the manufacturers instructions. For this, 1.5 g of the powdered coating material is suspended in approx.
- the powdered coating material has a particle-size distribution with a D 50 value of at most 53 ⁇ m, preferably at most 51 ⁇ m, more preferably at most 50 ⁇ m and still more preferably at most 49 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 50 value of at most 48 ⁇ m, preferably at most 47 ⁇ m, more preferably at most 46 ⁇ m and still more preferably at most 45 ⁇ m.
- D 50 within the meaning of the present invention denotes the particle size at which 50% of the above-named particle-size distribution volume-averaged by means of laser granulometry lies below the indicated value.
- the measurements can be carried out for example according to the above-named measurement method with a particle-size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany.
- the powdered coating material has a particle-size distribution with a D 50 value of at least 1.5 ⁇ m, preferably at least 2 ⁇ m, more preferably at least 4 ⁇ m and still more preferably at least 6 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 50 value of at least 7 ⁇ m, preferably at least 9 ⁇ m, more preferably at least 11 ⁇ m and still more preferably at least 13 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 1.5 to 53 ⁇ m, preferably from a range of from 2 to 51 ⁇ m, more preferably from a range of from 4 to 50 ⁇ m and still more preferably from a range of from 6 to 49 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 7 to 48 ⁇ m, preferably from a range of from 9 to 47 ⁇ m, more preferably from a range of from 11 to 46 ⁇ m and still more preferably from a range of from 13 to 45 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 1.5 to 45 ⁇ m, preferably from a range of from 2 to 43 ⁇ m, more preferably from a range of from 2.5 to 41 ⁇ m and still more preferably from a range of from 3 to 40 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 3.5 to 38 ⁇ m, preferably from a range of from 4 to 36 ⁇ m, more preferably from a range of from 4.5 to 34 ⁇ m and still more preferably from a range of from 5 to 32 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 9 to 53 ⁇ m, preferably from a range of from 12 to 51 ⁇ m, more preferably from a range of from 15 to 50 ⁇ m, still more preferably from a range of from 17 to 49 ⁇ m.
- the powder has a particle-size distribution with a D 50 value from a range of from 19 to 48 ⁇ m, preferably from a range of from 21 to 47 ⁇ m, more preferably from a range of from 23 to 46 ⁇ m and still more preferably from a range of from 25 to 45 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 90 value of at most 103 ⁇ m, preferably at most 99 ⁇ m, more preferably at most 95 ⁇ m, still more preferably at most 91 ⁇ m and most preferably at most 87 ⁇ m.
- the powdered coating material has a D 90 value of at most 83 ⁇ m, preferably at most 79 ⁇ m, more preferably at most 75 ⁇ m and still more preferably at most 71 ⁇ m.
- D 90 within the meaning of the present invention denotes the particle size at which 90% of the above-named particle-size distribution volume-averaged by means of laser granulometry lies below the indicated value.
- the measurements can be carried out for example according to the above-named measurement method with a particle-size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany.
- the powdered coating material has a particle-size distribution with a D 90 value of at least 9 ⁇ m, preferably at least 11 ⁇ m, more preferably at least 13 ⁇ m and still more preferably at least 15 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 90 value of at least 17 ⁇ m, preferably at least 19 ⁇ m, more preferably at least 21 ⁇ m and still more preferably at least 22 ⁇ m.
- the powdered coating materials have a particle-size distribution with a D 90 value from a range of from 42 to 103 ⁇ m, preferably from a range of from 45 to 99 ⁇ m, more preferably from a range of from 48 to 95 ⁇ m and still more preferably from a range of from 50 to 91 ⁇ m.
- the powdered coating material has a D 90 value from a range of from 52 to 87 ⁇ m, preferably from a range of from 54 to 81 ⁇ m, more preferably from a range of from 56 to 75 ⁇ m and still more preferably from a range of from 57 to 71 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of at most 5 ⁇ m, preferably at most 4 ⁇ m, more preferably at most 3 ⁇ m and still more preferably at most 2.5 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of at most 2.2 ⁇ m, preferably at most 2 ⁇ m, more preferably at most 1.8 ⁇ m and still more preferably at most 1.7 ⁇ m.
- D 10 within the meaning of the present invention denotes the particle size at which 10% of the above-named particle-size distribution volume-averaged by means of laser granulometry lies below the indicated value.
- the measurements can be carried out for example according to the above-named measurement method with a particle-size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany.
- the powdered coating materials according to the invention with a high fines proportion also still have a strong tendency to form fine dusts, which makes the handling of corresponding powders much more difficult.
- the powdered coating material according to the invention has a particle-size distribution with a D 10 value of at least 0.2 ⁇ m, preferably at least 0.4 ⁇ m, more preferably at least 0.5 ⁇ m and still more preferably at least 0.6 ⁇ m.
- the powdered coating material according to the invention has a particle-size distribution with a D 10 value of at least 0.7 ⁇ m, preferably 0.8 ⁇ m, more preferably 0.9 ⁇ m and still more preferably at least 1.0 ⁇ m.
- the powdered coating material according to the invention is characterized in that it have a particle-size distribution with a D 10 value from a range of from at least 0.2 to 5 ⁇ m, preferably at least 0.4 to 4 ⁇ m, more preferably from a range of from 0.5 to 3 ⁇ m and still more preferably from a range of from 0.6 to 2.5 ⁇ m.
- the powdered coating material according to the invention has a particle-size distribution with a D 10 value from a range of from 0.7 to 2.2 ⁇ m, preferably from a range of from 0.8 to 2.1 ⁇ m, more preferably from a range of from 0.9 to 2.0 ⁇ m and still more preferably from a range of from 1.0 to 1.9 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 3.7 to 26 ⁇ m, a D 50 value of from 6 to 49 ⁇ m and a D 90 value of from 12 to 86 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 5.8 to 26 ⁇ m, a D 50 value of from 11 to 46 ⁇ m and a D 90 value of from 16 to 83 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 9 to 19 ⁇ m, a D 50 value of from 16 to 35 ⁇ m and a D 90 value of from 23 to 72 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 0.8 to 28 ⁇ m, a D 50 value of from 1.5 to 45 ⁇ m and a D 90 value of from 2.5 to 81 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 2.2 to 22 ⁇ m, a D 50 value of from 4 to 36 ⁇ m and a D 90 value of from 4 to 62 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 2.8 to 17 ⁇ m, a D 50 value of from 6 to 28 ⁇ m and a D 90 value of from 9 to 49 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 4.8 to 29 ⁇ m, a D 50 value of from 9 to 53 ⁇ m and a D 90 value of from 13 to 97 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 12 to 26 ⁇ m, a D 50 value of from 23 to 46 ⁇ m and a D 90 value of from 35 to 87 ⁇ m.
- the powdered coating material has a particle-size distribution with a D 10 value of from 15 to 24 ⁇ m, a D 50 value of from 28 to 44 ⁇ m and a D 90 value of from 41 to 78 ⁇ m.
- the inventors have found that in particular embodiments, for example, a still more uniform conveyability of the powdered coating material is achieved through the use of a powdered coating material with a smaller span, which further simplifies the formation of a more homogeneous and higher-quality layer.
- the span of the powdered coating material is at most 2.9, preferably at most 2.6, more preferably at most 2.4 and still more preferably at most 2.1.
- the span of the powdered coating material is at most 1.9, preferably at most 1.8, more preferably at most 1.7 and still more preferably at most 1.6.
- the span value of the powdered coating material is at least 0.4, preferably at least 0.5, more preferably at least 0.6 and still more preferably at least 0.7. In particular embodiments, it is preferred in particular that the span value of the powdered coating material is at least 0.8, preferably at least 0.9, more preferably at least 1.0 and still more preferably at least 1.1.
- the powdered coating material has a span value from a range of from 0.4 to 2.9, preferably from a range of from 0.5 to 2.6, more preferably from a range of from 0.6 to 2.4 and still more preferably from a range of from 0.7 to 2.1.
- the powdered coating material has a span value from a range of from 0.8 to 1.9, preferably from a range of from 0.9 to 1.8, more preferably from a range of from 1.0 to 1.7 and still more preferably from a range of from 1.1 to 1.6.
- the powdered coating material has for example a particle-size distribution with a span from a range of from 0.4 to 2.9 and a D 50 value from a range of from 1.5 to 53 ⁇ m, preferably from a range of from 2 to 51 ⁇ m, more preferably from a range of from 4 to 50 ⁇ m, still more preferably from a range of from 6 to 49 ⁇ m and most preferably from a range of from 7 to 48 ⁇ m.
- the powdered coating material has a particle-size distribution with a span from a range of from 0.5 to 2.6 and a D 50 value from a range of from 1.5 to 53 ⁇ m, preferably from a range of from 2 to 51 ⁇ m, more preferably from a range of from 4 to 50 ⁇ m, still more preferably from a range of from 6 to 49 ⁇ m and most preferably from a range of from 7 to 48 ⁇ m.
- the powdered coating material has a particle-size distribution with a span from a range of from 0.6 to 2.4 and a D 50 value from a range of from 1.5 to 53 ⁇ m, preferably from a range of from 2 to 51 ⁇ m, more preferably from a range of from 4 to 50 ⁇ m, still more preferably from a range of from 6 to 49 ⁇ m and most preferably from a range of from 7 to 48 ⁇ m.
- the powdered coating material has a particle-size distribution with a span from a range of from 0.7 to 2.1 and a D 50 value from a range of from 1.5 to 53 ⁇ m, preferably from a range of from 2 to 51 ⁇ m, more preferably from a range of from 4 to 50 ⁇ m, still more preferably from a range of from 6 to 49 ⁇ m and most preferably from a range of from 7 to 48 ⁇ m.
- the density of the powdered coating material can influence the conveying of such powders in the form of an aerosol.
- the inventors are of the view that the differences in inertia of particles that are the same size but have different densities lead to a different behavior of the aerosol streams of powdered coating materials with identical particle-size distribution. It can therefore prove to be difficult to transfer conveying methods which have been optimized for a specific D 50 to powdered coating materials with other densities. In particular embodiments, therefore, it is preferred that the upper limit of the span value is corrected dependent on the density of the powdered coating material used.
- Span UC Span U ⁇ ( ⁇ Alu ⁇ X ) 1 3
- Span UC is the corrected upper span value
- Span U is the upper span value
- ⁇ Alu is the density of aluminum (2.7 g/cm 3 )
- ⁇ X is the density of the powdered coating material used.
- a powdered coating material with an uncorrected upper span value is therefore used for powdered coating materials with a density lower than the density of aluminum.
- Coating methods that can be used according to the invention are known to a person skilled in the art under the names cold gas spraying, thermal plasma spraying, non-thermal plasma spraying, flame spraying and high-speed flame spraying.
- Cold gas spraying is characterized in that the powder to be applied is not melted in the gas jet, but the particles are greatly accelerated and, as a result of their kinetic energy, form a coating on the surface of the substrate.
- various gases known to a person skilled in the art can be used as carrier gas, such as nitrogen, helium, argon, air, krypton, neon, xenon, carbon dioxide, oxygen or mixtures thereof.
- Gas speeds of up to 3000 m/s are achieved through a controlled expansion of the above-named gases in a corresponding nozzle.
- the particles can be accelerated here to up to 2000 m/s.
- a disadvantage is, for example, the strong generation of noise which is brought about by the high speeds of the gas streams used.
- a powder is converted to the liquid or plastic state by means of a flame and then applied to a substrate as coating.
- a substrate e.g. a mixture of oxygen and a combustible gas such as acetylene or hydrogen is combusted.
- some of the oxygen is used to transport the powdered coating material into the combustion flame. The particles achieve speeds of between 24 and 31 m/s in customary variants of this method.
- a powder is also converted to the liquid or plastic state by means of a flame.
- the particles are accelerated to significantly higher speeds compared with the above-named method.
- a speed of the gas stream of from 1220 to 1525 m/s with a speed of the particles of from approx. 550 to 795 m/s is named.
- gas speeds of over 2000 m/s are also achieved.
- the speed of the flame lies between 1000 and 2500 m/s.
- the flame temperature lies between 2200° C.
- the temperature of the flame is thus comparable to the temperature in flame spraying. This is achieved by combusting the gases under a pressure of from approx. 515 to 621 kPa, followed by expansion of the combustion gases in a nozzle. In general, the view is taken that coatings produced here have a higher density than, for example, coatings obtained by the flame spraying method.
- Detonation/explosive flame spraying can be viewed as a subtype of high-speed flame spraying.
- the powdered coating material is strongly accelerated by repeated detonations of a gas mixture such as acetylene/oxygen, wherein for example particle speeds of approx. 730 m/s are achieved.
- the detonation frequency of the method becomes for example between approx. 4 and 10 Hz.
- detonation frequencies of around approx. 100 Hz are also chosen.
- the layers obtained are usually supposed to have a particularly high hardness, strength, density and good binding to the substrate surface.
- a disadvantage in the above-named methods is the increased safety costs, as well as for example the high noise load because of the high gas speeds.
- thermal plasma spraying for example, a direct current arc furnace is passed through by a primary gas such as argon at a speed of 40 l/min and a secondary gas such as hydrogen at a speed of 2.5 l/min, wherein a thermal plasma is generated. Then, for example, 40 g/min of the powdered coating material is fed in with the aid of a carrier gas stream, which is passed into the plasma flame at a speed of 4 l/min.
- the conveying rate of the powdered coating material is between 5 g/min and 60 g/min, more preferably between 10 g/min and 40 g/min.
- argon, helium or mixtures thereof as ionizable gas.
- the whole gas stream is furthermore preferably 30 to 150 SLPM (standard liters per minute) in particular variants.
- the electrical power used to ionize the gas stream, without the heat energy dissipated as a result of cooling, can be selected for example between 5 and 100 kW, preferably between 40 and 80 kW.
- plasma temperatures of between 4000 and a few 10000 K can be achieved.
- a non-thermal plasma is used to activate the powdered coating material.
- the plasma used here is generated for example with a barrier discharge or corona discharge with a frequency of from 50 Hz to 1 MHz. In particular variants of non-thermal plasma spraying, it is preferred that work is done at a frequency of from 10 kHz to 100 kHz.
- the temperature of the plasma here is preferably less than 3000 K, preferably less than 2500 K and still more preferably less than 2000 K. This minimizes the technical outlay and keeps the input of energy into the coating material to be applied as low as possible, which in turn allows a gentle coating of the substrate.
- Non-thermal plasmas the core temperature of which is below 1173 K or even below 773 K in the core region can also be generated by targeted choice of the parameters.
- the temperature in the core region is measured here, for example, using an NiCr/Ni thermocouple and a spray diameter of 3 mm at a distance of 10 mm from the nozzle outlet in the core of the emerging plasma jet at ambient pressure.
- Such non-thermal plasmas are suitable in particular for coatings of very temperature-sensitive substrates.
- the outlet opening for the plasma flame such that the track widths of the coatings produced lie between 0.2 mm and 10 mm.
- a distance of 1 mm is chosen as the distance from the spray lance to the substrate. This makes possible as great a flexibility as possible of the coatings and, at the same time, guarantees high-quality coatings.
- the distance between spray lance and substrate expediently lies between 1 mm and 35 mm.
- ionizable gas in the non-thermal plasma method.
- gases known to a person skilled in the art and mixtures thereof can be used as ionizable gas in the non-thermal plasma method.
- gases known to a person skilled in the art and mixtures thereof can be used as ionizable gas in the non-thermal plasma method.
- gases are helium, argon, xenon, nitrogen, oxygen, hydrogen or air, preferably argon or air.
- a particularly preferred ionizable gas is air.
- the speed of the plasma stream lies below 200 m/s.
- a value of between 0.01 m/s and 100 m/s, preferably between 0.2 m/s and 10 m/s, can be chosen as the flow rate.
- the volume flow of the carrier gas lies between 10 and 25 l/min, more preferably between 15 and 19 l/min.
- the particles of the powdered coating material are preferably metallic particles or metal-containing particles. It is preferred in particular that the metal content of the metallic particles or metal-containing particles is at least 95 wt.-%, preferably at least 99 wt.-%, still more preferably at least 99.9 wt.-%.
- the metal is, or the metals are, selected from the group consisting of silver, gold, platinum, palladium, vanadium, chromium, manganese, cobalt, germanium, antimony, aluminum, zinc, tin, iron, copper, nickel, titanium, silicon, alloys and mixtures thereof.
- the metal is, or the metals are, selected from the group consisting of silver, gold, aluminum, zinc, tin, iron, copper, nickel, titanium, silicon, alloys and mixtures thereof, preferably from the group consisting of silver, gold, aluminum, zinc, tin, iron, nickel, titanium, silicon, alloys and mixtures thereof.
- the metal or the metals of the particles of the powdered coating material is or are selected from the group consisting of silver, aluminum, zinc, tin, copper, alloys and mixtures thereof.
- metallic particles or metal-containing particles in which the metal is, or the metals are, selected from the group consisting of silver, aluminum and tin have proved to be particularly suitable particles in specific embodiments.
- the powdered coating material consists of inorganic particles which are preferably selected from the group consisting of carbonates, oxides, hydroxides, carbides, halides, nitrides and mixtures thereof. Mineral and/or metal-oxide particles are particularly suitable.
- the inorganic particles are alternatively or additionally selected from the group consisting of carbonaceous particles or graphite particles.
- a further possibility is the use of mixtures of the metallic particles and the above-named inorganic particles, such as for example mineral and/or metal-oxide particles, and/or the particles which are selected from the group consisting of carbonates, oxides, hydroxides, carbides, halides, nitrides and mixtures thereof.
- the powdered coating material can comprise or consist of glass particles.
- the powdered coating material comprises or consists of organic and/or inorganic salts.
- the powdered coating material comprises or consists of plastic particles.
- the above-named plastic particles are formed for example from pure or mixed homo-, co-, block or pre-polymers or mixtures thereof.
- the plastic particles can be pure crystals or be mixed crystals or have amorphous phases.
- the plastic particles can be obtained for example by mechanical comminution of plastics.
- the powdered coating material comprises or consists of mixtures of particles of different materials.
- the powdered coating material consists in particular of at least two, preferably three, different particles of different materials.
- the particles can be produced via different methods.
- the metal particles can be obtained by nebulizing or atomizing molten metals.
- Glass particles can be produced by mechanical comminution of glass or else from the melt. In the latter case, the glass melt can likewise be atomized or nebulized.
- melted glass can also be comminuted on rotating elements, for example a drum.
- Mineral particles, metal-oxide particles and inorganic particles which are selected from the group which consists of oxides, hydroxides, carbonates, carbides, nitrides, halides and mixtures thereof can be obtained by comminuting the naturally occurring minerals, stones, etc. and then screening them by size.
- the screening by size can be carried out for example by means of cyclones, air separators, screens, etc.
- the particles of the powdered coating material have been equipped with a coating in addition to the surface coverage according to the invention.
- a coating in addition to the surface coverage according to the invention.
- This makes it possible for example to provide a coated standard powder with an increased oxidation stability which is adapted to specific devices or uses by a targeted, subsequent surface coverage.
- This is particularly advantageous for a surface coverage according to the invention which is applied by means of methods that are simple in terms of process engineering.
- the above-named coating is applied before the surface coverage according to the invention, wherein the surface coverage according to the invention is preferably applied mechanically to the particles, for example kneaded on.
- the above-named coating can comprise a metal or consist of a metal.
- a coating of a particle can be formed closed or particulate, wherein coatings with a closed structure are preferred.
- the layer thickness of such a metallic coating preferably lies below 1 ⁇ m, more preferably below 0.8 ⁇ m and still more preferably below 0.5 ⁇ m.
- such coatings have a thickness of at least 0.05 ⁇ m, more preferably of at least 0.1 ⁇ m.
- Metals that are particularly preferred in particular embodiments for use in one of the above-named coatings are selected from the group consisting of copper, titanium, gold, silver, tin, zinc, iron, silicon, nickel and aluminum, preferably from the group consisting of gold, silver, tin and zinc, further preferably from the group consisting of silver, tin and zinc.
- the term main constituent within the meaning of the above-named coating denotes that the relevant metal or a mixture of the above-named metals represents at least 90 wt.-%, preferably 95 wt.-%, further preferably 99 wt.-% of the metal content of the coating. It must be understood that, in the case of a partial oxidation, the oxygen proportion of the corresponding oxide layer is not taken into account.
- Such metallic coatings can be produced for example by means of gas-phase synthesis or wet-chemical methods.
- the particles according to the invention of the powdered coating material are additionally or alternatively coated with a metal oxide layer.
- this metal oxide layer substantially consists of silicon oxide, aluminum oxide, boron oxide, zirconium oxide, cerium oxide, iron oxide, titanium oxide, chromium oxide, tin oxide, molybdenum oxide, oxide hydrates thereof, hydroxides thereof and mixtures thereof.
- the metal oxide layer substantially consists of silicon oxide.
- the above-mentioned term, “substantially consists of”, within the meaning of the present invention means that at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% and most preferably at least 99.9% of the metal oxide layer consists of the above-named metal oxides, in each case relative to the number of particles of the metal oxide layer, wherein any water contained is not factored in.
- the composition of the metal oxide layer can be determined by means of methods known to a person skilled in the art, such as for example sputtering in combination with XPS or TOF-SIMS.
- Such a metal oxide layer can be applied for example using the sol-gel method.
- the substrate is selected from the group consisting of plastic substrates, inorganic substrates, cellulose-containing substrates and mixtures thereof.
- the plastic substrates can be for example plastic films or shaped bodies made of plastics.
- the shaped bodies can have geometrically simple or complex shapes.
- the plastic shaped body can be for example a component from the automotive industry or the construction industry.
- the cellulose-containing substrates can be cardboard, paper, wood, wood-containing substrates, etc.
- the inorganic substrates can be for example metallic substrates, such as sheet metals or metallic shaped bodies or ceramic or mineral substrates or shaped bodies.
- the inorganic substrates can also be solar cells or silicon wavers, to which for example electrically conductive coatings or contacts are applied.
- Substrates made of glass such as for example glass panes, can also be used as inorganic substrates.
- the glass, in particular glass panes, can be equipped for example with electrochromic coatings using the method according to the invention.
- the substrates coated by means of the method according to the invention are suitable for very different uses.
- the coatings have optical and/or electromagnetic effects.
- the coatings can bring about reflections or absorptions.
- the coatings can be electrically conductive, semiconductive or non-conductive.
- Electrically conductive layers can be applied for example in the form of strip conductors to components. This can be used for example to make current-carrying possible within the framework of the on-board power supply in an automobile component. Furthermore, such a strip conductor can, however, also be formed for example as an antenna, as a shield, as an electrical contact, etc. This is particularly advantageous for example for RFID applications (radio frequency identification). Furthermore, coatings according to the invention can be used for example for heating purposes or for the targeted heating of specific components or specific parts of larger components.
- the coatings produced act as sliding layers, diffusion barriers for gases and liquids, wear and/or corrosion protection layers. Furthermore, the coatings produced can influence the surface tension of liquids or have adhesion-promoting properties.
- the coatings produced according to the invention can furthermore be used as sensor surfaces, for example as human-machine interface (HMI), for example in the form of a touchscreen.
- HMI human-machine interface
- the coatings can likewise be used to shield from electromagnetic interferences (EMI) or to protect against electrostatic discharges (ESD).
- EMI electromagnetic interferences
- ESD electrostatic discharges
- the coatings can also be used to bring about electromagnetic compatibility (EMC).
- layers can be applied which are applied for example to increase the stability of corresponding components after repair.
- An example is constituted by repairs in the aviation sector, wherein for example a loss of material as a result of processing steps must be compensated for, or a coating is to be applied for example for stabilization.
- This proves to be difficult for aluminum components for example, and normally requires post-processing steps such as sintering.
- firmly adhering coatings can be applied under very gentle conditions, without post-processing steps such as sintering even being required.
- the coatings act as electrical contacts and allow an electrical connection between different materials.
- FIGS. 1 and 2 show a copper layer applied to a steel sheet.
- the size distribution of the particles of the powdered coating materials used was determined by means of a HELOS device (Sympatec, Germany). For the measurement, 3 g of the powdered coating material was introduced into the measuring device and treated, before the measurement, with ultrasound for 30 seconds. For the dispersion, a Rodos T4.1 dispersing unit was used, wherein the primary pressure was 4 bar. The evaluation was carried out with the device's standard software.
- the application of the coating additive was carried out analogously to Example 1. 3 g monoethyl fumarate was used as coating additive.
- the application of the coating additive was carried out analogously to Example 1. 3 g adipic acid monoethyl ester was used as coating additive.
- the application of the coating additive was carried out analogously to Example 1. 3 g methyl triglycol was used as coating additive.
- the application of the coating additive was carried out analogously to Example 1. However, copper particles with a D 50 of 34 ⁇ m were used here. 3 g adipic acid monoethyl ester was used as coating additive.
- the application of the coating additive was carried out analogously to Example 1. However, a copper particle with a D 50 of 34 ⁇ m was used here. 3 g methyl triglycol was used as coating additive.
- Example 2 Copper particles with a D 50 value of 34 ⁇ m were used here. 3 g ethyl cellulose (Ethocel Standard 10, from Dow Wolff Cellulosics) was used as coating additive.
- the application of the coating additive was carried out analogously to Example 1. 100 g aluminum particles with a D 50 value of 1.6 ⁇ m were used here. 3 g ethyl cellulose (Ethocel Standard 10, from Dow Wolff Cellulosics) was used as coating additive.
- Example 2 The application of the coating additive was carried out analogously to Example 1. A copper particle with a D 50 value of 34 ⁇ m was used here. 3 g DEGALAN PM 381 (copolymer from methyl methacrylate and isobutyl methacrylate, from Evonik) was used as coating additive.
- the copper paste or tin paste was dispersed in 600 g ethanol, with the result that a 35 wt.-% dispersion formed.
- 100 ml of a solution of 0.5 g dimethyl 2,2′-azobis(2-methylpropionate) (trade name V 601; available from WAKO Chemicals GmbH, Fuggerstra ⁇ e 12, 41468 Neuss), 1 g methacryloxypropyltrimethoxysilane (MEMO) and 10 g trimethylolpropane trimethacrylate (TMPTMA) in white spirit was then added to the reaction mixture over 1 h. Stirring followed for a further 15 h at 75° C., the reaction mixture was filtered off, isolated as paste and dried under negative pressure.
- Example Metal D50 9-1 Aluminum grit 1.6 ⁇ m 9-2 Copper grit 25 ⁇ m 9-3 Copper flakes 35 ⁇ m 9-4 Copper grit 9 ⁇ m 9-5 Tin grit 28 ⁇ m
- the decomposition temperature of the polymer here was approx. 260° C., determined according to DIN EN ISO 11358. At this temperature, an incipient clear decrease in the weight of the powdered coating material was shown.
- the sheets coated according to the invention were much more homogeneous in relation to their optics as well as their haptics. SEM photographs of the surfaces demonstrate the formation of larger uniform areas of the coating, while the surface of the comparison examples is characterized by a large number of isolated particles. Furthermore, the cross-section shows that cavities contained in the coating of the sheet according to the invention are significantly smaller.
- the aluminum particles according to Examples 7-2 and 9-1 were applied to steel sheets by means of a flame spraying system from CASTOLIN in an oxy-acetylene flame.
- the obtained sheets were then analyzed by means of SEM.
- a uniform coating was shown here, wherein small cavities and only negligible amounts of oxidation were observed.
- the coatings macroscopically showed a good adhesion to the steel sheets.
- Example 9-1 without coating additive did not allow a coating according to the invention. Only small quantities of greatly isolated, very coarse particulate particle agglomerates were applied to the surface here.
- the powdered coating material was applied by means of a Plasmatron system from Inocon, Attnang-Puchheim, Austria. Argon and nitrogen were used as ionizable gases. Standard process parameters were used here.
Landscapes
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Materials Engineering (AREA)
- Mechanical Engineering (AREA)
- Metallurgy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- Plasma & Fusion (AREA)
- Paints Or Removers (AREA)
- Coating By Spraying Or Casting (AREA)
- Application Of Or Painting With Fluid Materials (AREA)
- Pigments, Carbon Blacks, Or Wood Stains (AREA)
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE102011052120.8 | 2011-07-25 | ||
DE102011052120A DE102011052120A1 (de) | 2011-07-25 | 2011-07-25 | Verwendung speziell belegter, pulverförmiger Beschichtungsmaterialien und Beschichtungsverfahren unter Einsatz derartiger Beschichtungsmaterialien |
PCT/EP2012/064636 WO2013014211A2 (de) | 2011-07-25 | 2012-07-25 | Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien |
Publications (1)
Publication Number | Publication Date |
---|---|
US20140342094A1 true US20140342094A1 (en) | 2014-11-20 |
Family
ID=46650518
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/234,833 Abandoned US20140342094A1 (en) | 2011-07-25 | 2012-07-25 | Use of Specially Coated Powdered Coating Materials and Coating Methods Using Such Coating Materials |
Country Status (7)
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20140170410A1 (en) * | 2011-07-25 | 2014-06-19 | Eckart Gmbh | Method for Applying a Coating to a Substrate, Coating, and Use of Particles |
US20140241937A1 (en) * | 2011-07-25 | 2014-08-28 | Eckart Gmbh | Coating Method Using Special Powdered Coating Materials and Use of Such Coating Materials |
US20160160359A1 (en) * | 2013-11-18 | 2016-06-09 | Seoul National University R&Db Foundation | Preparation of corrosion-protective copper paste through single process and application thereof to dipole tag antenna |
EP3327166A1 (en) * | 2016-11-24 | 2018-05-30 | Valeo Iluminacion | Method for creating a conductive track |
US20220372236A1 (en) * | 2019-10-08 | 2022-11-24 | Arkema France | Thermoplastic polymer composition for constructing 3d articles |
US11608541B2 (en) * | 2018-03-29 | 2023-03-21 | Baoshan Iron & Steel Co., Ltd. | Manufacturing method for high silicon grain oriented electrical steel sheet |
US11662300B2 (en) | 2019-09-19 | 2023-05-30 | Westinghouse Electric Company Llc | Apparatus for performing in-situ adhesion test of cold spray deposits and method of employing |
US11898986B2 (en) | 2012-10-10 | 2024-02-13 | Westinghouse Electric Company Llc | Systems and methods for steam generator tube analysis for detection of tube degradation |
US11935662B2 (en) | 2019-07-02 | 2024-03-19 | Westinghouse Electric Company Llc | Elongate SiC fuel elements |
Families Citing this family (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102014103025A1 (de) * | 2014-03-07 | 2015-09-10 | Ernst-Moritz-Arndt-Universität Greifswald | Verfahren zur Beschichtung eines Substrates, Verwendung des Substrats und Vorrichtung zur Beschichtung |
EP2998048A1 (de) * | 2014-09-17 | 2016-03-23 | Heraeus Deutschland GmbH & Co. KG | Metallsinterzubereitung und deren Verwendung zum Verbinden von Bauelementen |
JP6630047B2 (ja) * | 2015-02-27 | 2020-01-15 | 日立造船株式会社 | 溶射材料の製造方法、および、溶射方法 |
PL3078437T3 (pl) | 2015-04-09 | 2022-05-16 | Eckart Gmbh | Sposób wytwarzania odkształcanych plastycznie cząstek metalu |
CN104946950A (zh) * | 2015-06-10 | 2015-09-30 | 深圳市威勒达科技开发有限公司 | 一种钒钨合金靶材及其制备方法 |
CN104894449A (zh) * | 2015-06-10 | 2015-09-09 | 深圳市威勒达科技开发有限公司 | 一种钒钼合金靶材及其制备方法 |
WO2017207025A1 (de) | 2016-05-31 | 2017-12-07 | Eckart Gmbh | Verfahren zur herstellung von plastisch verformten metallpartikeln |
DE102016122394A1 (de) * | 2016-11-21 | 2018-05-24 | Woco Industrietechnik Gmbh | Bauteil umfassend zumindest ein Kunststoffmaterial, Komponenten mit einem solchen Bauteil und Verfahren zur Verbesserung der Widerstandsfähigkeit eines solchen Bauteils |
KR20190070735A (ko) * | 2017-12-13 | 2019-06-21 | 엘티메탈 주식회사 | 용사법을 이용한 전기 접점재료의 제조방법 및 이로부터 제조된 전기 접점재료 |
CN113002022B (zh) * | 2021-03-25 | 2022-03-08 | 南京工程学院 | 一种纤维增强树脂基复合材料修复方法 |
CN114032490B (zh) * | 2021-09-30 | 2023-11-24 | 福建省宁德恒茂节能科技有限公司 | 一种aod炉汽化冷却锅炉高温防腐抗磨电弧喷涂粉芯丝材 |
CN116288121B (zh) * | 2023-02-09 | 2024-09-10 | 佛山市骏昌隆新材料有限公司 | 热电偶表面防腐工艺 |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3471310A (en) * | 1965-05-24 | 1969-10-07 | Eutectic Welding Alloys | Welding process and product |
US5233153A (en) * | 1992-01-10 | 1993-08-03 | Edo Corporation | Method of plasma spraying of polymer compositions onto a target surface |
US6089825A (en) * | 1998-12-18 | 2000-07-18 | United Technologies Corporation | Abradable seal having improved properties and method of producing seal |
US6800336B1 (en) * | 1999-10-30 | 2004-10-05 | Foernsel Peter | Method and device for plasma coating surfaces |
US20090202814A1 (en) * | 2005-03-13 | 2009-08-13 | Rene Jabado | Matrix and Layer System |
JP2010133021A (ja) * | 2008-10-31 | 2010-06-17 | Topy Ind Ltd | 溶射用粒子 |
Family Cites Families (63)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2071251A (en) | 1931-07-03 | 1937-02-16 | Du Pont | Fiber and method of producing it |
US2071250A (en) | 1931-07-03 | 1937-02-16 | Du Pont | Linear condensation polymers |
US2130523A (en) | 1935-01-02 | 1938-09-20 | Du Pont | Linear polyamides and their production |
US2130948A (en) | 1937-04-09 | 1938-09-20 | Du Pont | Synthetic fiber |
US2241322A (en) | 1938-09-30 | 1941-05-06 | Du Pont | Process for preparing polyamides from cyclic amides |
US2312966A (en) | 1940-04-01 | 1943-03-02 | Du Pont | Polymeric material |
US2512606A (en) | 1945-09-12 | 1950-06-27 | Du Pont | Polyamides and method for obtaining same |
NL99388C (enrdf_load_stackoverflow) | 1956-09-28 | |||
DE1300266B (de) | 1960-06-10 | 1969-07-31 | Bayer Ag | Verfahren zur Herstellung hochmolekularer, linearer Polycarbonate |
DE1495730B2 (de) | 1963-07-24 | 1971-03-18 | Farbenfabriken Bayer AG, 5090 Le verkusen | Verfahren zum herstellen thermoplastischer polykondensations produkte |
IL24111A (en) | 1964-08-24 | 1969-02-27 | Du Pont | Linear polyamides |
US3991240A (en) * | 1975-02-18 | 1976-11-09 | Metco, Inc. | Composite iron molybdenum boron flame spray powder |
DE2826925A1 (de) | 1978-06-20 | 1980-01-17 | Basf Ag | Witterungsbestaendige, schlagzaehe thermoplastische massen mit guter einfaerbbarkeit |
DE3227555A1 (de) | 1982-07-23 | 1984-01-26 | Basf Ag, 6700 Ludwigshafen | Thermoplastische formmasse |
CA1246295A (en) | 1982-12-23 | 1988-12-06 | Robert A. Clendinning | Aromatic amorphous thermoplastic terpolymers |
DE3330154A1 (de) | 1983-08-20 | 1985-03-07 | Basf Ag, 6700 Ludwigshafen | Verfahren zur herstellung von polyethern |
US4645716A (en) * | 1985-04-09 | 1987-02-24 | The Perkin-Elmer Corporation | Flame spray material |
CA1327769C (en) | 1986-06-20 | 1994-03-15 | Shoji Ikeda | Powder treating method and apparatus used therefor |
DE3726283A1 (de) | 1987-08-07 | 1989-02-16 | Basf Ag | Thermoplastische formmassen |
DE3816585A1 (de) | 1988-05-16 | 1989-11-23 | Thyssen Guss Ag | Vorrichtung zum plasmaspritzen |
US4872904A (en) | 1988-06-02 | 1989-10-10 | The Perkin-Elmer Corporation | Tungsten carbide powder and method of making for flame spraying |
DE8908954U1 (de) | 1989-06-03 | 1990-09-27 | Castolin S.A., Lausanne-St. Sulpice, Waadt/Vaud | Autogenes Flammspritzgerät zum Flammspritzen von pulverförmigen Werkstoffen bzw. Spritzpulver |
US5126205A (en) * | 1990-05-09 | 1992-06-30 | The Perkin-Elmer Corporation | Powder of plastic and treated mineral |
DE4041623A1 (de) | 1990-12-22 | 1992-06-25 | Osu Maschinenbau Gmbh | Duese fuer eine vorrichtung und ein verfahren zum hochgeschwindigkeitsflammenspritzen |
DE4134144C2 (de) * | 1991-10-16 | 1994-04-21 | Fraunhofer Ges Forschung | Karbidisches Spritzpulver |
US5385789A (en) * | 1993-09-15 | 1995-01-31 | Sulzer Plasma Technik, Inc. | Composite powders for thermal spray coating |
US5426003A (en) * | 1994-02-14 | 1995-06-20 | Westinghouse Electric Corporation | Method of forming a plasma sprayed interconnection layer on an electrode of an electrochemical cell |
DE19532412C2 (de) | 1995-09-01 | 1999-09-30 | Agrodyn Hochspannungstechnik G | Vorrichtung zur Oberflächen-Vorbehandlung von Werkstücken |
US5716422A (en) | 1996-03-25 | 1998-02-10 | Wilson Greatbatch Ltd. | Thermal spray deposited electrode component and method of manufacture |
JPH1060617A (ja) | 1996-08-22 | 1998-03-03 | Suruzaa Meteko Japan Kk | 高速フレーム溶射方法 |
DE19728629A1 (de) | 1997-07-04 | 1999-01-07 | Basf Ag | Thermoplastische Formmassen mit geringer Eigenfarbe |
DE19747386A1 (de) | 1997-10-27 | 1999-04-29 | Linde Ag | Verfahren zum thermischen Beschichten von Substratwerkstoffen |
DE19807086A1 (de) | 1998-02-20 | 1999-08-26 | Fraunhofer Ges Forschung | Verfahren zum Beschichten von Oberflächen eines Substrates, Vorrichtung zur Durchführung des Verfahrens, Schichtsystem sowie beschichtetes Substrat |
EP0939142A1 (en) * | 1998-02-27 | 1999-09-01 | Ticona GmbH | Thermal spray powder incorporating an oxidised polyarylene sulfide |
DE19856307C1 (de) | 1998-12-07 | 2000-01-13 | Bosch Gmbh Robert | Vorrichtung zur Erzeugung eines freien kalten Plasmastrahles |
EP1024222A3 (de) | 1999-01-27 | 2000-09-13 | eybl International AG | Verfahren zur Ausrüstung von textilen Substraten |
DE19955880A1 (de) | 1999-11-20 | 2001-05-23 | Henkel Kgaa | Plasmabeschichtung von Metallen bei Atmosphärendruck |
DE10046956C2 (de) * | 2000-09-21 | 2002-07-25 | Federal Mogul Burscheid Gmbh | Thermisch aufgetragene Beschichtung für Kolbenringe aus mechanisch legierten Pulvern |
JP3952252B2 (ja) * | 2001-01-25 | 2007-08-01 | 株式会社フジミインコーポレーテッド | 溶射用粉末およびそれを用いた高速フレーム溶射方法 |
DE10109087A1 (de) | 2001-02-24 | 2002-10-24 | Leoni Bordnetz Sys Gmbh & Co | Verfahren zum Herstellen eines Formbauteils mit einer integrierten Leiterbahn |
JP2006037238A (ja) * | 2001-03-08 | 2006-02-09 | Shin Etsu Chem Co Ltd | 溶射用球状粒子の製造方法 |
DE10116502B4 (de) | 2001-04-03 | 2004-02-19 | Viöl, Wolfgang, Prof. Dr. | Verfahren und Vorrichtung zur Ausbildung eines Plasmastrahls |
JP3543149B2 (ja) | 2001-09-03 | 2004-07-14 | 島津工業有限会社 | プラズマ溶射用のトーチヘッド |
AU2003239287B2 (en) | 2002-01-29 | 2007-11-29 | Ciba Specialty Chemicals Holding Inc. | Process for the production of strongly adherent coatings |
US7678428B2 (en) | 2002-04-12 | 2010-03-16 | Sulzer Metco Ag | Plasma spraying method |
US7179526B2 (en) | 2002-08-02 | 2007-02-20 | 3M Innovative Properties Company | Plasma spraying |
DE10320379A1 (de) | 2003-05-06 | 2004-12-02 | Leoni Ag | Elektrisch beheizbares Element und Verfahren zum Herstellen eines elektrisch beheizbaren Elements |
CH696811A5 (de) * | 2003-09-26 | 2007-12-14 | Michael Dvorak Dr Ing Dipl Phy | Verfahren zur Beschichtung einer Substratoberfläche unter Verwendung eines Plasmastrahles. |
US7799111B2 (en) * | 2005-03-28 | 2010-09-21 | Sulzer Metco Venture Llc | Thermal spray feedstock composition |
JP4719877B2 (ja) * | 2005-06-21 | 2011-07-06 | 国立大学法人豊橋技術科学大学 | マイクロ波プラズマトーチ及びマイクロ波プラズマ溶射装置 |
DE102005047688C5 (de) * | 2005-09-23 | 2008-09-18 | Siemens Ag | Kaltgasspritzverfahren |
EP1806183A1 (de) | 2006-01-10 | 2007-07-11 | Siemens Aktiengesellschaft | Düsenanordnung und Verfahren zum Kaltgasspritzen |
DE102006005775A1 (de) * | 2006-02-07 | 2007-08-09 | Forschungszentrum Jülich GmbH | Thermisches Spritzverfahren mit kolloidaler Suspension |
DE102006047103A1 (de) * | 2006-09-28 | 2008-04-03 | Siemens Ag | Pulver für Kaltgasspritzverfahren |
DE102006061435A1 (de) | 2006-12-23 | 2008-06-26 | Leoni Ag | Verfahren und Vorrichtung zum Aufspritzen insbesondere einer Leiterbahn, elektrisches Bauteil mit einer Leiterbahn sowie Dosiervorrichtung |
US7928338B2 (en) | 2007-02-02 | 2011-04-19 | Plasma Surgical Investments Ltd. | Plasma spraying device and method |
DE102007006820A1 (de) * | 2007-02-07 | 2008-08-14 | Eckart Gmbh & Co.Kg | Chemikalienbeständige Metalleffektpigmente, Verfahren zu deren Herstellung und Verwendung derselben |
JP2009235558A (ja) * | 2007-12-28 | 2009-10-15 | Tosoh Corp | 窒化アルミニウム溶射部材及びその製造方法 |
DE102008031843A1 (de) | 2008-07-05 | 2010-01-07 | Mtu Aero Engines Gmbh | Verfahren und Vorrichtung zum Kaltgasspritzen |
DE102008050184B4 (de) | 2008-10-01 | 2011-04-21 | Technische Universität Chemnitz | Verfahren und Vorrichtung zum Hochgeschwindigkeitsflammspritzen |
JP5146402B2 (ja) * | 2009-05-19 | 2013-02-20 | トヨタ自動車株式会社 | 炭素粒子含有被膜の成膜方法、伝熱部材、パワーモジュール、及び車両用インバータ |
DE102009037846A1 (de) * | 2009-08-18 | 2011-02-24 | Siemens Aktiengesellschaft | Partikelgefüllte Beschichtungen, Verfahren zur Herstellung und Verwendungen dazu |
CN103415644B (zh) * | 2011-03-16 | 2016-11-09 | 埃卡特有限公司 | 涂层以及用于涂层的方法和装置 |
-
2011
- 2011-07-25 DE DE102011052120A patent/DE102011052120A1/de not_active Withdrawn
-
2012
- 2012-07-25 EP EP12746062.4A patent/EP2737102A2/de not_active Withdrawn
- 2012-07-25 KR KR1020147004895A patent/KR20140068032A/ko not_active Withdrawn
- 2012-07-25 JP JP2014522091A patent/JP2014522913A/ja active Pending
- 2012-07-25 CN CN201280046397.7A patent/CN103827345B/zh active Active
- 2012-07-25 WO PCT/EP2012/064636 patent/WO2013014211A2/de active Application Filing
- 2012-07-25 US US14/234,833 patent/US20140342094A1/en not_active Abandoned
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3471310A (en) * | 1965-05-24 | 1969-10-07 | Eutectic Welding Alloys | Welding process and product |
US5233153A (en) * | 1992-01-10 | 1993-08-03 | Edo Corporation | Method of plasma spraying of polymer compositions onto a target surface |
US6089825A (en) * | 1998-12-18 | 2000-07-18 | United Technologies Corporation | Abradable seal having improved properties and method of producing seal |
US6800336B1 (en) * | 1999-10-30 | 2004-10-05 | Foernsel Peter | Method and device for plasma coating surfaces |
US20090202814A1 (en) * | 2005-03-13 | 2009-08-13 | Rene Jabado | Matrix and Layer System |
JP2010133021A (ja) * | 2008-10-31 | 2010-06-17 | Topy Ind Ltd | 溶射用粒子 |
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20140170410A1 (en) * | 2011-07-25 | 2014-06-19 | Eckart Gmbh | Method for Applying a Coating to a Substrate, Coating, and Use of Particles |
US20140241937A1 (en) * | 2011-07-25 | 2014-08-28 | Eckart Gmbh | Coating Method Using Special Powdered Coating Materials and Use of Such Coating Materials |
US9580787B2 (en) * | 2011-07-25 | 2017-02-28 | Eckart Gmbh | Coating method using special powdered coating materials and use of such coating materials |
US11898986B2 (en) | 2012-10-10 | 2024-02-13 | Westinghouse Electric Company Llc | Systems and methods for steam generator tube analysis for detection of tube degradation |
US20160160359A1 (en) * | 2013-11-18 | 2016-06-09 | Seoul National University R&Db Foundation | Preparation of corrosion-protective copper paste through single process and application thereof to dipole tag antenna |
US9945038B2 (en) * | 2013-11-18 | 2018-04-17 | Seoul National University R&Db Foundation | Preparation of corrosion-protective copper paste through single process and application thereof to dipole tag antenna |
EP3327166A1 (en) * | 2016-11-24 | 2018-05-30 | Valeo Iluminacion | Method for creating a conductive track |
US11608541B2 (en) * | 2018-03-29 | 2023-03-21 | Baoshan Iron & Steel Co., Ltd. | Manufacturing method for high silicon grain oriented electrical steel sheet |
US11935662B2 (en) | 2019-07-02 | 2024-03-19 | Westinghouse Electric Company Llc | Elongate SiC fuel elements |
US11662300B2 (en) | 2019-09-19 | 2023-05-30 | Westinghouse Electric Company Llc | Apparatus for performing in-situ adhesion test of cold spray deposits and method of employing |
US20220372236A1 (en) * | 2019-10-08 | 2022-11-24 | Arkema France | Thermoplastic polymer composition for constructing 3d articles |
US12319796B2 (en) * | 2019-10-08 | 2025-06-03 | Arkema France | Thermoplastic polymer composition for constructing 3D articles |
Also Published As
Publication number | Publication date |
---|---|
WO2013014211A3 (de) | 2013-06-13 |
EP2737102A2 (de) | 2014-06-04 |
JP2014522913A (ja) | 2014-09-08 |
KR20140068032A (ko) | 2014-06-05 |
DE102011052120A1 (de) | 2013-01-31 |
WO2013014211A2 (de) | 2013-01-31 |
CN103827345B (zh) | 2018-10-26 |
CN103827345A (zh) | 2014-05-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20140342094A1 (en) | Use of Specially Coated Powdered Coating Materials and Coating Methods Using Such Coating Materials | |
US20140230692A1 (en) | Methods for Substrate Coating and Use of Additive-Containing Powdered Coating Materials in Such Methods | |
US9580787B2 (en) | Coating method using special powdered coating materials and use of such coating materials | |
JP5888342B2 (ja) | コーティングのための方法及び装置、並びにコーティング | |
US20140170410A1 (en) | Method for Applying a Coating to a Substrate, Coating, and Use of Particles | |
JP4659061B2 (ja) | 触媒皮膜を有する基板 | |
EP2322685A1 (en) | Ceramic coatings and methods of making the same | |
JP2001234320A (ja) | 溶射粉末材、およびそれを使用した溶射方法並びに溶射皮膜 | |
JP2014522913A5 (enrdf_load_stackoverflow) | ||
JP2022529003A (ja) | 付加製造用途のための非熱プラズマグロー放電により作製された小粒子による官能化金属粉末 | |
WO2008068942A1 (ja) | ウォームスプレーコーティング方法とその粒子 | |
EP2419371B1 (en) | A process and apparatus for depositing nanostructured material onto a substrate material | |
DE102011052119A1 (de) | Verfahren zur Substratbeschichtung und Verwendung additivversehener, pulverförmiger Beschichtungsmaterialien in derartigen Verfahren | |
JP2019090063A (ja) | 複合めっき用めっき液、複合めっき物、および複合めっき用ポリオレフィン樹脂水性分散体 | |
TW201631213A (zh) | 用於生產含有顆粒的氣溶膠之方法 | |
JP2000087210A (ja) | 低酸化溶射皮膜を形成するためのプラズマ溶射方法 | |
JPS59130574A (ja) | ポリエ−テルケトン樹脂の粉体塗装方法 | |
Tapphorn et al. | Kinetic Metallization TM-Coating Development System | |
JP2007091777A (ja) | 型内塗装用塗料、型内塗装方法及び型内塗装製品 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: ECKART GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:HOFENER, SEBASTIAN;RUPPRECHT, MARKUS;WOLFRUM, CHRISTIAN;AND OTHERS;SIGNING DATES FROM 20140120 TO 20140127;REEL/FRAME:032648/0086 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |