US20130035328A1 - Antiviral compounds and methods - Google Patents
Antiviral compounds and methods Download PDFInfo
- Publication number
- US20130035328A1 US20130035328A1 US13/553,239 US201213553239A US2013035328A1 US 20130035328 A1 US20130035328 A1 US 20130035328A1 US 201213553239 A US201213553239 A US 201213553239A US 2013035328 A1 US2013035328 A1 US 2013035328A1
- Authority
- US
- United States
- Prior art keywords
- guanidine
- hydrogen
- phenyl
- cinnamoylguanidine
- virus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 221
- 238000000034 method Methods 0.000 title claims abstract description 60
- 230000000840 anti-viral effect Effects 0.000 title abstract description 44
- 241000700605 Viruses Species 0.000 claims description 98
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 claims description 71
- 241000711549 Hepacivirus C Species 0.000 claims description 63
- 239000001257 hydrogen Substances 0.000 claims description 62
- 229910052739 hydrogen Inorganic materials 0.000 claims description 62
- DMRPQMZUZKCGFD-VOTSOKGWSA-N (e)-n-(diaminomethylidene)-3-phenylprop-2-enamide Chemical compound NC(N)=NC(=O)\C=C\C1=CC=CC=C1 DMRPQMZUZKCGFD-VOTSOKGWSA-N 0.000 claims description 57
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 54
- 241000711573 Coronaviridae Species 0.000 claims description 47
- 229960002576 amiloride Drugs 0.000 claims description 43
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 43
- 241000725303 Human immunodeficiency virus Species 0.000 claims description 42
- RQQJJXVETXFINY-UHFFFAOYSA-N 5-(N,N-hexamethylene)amiloride Chemical compound N1=C(N)C(C(=O)N=C(N)N)=NC(Cl)=C1N1CCCCCC1 RQQJJXVETXFINY-UHFFFAOYSA-N 0.000 claims description 38
- 241000710803 Equine arteritis virus Species 0.000 claims description 38
- 208000015181 infectious disease Diseases 0.000 claims description 38
- -1 C1-6alkyloxy Chemical group 0.000 claims description 37
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 claims description 37
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 claims description 36
- 230000010076 replication Effects 0.000 claims description 36
- 230000012010 growth Effects 0.000 claims description 32
- 150000002431 hydrogen Chemical class 0.000 claims description 29
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 claims description 27
- 241000711493 Porcine respiratory coronavirus Species 0.000 claims description 26
- 241000315672 SARS coronavirus Species 0.000 claims description 23
- XSDQTOBWRPYKKA-UHFFFAOYSA-N amiloride Chemical compound NC(=N)NC(=O)C1=NC(Cl)=C(N)N=C1N XSDQTOBWRPYKKA-UHFFFAOYSA-N 0.000 claims description 23
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical group [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 claims description 21
- 125000001475 halogen functional group Chemical group 0.000 claims description 21
- FAJIOICCLPXHDD-UHFFFAOYSA-N n-(diaminomethylidene)-6-methoxynaphthalene-2-carboxamide Chemical compound C1=C(C(=O)NC(N)=N)C=CC2=CC(OC)=CC=C21 FAJIOICCLPXHDD-UHFFFAOYSA-N 0.000 claims description 21
- ORHXTMBRQJROCY-UHFFFAOYSA-N 3-(3-bromophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(Br)=C1 ORHXTMBRQJROCY-UHFFFAOYSA-N 0.000 claims description 20
- 241000711467 Human coronavirus 229E Species 0.000 claims description 20
- 241001428935 Human coronavirus OC43 Species 0.000 claims description 19
- FYOXCRMHHBYILR-UHFFFAOYSA-N n-(diaminomethylidene)-5-phenylpenta-2,4-dienamide Chemical compound NC(=N)NC(=O)C=CC=CC1=CC=CC=C1 FYOXCRMHHBYILR-UHFFFAOYSA-N 0.000 claims description 18
- DHUGRAINHFHLBE-UHFFFAOYSA-N n-(diaminomethylidene)-4-phenylbenzamide Chemical compound C1=CC(C(=O)NC(=N)N)=CC=C1C1=CC=CC=C1 DHUGRAINHFHLBE-UHFFFAOYSA-N 0.000 claims description 17
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims description 16
- 241000713666 Lentivirus Species 0.000 claims description 16
- 125000004356 hydroxy functional group Chemical group O* 0.000 claims description 15
- 230000002401 inhibitory effect Effects 0.000 claims description 15
- OBEJPGOVZUDGAY-UHFFFAOYSA-N n-[amino(anilino)methylidene]-3-phenylpropanamide Chemical compound C=1C=CC=CC=1NC(=N)NC(=O)CCC1=CC=CC=C1 OBEJPGOVZUDGAY-UHFFFAOYSA-N 0.000 claims description 15
- HVVFWRLIARMUOV-UHFFFAOYSA-N 3-(2-chlorophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1Cl HVVFWRLIARMUOV-UHFFFAOYSA-N 0.000 claims description 14
- PZNOJKMDUBWCBQ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-methylphenyl)prop-2-enamide Chemical compound CC1=CC=CC(C=CC(=O)N=C(N)N)=C1 PZNOJKMDUBWCBQ-UHFFFAOYSA-N 0.000 claims description 14
- 125000003118 aryl group Chemical group 0.000 claims description 13
- DKJONGCRYHKAGI-UHFFFAOYSA-N n-(diaminomethylidene)-3-[3-(trifluoromethyl)phenyl]prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(C(F)(F)F)=C1 DKJONGCRYHKAGI-UHFFFAOYSA-N 0.000 claims description 13
- BCDKGQNGEDRCKI-UHFFFAOYSA-N n-(diaminomethylidene)quinoline-2-carboxamide Chemical compound C1=CC=CC2=NC(C(=O)NC(=N)N)=CC=C21 BCDKGQNGEDRCKI-UHFFFAOYSA-N 0.000 claims description 13
- ZLHBIWZXHDEOFT-UHFFFAOYSA-N 3-(2-tert-butylphenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound CC(C)(C)C1=CC=CC=C1C=CC(=O)N=C(N)N ZLHBIWZXHDEOFT-UHFFFAOYSA-N 0.000 claims description 12
- FIZKBCWWZMXZHL-UHFFFAOYSA-N 3-(3-chlorophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(Cl)=C1 FIZKBCWWZMXZHL-UHFFFAOYSA-N 0.000 claims description 12
- IIORGOGWQSVXAU-UHFFFAOYSA-N 3-(4-bromophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(Br)C=C1 IIORGOGWQSVXAU-UHFFFAOYSA-N 0.000 claims description 12
- 125000003107 substituted aryl group Chemical group 0.000 claims description 12
- OKOXJPLBLDXQNV-DTWKUNHWSA-N (1r,2r)-n-(diaminomethylidene)-2-phenylcyclopropane-1-carboxamide Chemical compound NC(=N)NC(=O)[C@@H]1C[C@H]1C1=CC=CC=C1 OKOXJPLBLDXQNV-DTWKUNHWSA-N 0.000 claims description 11
- PFKYZWUGTMREHT-UHFFFAOYSA-N 3-(2-bromophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1Br PFKYZWUGTMREHT-UHFFFAOYSA-N 0.000 claims description 11
- ZJRXLZFDGGZHTC-UHFFFAOYSA-N 3-(4-chlorophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(Cl)C=C1 ZJRXLZFDGGZHTC-UHFFFAOYSA-N 0.000 claims description 11
- IIUPTHVVXMBJMQ-UHFFFAOYSA-N 3-amino-6-chloro-n-(diaminomethylidene)-5-(dimethylamino)pyrazine-2-carboxamide;hydrochloride Chemical compound Cl.CN(C)C1=NC(N)=C(C(=O)N=C(N)N)N=C1Cl IIUPTHVVXMBJMQ-UHFFFAOYSA-N 0.000 claims description 11
- QDERNBXNXJCIQK-UHFFFAOYSA-N ethylisopropylamiloride Chemical compound CCN(C(C)C)C1=NC(N)=C(C(=O)N=C(N)N)N=C1Cl QDERNBXNXJCIQK-UHFFFAOYSA-N 0.000 claims description 11
- YSPHLCIYDPAMTC-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-methoxyphenyl)prop-2-enamide Chemical compound COC1=CC=CC=C1C=CC(=O)N=C(N)N YSPHLCIYDPAMTC-UHFFFAOYSA-N 0.000 claims description 11
- YJJRJCGALAGVMY-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3,4-dichlorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(Cl)C(Cl)=C1 YJJRJCGALAGVMY-UHFFFAOYSA-N 0.000 claims description 11
- FVBMZBLBBKLKTN-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-methoxyphenyl)prop-2-enamide Chemical compound COC1=CC=CC(C=CC(=O)N=C(N)N)=C1 FVBMZBLBBKLKTN-UHFFFAOYSA-N 0.000 claims description 11
- DXFJUUOQFIHODP-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-hydroxyphenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(O)C=C1 DXFJUUOQFIHODP-UHFFFAOYSA-N 0.000 claims description 11
- PISVGNWQIULYBS-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-propan-2-ylphenyl)prop-2-enamide Chemical compound CC(C)C1=CC=C(C=CC(=O)N=C(N)N)C=C1 PISVGNWQIULYBS-UHFFFAOYSA-N 0.000 claims description 11
- VDYFICUZUMSCMU-UHFFFAOYSA-N n-(diaminomethylidene)-4-phenoxybenzamide Chemical compound C1=CC(C(=O)NC(=N)N)=CC=C1OC1=CC=CC=C1 VDYFICUZUMSCMU-UHFFFAOYSA-N 0.000 claims description 11
- LTGYAZVREDUARQ-UHFFFAOYSA-N 3-(2-cyclohexylphenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1C1CCCCC1 LTGYAZVREDUARQ-UHFFFAOYSA-N 0.000 claims description 10
- RVIUMPLAOXSSGN-UHFFFAOYSA-N 3-amino-6-chloro-n-(diaminomethylidene)-5-[methyl(2-methylpropyl)amino]pyrazine-2-carboxamide Chemical compound CC(C)CN(C)C1=NC(N)=C(C(=O)N=C(N)N)N=C1Cl RVIUMPLAOXSSGN-UHFFFAOYSA-N 0.000 claims description 10
- WJOUCPOCQUVRJW-UHFFFAOYSA-N 3-phenyl-n-[n-phenyl-n'-(3-phenylpropanoyl)carbamimidoyl]propanamide Chemical compound C=1C=CC=CC=1CCC(=O)NC(=NC=1C=CC=CC=1)NC(=O)CCC1=CC=CC=C1 WJOUCPOCQUVRJW-UHFFFAOYSA-N 0.000 claims description 10
- KXDROGADUISDGY-UHFFFAOYSA-N Benzamil hydrochloride Chemical compound C=1C=CC=CC=1CN=C(N)NC(=O)C1=NC(Cl)=C(N)N=C1N KXDROGADUISDGY-UHFFFAOYSA-N 0.000 claims description 10
- JBLYNJINPOWRFG-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,5-dimethylphenyl)prop-2-enamide Chemical compound CC1=CC=C(C)C(C=CC(=O)N=C(N)N)=C1 JBLYNJINPOWRFG-UHFFFAOYSA-N 0.000 claims description 10
- LNOGCEAJDCCGSB-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,6-dichlorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=C(Cl)C=CC=C1Cl LNOGCEAJDCCGSB-UHFFFAOYSA-N 0.000 claims description 10
- OLALSUPQCJAGAU-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-fluorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(F)=C1 OLALSUPQCJAGAU-UHFFFAOYSA-N 0.000 claims description 10
- IIQICEWHWURYDB-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-methoxyphenyl)prop-2-enamide Chemical compound COC1=CC=C(C=CC(=O)N=C(N)N)C=C1 IIQICEWHWURYDB-UHFFFAOYSA-N 0.000 claims description 10
- RXEFMYMSKWTKRU-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-methylphenyl)prop-2-enamide Chemical compound CC1=CC=C(C=CC(=O)N=C(N)N)C=C1 RXEFMYMSKWTKRU-UHFFFAOYSA-N 0.000 claims description 10
- AIUWTTOLGFMCEE-UHFFFAOYSA-N n-(diaminomethylidene)-3-phenylprop-2-enamide;hydrochloride Chemical compound Cl.NC(N)=NC(=O)C=CC1=CC=CC=C1 AIUWTTOLGFMCEE-UHFFFAOYSA-N 0.000 claims description 10
- VDBNVLGNOVEOPB-UHFFFAOYSA-N n-(diaminomethylidene)-3-phenylpropanamide Chemical compound NC(=N)NC(=O)CCC1=CC=CC=C1 VDBNVLGNOVEOPB-UHFFFAOYSA-N 0.000 claims description 10
- 238000011321 prophylaxis Methods 0.000 claims description 10
- 230000000979 retarding effect Effects 0.000 claims description 10
- 150000003839 salts Chemical class 0.000 claims description 10
- HRKGSHPEYGOZHJ-UHFFFAOYSA-N 3-(3-tert-butylphenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound CC(C)(C)C1=CC=CC(C=CC(=O)N=C(N)N)=C1 HRKGSHPEYGOZHJ-UHFFFAOYSA-N 0.000 claims description 9
- AORSRQOKSFUBQU-UHFFFAOYSA-N 3-(5-bromo-2-fluorophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC(Br)=CC=C1F AORSRQOKSFUBQU-UHFFFAOYSA-N 0.000 claims description 9
- IZTOMICYUSXUFV-UHFFFAOYSA-N 3-(5-bromo-2-methoxyphenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound COC1=CC=C(Br)C=C1C=CC(=O)N=C(N)N IZTOMICYUSXUFV-UHFFFAOYSA-N 0.000 claims description 9
- WYZGHFCGQGCOPZ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,3-dimethylphenyl)prop-2-enamide Chemical compound CC1=CC=CC(C=CC(=O)N=C(N)N)=C1C WYZGHFCGQGCOPZ-UHFFFAOYSA-N 0.000 claims description 9
- QKUJGONOHHSOQJ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-ethoxyphenyl)prop-2-enamide Chemical compound CCOC1=CC=CC=C1C=CC(=O)N=C(N)N QKUJGONOHHSOQJ-UHFFFAOYSA-N 0.000 claims description 9
- HYBPCGHPOGXYLO-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-ethylphenyl)prop-2-enamide Chemical compound CCC1=CC=CC=C1C=CC(=O)N=C(N)N HYBPCGHPOGXYLO-UHFFFAOYSA-N 0.000 claims description 9
- MMVUASXGHTWYSF-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-methylphenyl)prop-2-enamide Chemical compound CC1=CC=CC=C1C=CC(=O)N=C(N)N MMVUASXGHTWYSF-UHFFFAOYSA-N 0.000 claims description 9
- WGRUSZZJGBKVDU-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3,4,5-trimethoxyphenyl)prop-2-enamide Chemical compound COC1=CC(C=CC(=O)N=C(N)N)=CC(OC)=C1OC WGRUSZZJGBKVDU-UHFFFAOYSA-N 0.000 claims description 9
- IPGOWJWLSZFUMA-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3,4-difluorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(F)C(F)=C1 IPGOWJWLSZFUMA-UHFFFAOYSA-N 0.000 claims description 9
- JRSLBEIEBBOHCW-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-ethoxyphenyl)prop-2-enamide Chemical compound CCOC1=CC=CC(C=CC(=O)N=C(N)N)=C1 JRSLBEIEBBOHCW-UHFFFAOYSA-N 0.000 claims description 9
- MHTGKDXWKXQUAQ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-nitrophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC([N+]([O-])=O)=C1 MHTGKDXWKXQUAQ-UHFFFAOYSA-N 0.000 claims description 9
- DRIQBBXJVJVPGI-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-phenylphenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(C=2C=CC=CC=2)=C1 DRIQBBXJVJVPGI-UHFFFAOYSA-N 0.000 claims description 9
- HOAZIGOPBVUULO-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-ethoxyphenyl)prop-2-enamide Chemical compound CCOC1=CC=C(C=CC(=O)N=C(N)N)C=C1 HOAZIGOPBVUULO-UHFFFAOYSA-N 0.000 claims description 9
- VCBGPXCHKPPINZ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-fluorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(F)C=C1 VCBGPXCHKPPINZ-UHFFFAOYSA-N 0.000 claims description 9
- ZAYDWNACZRBICF-UHFFFAOYSA-N n-(diaminomethylidene)-3-[3-(trifluoromethoxy)phenyl]prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(OC(F)(F)F)=C1 ZAYDWNACZRBICF-UHFFFAOYSA-N 0.000 claims description 9
- KZMIUYQOZTVXRV-UHFFFAOYSA-N n-(diaminomethylidene)-3-[4-(trifluoromethyl)phenyl]prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(C(F)(F)F)C=C1 KZMIUYQOZTVXRV-UHFFFAOYSA-N 0.000 claims description 9
- WTQIOSFOBLCCFK-UHFFFAOYSA-N n-[amino(anilino)methylidene]-3-phenylprop-2-enamide Chemical compound C=1C=CC=CC=1C=CC(=O)N=C(N)NC1=CC=CC=C1 WTQIOSFOBLCCFK-UHFFFAOYSA-N 0.000 claims description 9
- PCEORBLTWJVJHN-UHFFFAOYSA-N n-[amino-(3-phenylprop-2-enoylamino)methylidene]benzamide Chemical compound C=1C=CC=CC=1C(=O)N=C(N)NC(=O)C=CC1=CC=CC=C1 PCEORBLTWJVJHN-UHFFFAOYSA-N 0.000 claims description 9
- 230000001225 therapeutic effect Effects 0.000 claims description 9
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 8
- FKXYVYMLZGVJIM-UHFFFAOYSA-N 3,5-diamino-n-(diaminomethylidene)-6-iodopyrazine-2-carboxamide Chemical compound NC(N)=NC(=O)C1=NC(I)=C(N)N=C1N FKXYVYMLZGVJIM-UHFFFAOYSA-N 0.000 claims description 8
- MYIAILVVWSAAHT-UHFFFAOYSA-N 3-(4-tert-butylphenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound CC(C)(C)C1=CC=C(C=CC(=O)N=C(N)N)C=C1 MYIAILVVWSAAHT-UHFFFAOYSA-N 0.000 claims description 8
- IBFSKNNSMJANAC-UHFFFAOYSA-N 3-[3-(cyclohexen-1-yl)phenyl]-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(C=2CCCCC=2)=C1 IBFSKNNSMJANAC-UHFFFAOYSA-N 0.000 claims description 8
- UCXHYERTWMEXOK-UHFFFAOYSA-N 3-phenyl-n-[n'-(3-phenylpropanoyl)carbamimidoyl]propanamide Chemical compound C=1C=CC=CC=1CCC(=O)NC(=N)NC(=O)CCC1=CC=CC=C1 UCXHYERTWMEXOK-UHFFFAOYSA-N 0.000 claims description 8
- BAANTXNFSRCMCP-UHFFFAOYSA-N 5-(3-bromophenyl)-n-(diaminomethylidene)penta-2,4-dienamide Chemical compound NC(=N)NC(=O)C=CC=CC1=CC=CC(Br)=C1 BAANTXNFSRCMCP-UHFFFAOYSA-N 0.000 claims description 8
- 241000283690 Bos taurus Species 0.000 claims description 8
- ORAVVJNVOXLQIT-UHFFFAOYSA-N n-(diaminomethylidene)-2-phenylacetamide Chemical compound NC(=N)NC(=O)CC1=CC=CC=C1 ORAVVJNVOXLQIT-UHFFFAOYSA-N 0.000 claims description 8
- CHKULGQCBATXKS-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,4,6-trimethylphenyl)prop-2-enamide Chemical compound CC1=CC(C)=C(C=CC(=O)N=C(N)N)C(C)=C1 CHKULGQCBATXKS-UHFFFAOYSA-N 0.000 claims description 8
- FGLKXTSTMPDAMW-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-fluorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1F FGLKXTSTMPDAMW-UHFFFAOYSA-N 0.000 claims description 8
- MASFCCGAEYGKRN-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-phenylphenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1C1=CC=CC=C1 MASFCCGAEYGKRN-UHFFFAOYSA-N 0.000 claims description 8
- UGJNJXYDMZXDLY-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-phenylphenyl)prop-2-enamide Chemical compound C1=CC(C=CC(=O)N=C(N)N)=CC=C1C1=CC=CC=C1 UGJNJXYDMZXDLY-UHFFFAOYSA-N 0.000 claims description 8
- ZAPVDFDIPMJGRX-UHFFFAOYSA-N n-(diaminomethylidene)-3-[2-(trifluoromethyl)phenyl]prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1C(F)(F)F ZAPVDFDIPMJGRX-UHFFFAOYSA-N 0.000 claims description 8
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- OPGLKSXECNCJHX-UHFFFAOYSA-N 3-phenyl-n-[n-phenyl-n'-(3-phenylprop-2-enoyl)carbamimidoyl]prop-2-enamide Chemical compound C=1C=CC=CC=1C=CC(=O)NC(=NC(=O)C=CC=1C=CC=CC=1)NC1=CC=CC=C1 OPGLKSXECNCJHX-UHFFFAOYSA-N 0.000 claims description 7
- SAXKBLLZHUBONF-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-propan-2-ylphenyl)prop-2-enamide;hydrochloride Chemical compound Cl.CC(C)C1=CC=CC(C=CC(=O)N=C(N)N)=C1 SAXKBLLZHUBONF-UHFFFAOYSA-N 0.000 claims description 7
- FMKRDNDKDWJOFK-UHFFFAOYSA-N n-(diaminomethylidene)-3-(furan-2-yl)prop-2-enamide Chemical compound NC(=N)NC(=O)C=CC1=CC=CO1 FMKRDNDKDWJOFK-UHFFFAOYSA-N 0.000 claims description 7
- RNJYBXUVPPUWLN-DLPFSFTESA-N n-(diaminomethylidene)-3-[3-[(e)-hept-1-enyl]phenyl]prop-2-enamide Chemical compound CCCCC\C=C\C1=CC=CC(C=CC(=O)N=C(N)N)=C1 RNJYBXUVPPUWLN-DLPFSFTESA-N 0.000 claims description 7
- OLXNOYLRZRHHKP-UHFFFAOYSA-N n-(diaminomethylidene)-3-pyridin-3-ylprop-2-enamide Chemical compound NC(=N)NC(=O)C=CC1=CC=CN=C1 OLXNOYLRZRHHKP-UHFFFAOYSA-N 0.000 claims description 7
- 229960005206 pyrazinamide Drugs 0.000 claims description 7
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 claims description 6
- DVIHQDDVFWZYQL-CMDGGOBGSA-N (e)-n-(diaminomethylidene)-3-[4-(dimethylamino)phenyl]-2-methylprop-2-enamide Chemical compound CN(C)C1=CC=C(\C=C(/C)C(=O)NC(N)=N)C=C1 DVIHQDDVFWZYQL-CMDGGOBGSA-N 0.000 claims description 6
- AJOKNWFEJJNBCY-UHFFFAOYSA-N 3-(2-chloro-6-fluorophenyl)-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=C(F)C=CC=C1Cl AJOKNWFEJJNBCY-UHFFFAOYSA-N 0.000 claims description 6
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 claims description 6
- 125000005605 benzo group Chemical group 0.000 claims description 6
- LCRHPQDZNWNTDJ-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2-nitrophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1[N+]([O-])=O LCRHPQDZNWNTDJ-UHFFFAOYSA-N 0.000 claims description 6
- MHPIZTURFVSLTJ-UHFFFAOYSA-N 3,5-diamino-n-[amino(anilino)methylidene]-6-chloropyrazine-2-carboxamide;methanesulfonic acid Chemical compound CS(O)(=O)=O.N=1C(Cl)=C(N)N=C(N)C=1C(=O)N=C(N)NC1=CC=CC=C1 MHPIZTURFVSLTJ-UHFFFAOYSA-N 0.000 claims description 5
- PBNYRUZGPCPHMQ-UHFFFAOYSA-N 3-amino-6-chloro-n-(diaminomethylidene)-5-phenylpyrazine-2-carboxamide Chemical compound N1=C(N)C(C(=O)NC(=N)N)=NC(Cl)=C1C1=CC=CC=C1 PBNYRUZGPCPHMQ-UHFFFAOYSA-N 0.000 claims description 5
- OECMIBNCPUMKFU-UHFFFAOYSA-N n-(diaminomethylidene)naphthalene-2-carboxamide Chemical compound C1=CC=CC2=CC(C(=O)N=C(N)N)=CC=C21 OECMIBNCPUMKFU-UHFFFAOYSA-N 0.000 claims description 5
- GAOPLAYGZREQBS-UHFFFAOYSA-N n-[amino(anilino)methylidene]-6-hydroxynaphthalene-2-carboxamide Chemical compound C1=CC2=CC(O)=CC=C2C=C1C(=O)NC(=N)NC1=CC=CC=C1 GAOPLAYGZREQBS-UHFFFAOYSA-N 0.000 claims description 5
- ALCCFQJJLCFYEK-CMDGGOBGSA-N (e)-n-(diaminomethylidene)-3-naphthalen-1-ylprop-2-enamide Chemical compound C1=CC=C2C(/C=C/C(=O)NC(=N)N)=CC=CC2=C1 ALCCFQJJLCFYEK-CMDGGOBGSA-N 0.000 claims description 4
- JDOUMVFXQGCGRI-UHFFFAOYSA-N 2-n,6-n-bis(diaminomethylidene)naphthalene-2,6-dicarboxamide Chemical compound C1=C(C(=O)NC(N)=N)C=CC2=CC(C(=O)NC(=N)N)=CC=C21 JDOUMVFXQGCGRI-UHFFFAOYSA-N 0.000 claims description 4
- 239000003443 antiviral agent Substances 0.000 claims description 4
- APOPAXUENTVHHC-UHFFFAOYSA-N n-(diaminomethylidene)naphthalene-1-carboxamide Chemical compound C1=CC=C2C(C(=O)NC(=N)N)=CC=CC2=C1 APOPAXUENTVHHC-UHFFFAOYSA-N 0.000 claims description 4
- PQZIOEUUUCRAFA-UHFFFAOYSA-N n-(dianilinomethylidene)-3-phenylprop-2-enamide Chemical compound C=1C=CC=CC=1NC(NC=1C=CC=CC=1)=NC(=O)C=CC1=CC=CC=C1 PQZIOEUUUCRAFA-UHFFFAOYSA-N 0.000 claims description 4
- GAFVWCXCRDVUQZ-UHFFFAOYSA-N n-[amino(anilino)methylidene]naphthalene-2-carboxamide Chemical compound C=1C=C2C=CC=CC2=CC=1C(=O)NC(=N)NC1=CC=CC=C1 GAFVWCXCRDVUQZ-UHFFFAOYSA-N 0.000 claims description 4
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 claims description 4
- FZQFBWIJFXWWFO-UHFFFAOYSA-N 1-bromo-n-(diaminomethylidene)naphthalene-2-carboxamide Chemical compound C1=CC=CC2=C(Br)C(C(=O)N=C(N)N)=CC=C21 FZQFBWIJFXWWFO-UHFFFAOYSA-N 0.000 claims description 3
- DLNOQRGQJYTFNZ-UHFFFAOYSA-N 3-amino-5-(azepan-1-yl)-n-(diaminomethylidene)-6-phenylpyrazine-2-carboxamide Chemical compound C1CCCCCN1C=1N=C(N)C(C(=O)N=C(N)N)=NC=1C1=CC=CC=C1 DLNOQRGQJYTFNZ-UHFFFAOYSA-N 0.000 claims description 3
- GUSUDQLCQAYCDU-UHFFFAOYSA-N 5-(2-bromophenyl)-n-(diaminomethylidene)penta-2,4-dienamide Chemical compound NC(=N)NC(=O)C=CC=CC1=CC=CC=C1Br GUSUDQLCQAYCDU-UHFFFAOYSA-N 0.000 claims description 3
- RNBDGEPPWFXJKE-UHFFFAOYSA-N 6-bromo-n-(diaminomethylidene)naphthalene-2-carboxamide Chemical compound C1=C(Br)C=CC2=CC(C(=O)NC(=N)N)=CC=C21 RNBDGEPPWFXJKE-UHFFFAOYSA-N 0.000 claims description 3
- 239000000969 carrier Substances 0.000 claims description 3
- LKKDZBGWPNQPOP-UHFFFAOYSA-N n-(diaminomethylidene)-2-naphthalen-1-ylacetamide Chemical compound C1=CC=C2C(CC(=O)NC(=N)N)=CC=CC2=C1 LKKDZBGWPNQPOP-UHFFFAOYSA-N 0.000 claims description 3
- DFHWZOGNQXSCSX-UHFFFAOYSA-N n-[amino(dimethylamino)methylidene]-3-phenylprop-2-enamide Chemical compound CN(C)C(N)=NC(=O)C=CC1=CC=CC=C1 DFHWZOGNQXSCSX-UHFFFAOYSA-N 0.000 claims description 3
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 claims 16
- 125000003236 benzoyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C(*)=O 0.000 claims 12
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims 12
- 125000000217 alkyl group Chemical group 0.000 claims 4
- AUQMQBNHIQLGRP-UHFFFAOYSA-N n-(diaminomethylidene)-2-naphthalen-2-ylacetamide Chemical compound C1=CC=CC2=CC(CC(=O)NC(=N)N)=CC=C21 AUQMQBNHIQLGRP-UHFFFAOYSA-N 0.000 claims 2
- NCAPVVSGOJRHLA-UHFFFAOYSA-N n-(diaminomethylidene)-3-naphthalen-2-ylprop-2-enamide Chemical compound C1=CC=CC2=CC(C=CC(=O)NC(=N)N)=CC=C21 NCAPVVSGOJRHLA-UHFFFAOYSA-N 0.000 claims 2
- 208000036142 Viral infection Diseases 0.000 abstract description 14
- 230000009385 viral infection Effects 0.000 abstract description 14
- 108090000862 Ion Channels Proteins 0.000 description 137
- 102000004310 Ion Channels Human genes 0.000 description 137
- 210000004027 cell Anatomy 0.000 description 117
- 230000000694 effects Effects 0.000 description 105
- 101710204837 Envelope small membrane protein Proteins 0.000 description 77
- 101710145006 Lysis protein Proteins 0.000 description 77
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 76
- 239000000243 solution Substances 0.000 description 71
- 108091006146 Channels Proteins 0.000 description 70
- 230000001580 bacterial effect Effects 0.000 description 61
- 108090000765 processed proteins & peptides Proteins 0.000 description 53
- 241000711466 Murine hepatitis virus Species 0.000 description 48
- 238000002474 experimental method Methods 0.000 description 46
- 239000012528 membrane Substances 0.000 description 46
- 108090000623 proteins and genes Proteins 0.000 description 42
- 239000000203 mixture Substances 0.000 description 41
- 238000003556 assay Methods 0.000 description 40
- 102000004169 proteins and genes Human genes 0.000 description 40
- 239000011780 sodium chloride Substances 0.000 description 38
- 230000005764 inhibitory process Effects 0.000 description 35
- 229960004198 guanidine Drugs 0.000 description 34
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 33
- 239000003814 drug Substances 0.000 description 30
- 229940079593 drug Drugs 0.000 description 29
- 101000667983 Severe acute respiratory syndrome coronavirus Envelope small membrane protein Proteins 0.000 description 28
- 239000000232 Lipid Bilayer Substances 0.000 description 27
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 26
- 238000004166 bioassay Methods 0.000 description 26
- 241000711443 Bovine coronavirus Species 0.000 description 25
- UWICDWBEVIDNNJ-UHFFFAOYSA-N n-(diaminomethylidene)prop-2-enamide Chemical compound NC(=N)NC(=O)C=C UWICDWBEVIDNNJ-UHFFFAOYSA-N 0.000 description 25
- 230000003612 virological effect Effects 0.000 description 25
- 241001465754 Metazoa Species 0.000 description 24
- 241000588724 Escherichia coli Species 0.000 description 23
- 241000282414 Homo sapiens Species 0.000 description 22
- 230000015572 biosynthetic process Effects 0.000 description 22
- 150000002632 lipids Chemical class 0.000 description 22
- 238000002832 anti-viral assay Methods 0.000 description 21
- 239000002904 solvent Substances 0.000 description 21
- 230000014509 gene expression Effects 0.000 description 20
- 229910001415 sodium ion Inorganic materials 0.000 description 19
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 18
- 229910052757 nitrogen Inorganic materials 0.000 description 18
- 238000012360 testing method Methods 0.000 description 17
- 230000005714 functional activity Effects 0.000 description 16
- 230000009467 reduction Effects 0.000 description 16
- 238000012216 screening Methods 0.000 description 16
- 238000011282 treatment Methods 0.000 description 16
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 15
- 239000000499 gel Substances 0.000 description 15
- 229920000936 Agarose Polymers 0.000 description 13
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 13
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 13
- 230000006870 function Effects 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- 238000003786 synthesis reaction Methods 0.000 description 13
- 230000029812 viral genome replication Effects 0.000 description 13
- 108020004635 Complementary DNA Proteins 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 12
- 208000031886 HIV Infections Diseases 0.000 description 12
- 150000001413 amino acids Chemical group 0.000 description 12
- 239000000872 buffer Substances 0.000 description 12
- 150000002500 ions Chemical class 0.000 description 12
- 230000036961 partial effect Effects 0.000 description 12
- 238000002360 preparation method Methods 0.000 description 12
- 230000000875 corresponding effect Effects 0.000 description 11
- 241000288906 Primates Species 0.000 description 10
- RHQDFWAXVIIEBN-UHFFFAOYSA-N Trifluoroethanol Chemical compound OCC(F)(F)F RHQDFWAXVIIEBN-UHFFFAOYSA-N 0.000 description 10
- 0 [1*]C(=O)N/C(=N/[3*])N([2*])[4*] Chemical compound [1*]C(=O)N/C(=N/[3*])N([2*])[4*] 0.000 description 10
- 239000012634 fragment Substances 0.000 description 10
- 239000013641 positive control Substances 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 241000283073 Equus caballus Species 0.000 description 9
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 9
- 108700026244 Open Reading Frames Proteins 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- QRJZGVVKGFIGLI-UHFFFAOYSA-N 2-phenylguanidine Chemical compound NC(=N)NC1=CC=CC=C1 QRJZGVVKGFIGLI-UHFFFAOYSA-N 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 108010021611 acetyl-phenylalanyl-threonyl-leucyl-aspartyl-alanyl-aspartyl-phenylalanine Proteins 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- NGFWDHLKIUYSIP-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,3-difluorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC(F)=C1F NGFWDHLKIUYSIP-UHFFFAOYSA-N 0.000 description 8
- YVELSDDXFCIBLA-UHFFFAOYSA-N 3,5-diamino-N-[amino-[(2,4-dichlorophenyl)methylimino]methyl]-6-chloro-2-pyrazinecarboxamide Chemical compound C=1C=C(Cl)C=C(Cl)C=1CN=C(N)NC(=O)C1=NC(Cl)=C(N)N=C1N YVELSDDXFCIBLA-UHFFFAOYSA-N 0.000 description 7
- RXMUPNVSYKGKMY-UHFFFAOYSA-N 3-amino-6-chloro-n-(diaminomethylidene)-5-(dimethylamino)pyrazine-2-carboxamide Chemical compound CN(C)C1=NC(N)=C(C(=O)N=C(N)N)N=C1Cl RXMUPNVSYKGKMY-UHFFFAOYSA-N 0.000 description 7
- 229930024421 Adenine Natural products 0.000 description 7
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 7
- ANLYGLLAXHQIHH-UHFFFAOYSA-N CN(CC(=O)N=C(N)N)C(C)(C)C Chemical compound CN(CC(=O)N=C(N)N)C(C)(C)C ANLYGLLAXHQIHH-UHFFFAOYSA-N 0.000 description 7
- 206010012310 Dengue fever Diseases 0.000 description 7
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 7
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 7
- 229910019142 PO4 Inorganic materials 0.000 description 7
- 229960000643 adenine Drugs 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 239000012228 culture supernatant Substances 0.000 description 7
- 208000025729 dengue disease Diseases 0.000 description 7
- 108020001507 fusion proteins Proteins 0.000 description 7
- 102000037865 fusion proteins Human genes 0.000 description 7
- 229930182817 methionine Natural products 0.000 description 7
- 231100000331 toxic Toxicity 0.000 description 7
- 230000002588 toxic effect Effects 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- AXAVXPMQTGXXJZ-UHFFFAOYSA-N 2-aminoacetic acid;2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound NCC(O)=O.OCC(N)(CO)CO AXAVXPMQTGXXJZ-UHFFFAOYSA-N 0.000 description 6
- LKDIXLLGSXLUIQ-UHFFFAOYSA-N 3-[2-(cyclohexen-1-yl)phenyl]-n-(diaminomethylidene)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=CC=C1C1=CCCCC1 LKDIXLLGSXLUIQ-UHFFFAOYSA-N 0.000 description 6
- HDLCOUHHKHFAFU-UHFFFAOYSA-N CC(C)(C)C(=O)N=C(N)N.CC(C)(C)OC1=CC=CC=C1 Chemical compound CC(C)(C)C(=O)N=C(N)N.CC(C)(C)OC1=CC=CC=C1 HDLCOUHHKHFAFU-UHFFFAOYSA-N 0.000 description 6
- 101710205625 Capsid protein p24 Proteins 0.000 description 6
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 6
- 208000001490 Dengue Diseases 0.000 description 6
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 6
- 239000007995 HEPES buffer Substances 0.000 description 6
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 6
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 6
- NIOHELZQFBGCEO-UHFFFAOYSA-N Phenylamil Chemical compound N=1C(Cl)=C(N)N=C(N)C=1C(=O)N=C(N)NC1=CC=CC=C1 NIOHELZQFBGCEO-UHFFFAOYSA-N 0.000 description 6
- 101710177166 Phosphoprotein Proteins 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- 101710149279 Small delta antigen Proteins 0.000 description 6
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 6
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 6
- 102100022563 Tubulin polymerization-promoting protein Human genes 0.000 description 6
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 6
- 230000037396 body weight Effects 0.000 description 6
- 150000001768 cations Chemical class 0.000 description 6
- 230000010261 cell growth Effects 0.000 description 6
- 230000008878 coupling Effects 0.000 description 6
- 238000010168 coupling process Methods 0.000 description 6
- 238000005859 coupling reaction Methods 0.000 description 6
- 239000003599 detergent Substances 0.000 description 6
- 238000001962 electrophoresis Methods 0.000 description 6
- 239000013613 expression plasmid Substances 0.000 description 6
- 239000013642 negative control Substances 0.000 description 6
- 238000010647 peptide synthesis reaction Methods 0.000 description 6
- 239000010452 phosphate Substances 0.000 description 6
- 229910001414 potassium ion Inorganic materials 0.000 description 6
- 239000011734 sodium Substances 0.000 description 6
- 229910052708 sodium Inorganic materials 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 5
- YKYVOITWGMQTJW-XTZDZABFSA-N CC(C)(C)C.CC(C)(C)C(=O)/C=C/C1=CC=CC=C1.CC(C)(C)C(=O)C1=CC2=C(C=CC=C2)C=C1.CC(C)(C)C(=O)C1=CC=CC2=C1C=CC=C2.CC(C)(C)C(=O)C1=CC=CC=C1.CC(C)(C)C(=O)CCC1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC1=C(C)C(C)=C(CC(C)(C)C)C=C1 Chemical compound CC(C)(C)C.CC(C)(C)C(=O)/C=C/C1=CC=CC=C1.CC(C)(C)C(=O)C1=CC2=C(C=CC=C2)C=C1.CC(C)(C)C(=O)C1=CC=CC2=C1C=CC=C2.CC(C)(C)C(=O)C1=CC=CC=C1.CC(C)(C)C(=O)CCC1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC1=C(C)C(C)=C(CC(C)(C)C)C=C1 YKYVOITWGMQTJW-XTZDZABFSA-N 0.000 description 5
- 241000700199 Cavia porcellus Species 0.000 description 5
- 241000282994 Cervidae Species 0.000 description 5
- 241000699800 Cricetinae Species 0.000 description 5
- 241000283074 Equus asinus Species 0.000 description 5
- 241000282326 Felis catus Species 0.000 description 5
- 208000037357 HIV infectious disease Diseases 0.000 description 5
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 241001494479 Pecora Species 0.000 description 5
- 241000577979 Peromyscus spicilegus Species 0.000 description 5
- 241000282898 Sus scrofa Species 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 239000000284 extract Substances 0.000 description 5
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 238000009533 lab test Methods 0.000 description 5
- 244000144972 livestock Species 0.000 description 5
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 5
- 230000000241 respiratory effect Effects 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 238000003756 stirring Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- 229920001817 Agar Polymers 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 229920004943 Delrin® Polymers 0.000 description 4
- 101710177291 Gag polyprotein Proteins 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 101710125418 Major capsid protein Proteins 0.000 description 4
- 101710085938 Matrix protein Proteins 0.000 description 4
- 101710127721 Membrane protein Proteins 0.000 description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 238000001042 affinity chromatography Methods 0.000 description 4
- 239000008272 agar Substances 0.000 description 4
- 150000001450 anions Chemical class 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 230000034303 cell budding Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000002596 correlated effect Effects 0.000 description 4
- DIOQZVSQGTUSAI-UHFFFAOYSA-N decane Chemical compound CCCCCCCCCC DIOQZVSQGTUSAI-UHFFFAOYSA-N 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 239000012737 fresh medium Substances 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 238000004128 high performance liquid chromatography Methods 0.000 description 4
- 230000001524 infective effect Effects 0.000 description 4
- 239000002054 inoculum Substances 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 4
- 210000001616 monocyte Anatomy 0.000 description 4
- HXITXNWTGFUOAU-UHFFFAOYSA-N phenylboronic acid Chemical compound OB(O)C1=CC=CC=C1 HXITXNWTGFUOAU-UHFFFAOYSA-N 0.000 description 4
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 4
- IPEHBUMCGVEMRF-UHFFFAOYSA-N pyrazinecarboxamide Chemical compound NC(=O)C1=CN=CC=N1 IPEHBUMCGVEMRF-UHFFFAOYSA-N 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000012266 salt solution Substances 0.000 description 4
- 239000000741 silica gel Substances 0.000 description 4
- 229910002027 silica gel Inorganic materials 0.000 description 4
- 229910052709 silver Inorganic materials 0.000 description 4
- 239000004332 silver Substances 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 230000032258 transport Effects 0.000 description 4
- 230000017613 viral reproduction Effects 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- JMTMSDXUXJISAY-UHFFFAOYSA-N 2H-benzotriazol-4-ol Chemical compound OC1=CC=CC2=C1N=NN2 JMTMSDXUXJISAY-UHFFFAOYSA-N 0.000 description 3
- OSHKWEFWXCCNJR-UHFFFAOYSA-N 3,5-diamino-N-[amino-[(3,4-dichlorophenyl)methylimino]methyl]-6-chloro-2-pyrazinecarboxamide Chemical compound C=1C=C(Cl)C(Cl)=CC=1CN=C(N)NC(=O)C1=NC(Cl)=C(N)N=C1N OSHKWEFWXCCNJR-UHFFFAOYSA-N 0.000 description 3
- TVRPKYLCKXYMIX-UHFFFAOYSA-N 3,5-diamino-n-(diaminomethylidene)-6-phenylpyrazine-2-carboxamide Chemical compound N1=C(N)C(C(=O)NC(=N)N)=NC(C=2C=CC=CC=2)=C1N TVRPKYLCKXYMIX-UHFFFAOYSA-N 0.000 description 3
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 3
- 208000030507 AIDS Diseases 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 3
- 241000725619 Dengue virus Species 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 244000309467 Human Coronavirus Species 0.000 description 3
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 238000003646 Spearman's rank correlation coefficient Methods 0.000 description 3
- 108090000190 Thrombin Proteins 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 150000001408 amides Chemical group 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 3
- 239000001110 calcium chloride Substances 0.000 description 3
- 229910001628 calcium chloride Inorganic materials 0.000 description 3
- 239000004202 carbamide Substances 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 230000000120 cytopathologic effect Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 230000002222 downregulating effect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 3
- 239000000706 filtrate Substances 0.000 description 3
- 239000012467 final product Substances 0.000 description 3
- 229960000789 guanidine hydrochloride Drugs 0.000 description 3
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 3
- 235000019341 magnesium sulphate Nutrition 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- UFSJJMVCFQLTKW-UHFFFAOYSA-N n-(diaminomethylidene)-3-(2,4-dichlorophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C(Cl)C=C1Cl UFSJJMVCFQLTKW-UHFFFAOYSA-N 0.000 description 3
- DGSSRZZIDUQFRA-UHFFFAOYSA-N n-(diaminomethylidene)-3-(4-nitrophenyl)prop-2-enamide Chemical compound NC(N)=NC(=O)C=CC1=CC=C([N+]([O-])=O)C=C1 DGSSRZZIDUQFRA-UHFFFAOYSA-N 0.000 description 3
- AJDQRQQNNLZLPM-UHFFFAOYSA-N n-(diaminomethylidene)benzamide Chemical compound NC(N)=NC(=O)C1=CC=CC=C1 AJDQRQQNNLZLPM-UHFFFAOYSA-N 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229920002401 polyacrylamide Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 3
- 229960004072 thrombin Drugs 0.000 description 3
- 210000003501 vero cell Anatomy 0.000 description 3
- 210000002845 virion Anatomy 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- FMKRDNDKDWJOFK-ONEGZZNKSA-N (e)-n-(diaminomethylidene)-3-(furan-2-yl)prop-2-enamide Chemical compound NC(=N)NC(=O)\C=C\C1=CC=CO1 FMKRDNDKDWJOFK-ONEGZZNKSA-N 0.000 description 2
- HHGWXTUPFOMTBX-UHFFFAOYSA-N 2-(4-chlorophenoxy)-n-(diaminomethylidene)acetamide Chemical compound NC(=N)NC(=O)COC1=CC=C(Cl)C=C1 HHGWXTUPFOMTBX-UHFFFAOYSA-N 0.000 description 2
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 2
- 241000167854 Bourreria succulenta Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 101800001415 Bri23 peptide Proteins 0.000 description 2
- 102400000107 C-terminal peptide Human genes 0.000 description 2
- 101800000655 C-terminal peptide Proteins 0.000 description 2
- PKZXJGUQHGKSAE-QQGUIPNUSA-N C.C.C.C.C.C.C.C.C.C.C.C.C.C.C1=CC2=C(C=C1)C=CC=C2.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1CC1C1=CC=CC=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC(C)(C)CCC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1.CC1=NC(C)=C(C)N=C1C.CC=C(C)C Chemical compound C.C.C.C.C.C.C.C.C.C.C.C.C.C.C1=CC2=C(C=C1)C=CC=C2.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1CC1C1=CC=CC=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC(C)(C)CCC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1.CC1=NC(C)=C(C)N=C1C.CC=C(C)C PKZXJGUQHGKSAE-QQGUIPNUSA-N 0.000 description 2
- RFWLWGIZMXKATL-BQYQJAHWSA-N C/C(=C\C1=CC=CC=C1)C(=O)NC(=N)N Chemical compound C/C(=C\C1=CC=CC=C1)C(=O)NC(=N)N RFWLWGIZMXKATL-BQYQJAHWSA-N 0.000 description 2
- BUGBFZNZJXLHKN-UHFFFAOYSA-N CC(C)(C)NC1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 Chemical compound CC(C)(C)NC1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 BUGBFZNZJXLHKN-UHFFFAOYSA-N 0.000 description 2
- FINHMKGKINIASC-UHFFFAOYSA-N CC1=NC(C)=C(C)N=C1C Chemical compound CC1=NC(C)=C(C)N=C1C FINHMKGKINIASC-UHFFFAOYSA-N 0.000 description 2
- 229920002261 Corn starch Polymers 0.000 description 2
- 241000710827 Dengue virus 1 Species 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000711475 Feline infectious peritonitis virus Species 0.000 description 2
- 241000710831 Flavivirus Species 0.000 description 2
- 101150066516 GST gene Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 239000007987 MES buffer Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 102000016943 Muramidase Human genes 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- BAANTXNFSRCMCP-BQJQTIKASA-N N=C(N)NC(=O)/C=C/C=C/C1=CC=CC(Br)=C1 Chemical compound N=C(N)NC(=O)/C=C/C=C/C1=CC=CC(Br)=C1 BAANTXNFSRCMCP-BQJQTIKASA-N 0.000 description 2
- FYOXCRMHHBYILR-KBXRYBNXSA-N NC(N)=NC(=O)/C=C/C=C/C1=CC=CC=C1 Chemical compound NC(N)=NC(=O)/C=C/C=C/C1=CC=CC=C1 FYOXCRMHHBYILR-KBXRYBNXSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 230000010757 Reduction Activity Effects 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 102000018674 Sodium Channels Human genes 0.000 description 2
- 108010052164 Sodium Channels Proteins 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- BRQFIORUNWWNBM-UHFFFAOYSA-N [2-(benzylamino)cyclohexyl]methanol Chemical compound OCC1CCCCC1NCC1=CC=CC=C1 BRQFIORUNWWNBM-UHFFFAOYSA-N 0.000 description 2
- JBLYNJINPOWRFG-AATRIKPKSA-N [H]/C(=C\C1=CC(C)=CC=C1C)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC(C)=CC=C1C)C(=O)NC(=N)N JBLYNJINPOWRFG-AATRIKPKSA-N 0.000 description 2
- RXEFMYMSKWTKRU-VOTSOKGWSA-N [H]/C(=C\C1=CC=C(C)C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(C)C=C1)C(=O)NC(=N)N RXEFMYMSKWTKRU-VOTSOKGWSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000011149 active material Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- ACHKKGDWZVCSNH-UHFFFAOYSA-N amiloride hydrochloride Chemical compound Cl.NC(N)=NC(=O)C1=NC(Cl)=C(N)N=C1N ACHKKGDWZVCSNH-UHFFFAOYSA-N 0.000 description 2
- 229960004104 amiloride hydrochloride Drugs 0.000 description 2
- 238000005571 anion exchange chromatography Methods 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000002882 anti-plaque Effects 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 238000003287 bathing Methods 0.000 description 2
- 235000019693 cherries Nutrition 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 239000008120 corn starch Substances 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 2
- 238000009795 derivation Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 125000004836 hexamethylene group Chemical group [H]C([H])([*:2])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[*:1] 0.000 description 2
- 244000052637 human pathogen Species 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 239000002198 insoluble material Substances 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 210000005228 liver tissue Anatomy 0.000 description 2
- 239000012160 loading buffer Substances 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- QQALIOHMNFPVQU-UHFFFAOYSA-N methyl 3-amino-5-(azepan-1-yl)-6-chloropyrazine-2-carboxylate Chemical compound N1=C(N)C(C(=O)OC)=NC(Cl)=C1N1CCCCCC1 QQALIOHMNFPVQU-UHFFFAOYSA-N 0.000 description 2
- WSKZJWNLXWZAMH-UHFFFAOYSA-N methyl 3-amino-6-chloro-5-phenylpyrazine-2-carboxylate Chemical compound N1=C(N)C(C(=O)OC)=NC(Cl)=C1C1=CC=CC=C1 WSKZJWNLXWZAMH-UHFFFAOYSA-N 0.000 description 2
- CXKWCBBOMKCUKX-UHFFFAOYSA-M methylene blue Chemical compound [Cl-].C1=CC(N(C)C)=CC2=[S+]C3=CC(N(C)C)=CC=C3N=C21 CXKWCBBOMKCUKX-UHFFFAOYSA-M 0.000 description 2
- 229960000907 methylthioninium chloride Drugs 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 210000004980 monocyte derived macrophage Anatomy 0.000 description 2
- RUGVTHDTDHARRE-UHFFFAOYSA-N n-(diaminomethylidene)-3-(3-propan-2-ylphenyl)prop-2-enamide Chemical compound CC(C)C1=CC=CC(C=CC(=O)N=C(N)N)=C1 RUGVTHDTDHARRE-UHFFFAOYSA-N 0.000 description 2
- LAJYPQZULXFTFW-UHFFFAOYSA-N n-[n'-(naphthalene-1-carbonyl)carbamimidoyl]naphthalene-1-carboxamide Chemical compound C1=CC=C2C(C(=O)NC(NC(=O)C=3C4=CC=CC=C4C=CC=3)=N)=CC=CC2=C1 LAJYPQZULXFTFW-UHFFFAOYSA-N 0.000 description 2
- WDRHVXPVAUFWHJ-UHFFFAOYSA-N n-[n'-(naphthalene-2-carbonyl)-n-phenylcarbamimidoyl]naphthalene-2-carboxamide Chemical compound C=1C=C2C=CC=CC2=CC=1C(=O)NC(NC(=O)C=1C=C2C=CC=CC2=CC=1)=NC1=CC=CC=C1 WDRHVXPVAUFWHJ-UHFFFAOYSA-N 0.000 description 2
- MFCJIEIGERRXNO-UHFFFAOYSA-N n-[n'-(naphthalene-2-carbonyl)carbamimidoyl]naphthalene-2-carboxamide Chemical compound C1=CC=CC2=CC(C(=O)NC(NC(=O)C=3C=C4C=CC=CC4=CC=3)=N)=CC=C21 MFCJIEIGERRXNO-UHFFFAOYSA-N 0.000 description 2
- 201000009240 nasopharyngitis Diseases 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 2
- NFHFRUOZVGFOOS-UHFFFAOYSA-N palladium;triphenylphosphane Chemical compound [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 230000007505 plaque formation Effects 0.000 description 2
- 238000002962 plaque-reduction assay Methods 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 2
- 239000008057 potassium phosphate buffer Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 108010030416 proteoliposomes Proteins 0.000 description 2
- 239000002356 single layer Substances 0.000 description 2
- 238000000528 statistical test Methods 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- WOGITNXCNOTRLK-VOTSOKGWSA-N (e)-3-phenylprop-2-enoyl chloride Chemical compound ClC(=O)\C=C\C1=CC=CC=C1 WOGITNXCNOTRLK-VOTSOKGWSA-N 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 1
- LINDOXZENKYESA-UHFFFAOYSA-N 1,2-dimethylguanidine Chemical compound CNC(N)=NC LINDOXZENKYESA-UHFFFAOYSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- UBCHPRBFMUDMNC-UHFFFAOYSA-N 1-(1-adamantyl)ethanamine Chemical compound C1C(C2)CC3CC2CC1(C(N)C)C3 UBCHPRBFMUDMNC-UHFFFAOYSA-N 0.000 description 1
- CDIYCDUENCHDFC-UHFFFAOYSA-N 1-(3-amino-1,5,2,4-dioxadiazin-2-yl)-3-phenylprop-2-en-1-one Chemical compound NC1=NOCON1C(=O)C=CC1=CC=CC=C1 CDIYCDUENCHDFC-UHFFFAOYSA-N 0.000 description 1
- KWISWUFGPUHDRY-UHFFFAOYSA-N 1-Chloro-2-methylpropene Chemical compound CC(C)=CCl KWISWUFGPUHDRY-UHFFFAOYSA-N 0.000 description 1
- FOUAVNQNUCBBBG-UHFFFAOYSA-N 2-(3-amino-6-chloro-5-phenylpyrazin-2-yl)-N-(diaminomethylidene)acetamide Chemical compound C(N)(=N)NC(=O)CC1=NC(=C(N=C1N)C1=CC=CC=C1)Cl FOUAVNQNUCBBBG-UHFFFAOYSA-N 0.000 description 1
- VUFNLQXQSDUXKB-DOFZRALJSA-N 2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]ethyl (5z,8z,11z,14z)-icosa-5,8,11,14-tetraenoate Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)OCCOC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 VUFNLQXQSDUXKB-DOFZRALJSA-N 0.000 description 1
- 125000002391 4-chlorocinnamoyl group Chemical group 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- 102000041092 ABC transporter family Human genes 0.000 description 1
- 108091060858 ABC transporter family Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000633903 Avian infectious bronchitis virus (strain DE072) Species 0.000 description 1
- 241001428958 Avian infectious bronchitis virus (strain GRAY) Species 0.000 description 1
- 241000600136 Avian infectious bronchitis virus (strain H120) Species 0.000 description 1
- 241000600135 Avian infectious bronchitis virus (strain H52) Species 0.000 description 1
- 241000711445 Avian infectious bronchitis virus (strain KB8523) Species 0.000 description 1
- 241000711444 Avian infectious bronchitis virus (strain M41) Species 0.000 description 1
- 241001428956 Avian infectious bronchitis virus (strain PORTUGAL/322/82) Species 0.000 description 1
- 241000600134 Avian infectious bronchitis virus (strain SAIB20) Species 0.000 description 1
- 241001428951 Avian infectious bronchitis virus (strain UK/123/82) Species 0.000 description 1
- 241001428948 Avian infectious bronchitis virus (strain UK/142/86) Species 0.000 description 1
- 241001428945 Avian infectious bronchitis virus (strain UK/167/84) Species 0.000 description 1
- 241001428943 Avian infectious bronchitis virus (strain UK/183/66) Species 0.000 description 1
- 241001428937 Avian infectious bronchitis virus (strain UK/68/84) Species 0.000 description 1
- 241000600133 Avian infectious bronchitis virus (strain V18/91) Species 0.000 description 1
- 241000600132 Avian infectious bronchitis virus (strain Vic S) Species 0.000 description 1
- 241000633897 Bovine enteric coronavirus (strain 98TXSF-110-ENT) Species 0.000 description 1
- HAZLNAGTVBFZOR-UHFFFAOYSA-N C(C=CC1=CC=CC=C1)(=O)NC(=N)N(C)C.N1=C(C=NC=C1)C(=O)N Chemical compound C(C=CC1=CC=CC=C1)(=O)NC(=N)N(C)C.N1=C(C=NC=C1)C(=O)N HAZLNAGTVBFZOR-UHFFFAOYSA-N 0.000 description 1
- ZXNCNGFQHAGXFM-LQTMIHEZSA-N C.C.C.C.C.C.C.C.C.C.C.C.C.C.C/C(=C\C1=CC=CC2=C1C=CC=C2)C(C)(C)C.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1 Chemical compound C.C.C.C.C.C.C.C.C.C.C.C.C.C.C/C(=C\C1=CC=CC2=C1C=CC=C2)C(C)(C)C.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1 ZXNCNGFQHAGXFM-LQTMIHEZSA-N 0.000 description 1
- GIDCCKWQEGWRJO-NGRWPUITSA-N C.C.CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 Chemical compound C.C.CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 GIDCCKWQEGWRJO-NGRWPUITSA-N 0.000 description 1
- SEZYEQGRQJJQKK-VFXQKGTBSA-N C.C1=CC2=C(C=C1)C=CC=C2.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1CC1C1=CC=CC=C1.CC(C)(C)CC1=CC=CC=C1.CC(C)(C)CCC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1.CC1=NC(C)=C(C)N=C1C.CCC(C)C Chemical compound C.C1=CC2=C(C=C1)C=CC=C2.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)C1CC1C1=CC=CC=C1.CC(C)(C)CC1=CC=CC=C1.CC(C)(C)CCC1=CC=CC=C1.CC(C)=CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1.CC1=NC(C)=C(C)N=C1C.CCC(C)C SEZYEQGRQJJQKK-VFXQKGTBSA-N 0.000 description 1
- KDMDPAZVHASOAH-HWWUXOKASA-N C.CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 Chemical compound C.CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 KDMDPAZVHASOAH-HWWUXOKASA-N 0.000 description 1
- DXPGXRPFYKJDMP-CALJPSDSSA-N C.N=C(NC(=O)/C=C/C1=CC=CC=C1)NC1=CC=CC=C1 Chemical compound C.N=C(NC(=O)/C=C/C1=CC=CC=C1)NC1=CC=CC=C1 DXPGXRPFYKJDMP-CALJPSDSSA-N 0.000 description 1
- CNCVNPNLPMABPN-VOTSOKGWSA-N C/C(/C(NC(N)=N)=O)=C\c1ccccc1Br Chemical compound C/C(/C(NC(N)=N)=O)=C\c1ccccc1Br CNCVNPNLPMABPN-VOTSOKGWSA-N 0.000 description 1
- VTOMNJMWNCOVAO-FAEQGSSZSA-N C/C(=C\C1=CC=CC2=C1C=CC=C2)C(C)(C)C.C/C(=C\C1=CC=CC=C1)C(C)(C)C.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1 Chemical compound C/C(=C\C1=CC=CC2=C1C=CC=C2)C(C)(C)C.C/C(=C\C1=CC=CC=C1)C(C)(C)C.CC.CC(C)(C)/C=C/C1=CC=CC=C1.CC(C)(C)/C=C/C1=CC=CN=C1.CC(C)(C)/C=C/C=C/C1=CC=CC=C1.CC(C)(C)C1=CC=CC=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21.CC(C)(C)CC1=CC=CC=C1.CC1=CC(C)=C(C)C=C1/C=C(\C)C(C)(C)C.CC1=CC2=C(C=C1)C(C)=C(C(C)(C)C)C=C2.CC1=CC=C(/C=C/C=C/C(C)(C)C)C(C)=C1.CC1=CC=C(OCC(C)(C)C)C=C1 VTOMNJMWNCOVAO-FAEQGSSZSA-N 0.000 description 1
- BVPXXHINERMXOZ-UHFFFAOYSA-N C1(=CC=CC=C1)C1=CC=C(C(=O)NC(=N)N)C=C1.N1=C(C=NC=C1)C(=O)N Chemical compound C1(=CC=CC=C1)C1=CC=C(C(=O)NC(=N)N)C=C1.N1=C(C=NC=C1)C(=O)N BVPXXHINERMXOZ-UHFFFAOYSA-N 0.000 description 1
- HQJFREDLTATVBH-UHFFFAOYSA-N C1CCCNCC1.C1CCOC1.COC(=O)C1=NC(Cl)=C(Cl)N=C1N.COC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1N Chemical compound C1CCCNCC1.C1CCOC1.COC(=O)C1=NC(Cl)=C(Cl)N=C1N.COC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1N HQJFREDLTATVBH-UHFFFAOYSA-N 0.000 description 1
- CEMCPFIRPCOSNS-UHDJGPCESA-N C=O.[H]/C(=C\C1=CC=C(C)C=C1)C(=O)NC(=N)N Chemical compound C=O.[H]/C(=C\C1=CC=C(C)C=C1)C(=O)NC(=N)N CEMCPFIRPCOSNS-UHDJGPCESA-N 0.000 description 1
- OIUTYVKMKGCXOJ-OZHLEFMZSA-N CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21 Chemical compound CC(C)(C)/C=C/C1=COC=C1.CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1.CC(C)(C)CC1=CC2=CC=CC=C2C=C1.CC(C)(C)CC1=CC=CC2=CC=CC=C21 OIUTYVKMKGCXOJ-OZHLEFMZSA-N 0.000 description 1
- HLECJTBRJDANCJ-UHFFFAOYSA-N CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 Chemical compound CC(C)(C)C1=CC2=C(C=CC=C2)N=C1.CC(C)(C)C1=NC2=C(C=CC=C2)C=C1 HLECJTBRJDANCJ-UHFFFAOYSA-N 0.000 description 1
- SDXYCAORSPSYGZ-UHFFFAOYSA-N CCN(CC)C1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 Chemical compound CCN(CC)C1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 SDXYCAORSPSYGZ-UHFFFAOYSA-N 0.000 description 1
- 108010041397 CD4 Antigens Proteins 0.000 description 1
- DFHWZOGNQXSCSX-CMDGGOBGSA-N CN(C)C(=N)NC(=O)/C=C/C1=CC=CC=C1 Chemical compound CN(C)C(=N)NC(=O)/C=C/C1=CC=CC=C1 DFHWZOGNQXSCSX-CMDGGOBGSA-N 0.000 description 1
- VSUYKQQWJDURAI-UHFFFAOYSA-N CN(CC(=O)N=C(N)N)C1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 Chemical compound CN(CC(=O)N=C(N)N)C1=C(Cl)N=C(C(=O)N=C(N)N)C(N)=N1 VSUYKQQWJDURAI-UHFFFAOYSA-N 0.000 description 1
- LCMBTTKHOIVDKM-UHFFFAOYSA-N CN/C(N)=N/C(=O)C1=NC(Cl)=C(N)N=C1N Chemical compound CN/C(N)=N/C(=O)C1=NC(Cl)=C(N)N=C1N LCMBTTKHOIVDKM-UHFFFAOYSA-N 0.000 description 1
- HYCWBOJNEJSWEV-UHFFFAOYSA-N COC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N.COC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1N.OC(O)C1=CC=CC=C1 Chemical compound COC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N.COC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1N.OC(O)C1=CC=CC=C1 HYCWBOJNEJSWEV-UHFFFAOYSA-N 0.000 description 1
- LNZOSVXKGWVXKR-UHFFFAOYSA-N COC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N.N=C(N)NC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N Chemical compound COC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N.N=C(N)NC(=O)C1=NC(C2=CC=CC=C2)=C(N2CCCCCC2)N=C1N LNZOSVXKGWVXKR-UHFFFAOYSA-N 0.000 description 1
- QFVONLDGKIQGNS-UHFFFAOYSA-N COC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N.COC(=O)C1=NC(Cl)=C(Cl)N=C1N.OB(O)C1=CC=CC=C1 Chemical compound COC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N.COC(=O)C1=NC(Cl)=C(Cl)N=C1N.OB(O)C1=CC=CC=C1 QFVONLDGKIQGNS-UHFFFAOYSA-N 0.000 description 1
- ZAZOMYQLMJDGGI-UHFFFAOYSA-N COC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N.N=C(N)OC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N Chemical compound COC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N.N=C(N)OC(=O)C1=NC(Cl)=C(C2=CC=CC=C2)N=C1N ZAZOMYQLMJDGGI-UHFFFAOYSA-N 0.000 description 1
- USYMCUGEGUFUBI-UHFFFAOYSA-N COC(c(nc1Cl)c(N)nc1Cl)=O Chemical compound COC(c(nc1Cl)c(N)nc1Cl)=O USYMCUGEGUFUBI-UHFFFAOYSA-N 0.000 description 1
- YSPHLCIYDPAMTC-VOTSOKGWSA-N COC1=C(/C=C/C(=O)NC(=N)N)C=CC=C1 Chemical compound COC1=C(/C=C/C(=O)NC(=N)N)C=CC=C1 YSPHLCIYDPAMTC-VOTSOKGWSA-N 0.000 description 1
- FVBMZBLBBKLKTN-AATRIKPKSA-N COC1=CC(/C=C/C(=O)NC(=N)N)=CC=C1 Chemical compound COC1=CC(/C=C/C(=O)NC(=N)N)=CC=C1 FVBMZBLBBKLKTN-AATRIKPKSA-N 0.000 description 1
- IIQICEWHWURYDB-QPJJXVBHSA-N COC1=CC=C(/C=C/C(=O)NC(=N)N)C=C1 Chemical compound COC1=CC=C(/C=C/C(=O)NC(=N)N)C=C1 IIQICEWHWURYDB-QPJJXVBHSA-N 0.000 description 1
- UODZGMQTHUPSTP-UHFFFAOYSA-N COC1=NC(N)=C(Cl)N=C1C(=O)N=C(N)N Chemical compound COC1=NC(N)=C(Cl)N=C1C(=O)N=C(N)N UODZGMQTHUPSTP-UHFFFAOYSA-N 0.000 description 1
- RSNYLKUQQDELBD-UHFFFAOYSA-N COC1=NC(N2CCCCCC2)=C(Cl)N=C1C(=O)N=C(N)N Chemical compound COC1=NC(N2CCCCCC2)=C(Cl)N=C1C(=O)N=C(N)N RSNYLKUQQDELBD-UHFFFAOYSA-N 0.000 description 1
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 1
- 241001594994 Canine respiratory coronavirus Species 0.000 description 1
- 241000334972 Chicken enteric coronavirus Species 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- VWFCHDSQECPREK-LURJTMIESA-N Cidofovir Chemical compound NC=1C=CN(C[C@@H](CO)OCP(O)(O)=O)C(=O)N=1 VWFCHDSQECPREK-LURJTMIESA-N 0.000 description 1
- RUGVTHDTDHARRE-VOTSOKGWSA-N Cl.[H]/C(=C\C1=CC=CC(C(C)C)=C1)C(=O)NC(=N)N Chemical compound Cl.[H]/C(=C\C1=CC=CC(C(C)C)=C1)C(=O)NC(=N)N RUGVTHDTDHARRE-VOTSOKGWSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 241001135557 Enteric coronavirus Species 0.000 description 1
- 241001166747 Equine coronavirus NC99 Species 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 241000701063 Gallid alphaherpesvirus 1 Species 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 101710088172 HTH-type transcriptional regulator RipA Proteins 0.000 description 1
- 108700029057 Hepatitis C virus p7 Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010083687 Ion Pumps Proteins 0.000 description 1
- 102000006391 Ion Pumps Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108090000301 Membrane transport proteins Proteins 0.000 description 1
- 102000003939 Membrane transport proteins Human genes 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 102100035971 Molybdopterin molybdenumtransferase Human genes 0.000 description 1
- 101710119577 Molybdopterin molybdenumtransferase Proteins 0.000 description 1
- 241000544665 Murine hepatitis virus strain ML-11 Species 0.000 description 1
- 241000238367 Mya arenaria Species 0.000 description 1
- 102400000108 N-terminal peptide Human genes 0.000 description 1
- 101800000597 N-terminal peptide Proteins 0.000 description 1
- PCEORBLTWJVJHN-VAWYXSNFSA-N N/C(=N\C(=O)/C=C/C1=CC=CC=C1)NC(=O)C1=CC=CC=C1 Chemical compound N/C(=N\C(=O)/C=C/C1=CC=CC=C1)NC(=O)C1=CC=CC=C1 PCEORBLTWJVJHN-VAWYXSNFSA-N 0.000 description 1
- ONTAZXYUHYEZNY-UHFFFAOYSA-N N=C(N)CC(=O)CC1=CC2=CC=CC=C2C=C1 Chemical compound N=C(N)CC(=O)CC1=CC2=CC=CC=C2C=C1 ONTAZXYUHYEZNY-UHFFFAOYSA-N 0.000 description 1
- PFKYZWUGTMREHT-AATRIKPKSA-N N=C(N)NC(=O)/C=C/C1=C(Br)C=CC=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=C(Br)C=CC=C1 PFKYZWUGTMREHT-AATRIKPKSA-N 0.000 description 1
- HVVFWRLIARMUOV-AATRIKPKSA-N N=C(N)NC(=O)/C=C/C1=C(Cl)C=CC=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=C(Cl)C=CC=C1 HVVFWRLIARMUOV-AATRIKPKSA-N 0.000 description 1
- NCAPVVSGOJRHLA-SOFGYWHQSA-N N=C(N)NC(=O)/C=C/C1=CC2=C(C=CC=C2)C=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CC2=C(C=CC=C2)C=C1 NCAPVVSGOJRHLA-SOFGYWHQSA-N 0.000 description 1
- DXFJUUOQFIHODP-ZZXKWVIFSA-N N=C(N)NC(=O)/C=C/C1=CC=C(O)C=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CC=C(O)C=C1 DXFJUUOQFIHODP-ZZXKWVIFSA-N 0.000 description 1
- ORHXTMBRQJROCY-SNAWJCMRSA-N N=C(N)NC(=O)/C=C/C1=CC=CC(Br)=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CC=CC(Br)=C1 ORHXTMBRQJROCY-SNAWJCMRSA-N 0.000 description 1
- FIZKBCWWZMXZHL-SNAWJCMRSA-N N=C(N)NC(=O)/C=C/C1=CC=CC(Cl)=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CC=CC(Cl)=C1 FIZKBCWWZMXZHL-SNAWJCMRSA-N 0.000 description 1
- BOZAUWVEEASEDI-YIKKBJQVSA-N N=C(N)NC(=O)/C=C/C1=CC=CC=C1.O=C(O)/C=C/C1=CC=CC=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CC=CC=C1.O=C(O)/C=C/C1=CC=CC=C1 BOZAUWVEEASEDI-YIKKBJQVSA-N 0.000 description 1
- OLXNOYLRZRHHKP-ONEGZZNKSA-N N=C(N)NC(=O)/C=C/C1=CN=CC=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=CN=CC=C1 OLXNOYLRZRHHKP-ONEGZZNKSA-N 0.000 description 1
- AMQDDSKSNZPTIC-OWOJBTEDSA-N N=C(N)NC(=O)/C=C/C1=COC=C1 Chemical compound N=C(N)NC(=O)/C=C/C1=COC=C1 AMQDDSKSNZPTIC-OWOJBTEDSA-N 0.000 description 1
- GUSUDQLCQAYCDU-JHMJBTLWSA-N N=C(N)NC(=O)/C=C/C=C/C1=CC=CC=C1Br Chemical compound N=C(N)NC(=O)/C=C/C=C/C1=CC=CC=C1Br GUSUDQLCQAYCDU-JHMJBTLWSA-N 0.000 description 1
- OKOXJPLBLDXQNV-UHFFFAOYSA-N N=C(N)NC(=O)C1CC1C1=CC=CC=C1 Chemical compound N=C(N)NC(=O)C1CC1C1=CC=CC=C1 OKOXJPLBLDXQNV-UHFFFAOYSA-N 0.000 description 1
- IIORGOGWQSVXAU-ZZXKWVIFSA-N NC(N)=NC(=O)/C=C/C1=CC=C(Br)C=C1 Chemical compound NC(N)=NC(=O)/C=C/C1=CC=C(Br)C=C1 IIORGOGWQSVXAU-ZZXKWVIFSA-N 0.000 description 1
- ZJRXLZFDGGZHTC-ZZXKWVIFSA-N NC(N)=NC(=O)/C=C/C1=CC=C(Cl)C=C1 Chemical compound NC(N)=NC(=O)/C=C/C1=CC=C(Cl)C=C1 ZJRXLZFDGGZHTC-ZZXKWVIFSA-N 0.000 description 1
- UAZXRSJJVRWMRE-UHFFFAOYSA-N NC(N)=NC(=O)C1=CC2=C(C=CC=C2)N=C1 Chemical compound NC(N)=NC(=O)C1=CC2=C(C=CC=C2)N=C1 UAZXRSJJVRWMRE-UHFFFAOYSA-N 0.000 description 1
- DQBDVOYUKGUTLS-UHFFFAOYSA-N NC(N)=NC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1O Chemical compound NC(N)=NC(=O)C1=NC(Cl)=C(N2CCCCCC2)N=C1O DQBDVOYUKGUTLS-UHFFFAOYSA-N 0.000 description 1
- QHACSMCRBVYLCQ-UHFFFAOYSA-N NC(N)=NC(=O)C1=NC(Cl)=C(NC2=CC=C(F)C=C2)N=C1N Chemical compound NC(N)=NC(=O)C1=NC(Cl)=C(NC2=CC=C(F)C=C2)N=C1N QHACSMCRBVYLCQ-UHFFFAOYSA-N 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 241001292005 Nidovirales Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 229940122313 Nucleoside reverse transcriptase inhibitor Drugs 0.000 description 1
- PQZIOEUUUCRAFA-WUKNDPDISA-N O=C(/C=C/C1=CC=CC=C1)N=C(NC1=CC=CC=C1)NC1=CC=CC=C1 Chemical compound O=C(/C=C/C1=CC=CC=C1)N=C(NC1=CC=CC=C1)NC1=CC=CC=C1 PQZIOEUUUCRAFA-WUKNDPDISA-N 0.000 description 1
- OPGLKSXECNCJHX-YWNVXTCZSA-N O=C(/C=C/C1=CC=CC=C1)NC(=NC1=CC=CC=C1)NC(=O)/C=C/C1=CC=CC=C1 Chemical compound O=C(/C=C/C1=CC=CC=C1)NC(=NC1=CC=CC=C1)NC(=O)/C=C/C1=CC=CC=C1 OPGLKSXECNCJHX-YWNVXTCZSA-N 0.000 description 1
- 235000019502 Orange oil Nutrition 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000334226 Porcine epidemic diarrhea virus CV777 Species 0.000 description 1
- 241000585762 Porcine hemagglutinating encephalomyelitis virus (strain IAF-404) Species 0.000 description 1
- 241000711510 Porcine transmissible gastroenteritis coronavirus strain Purdue Species 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 101710132795 Protein P7 Proteins 0.000 description 1
- 241001290764 Puffinosis coronavirus Species 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 241000320410 Rat sialodacryoadenitis coronavirus Species 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 241000319426 SARS coronavirus BJ01 Species 0.000 description 1
- 241000319420 SARS coronavirus HKU-39849 Species 0.000 description 1
- 241000651068 SARS coronavirus HSR 1 Species 0.000 description 1
- 241000316209 SARS coronavirus Hong Kong/03/2003 Species 0.000 description 1
- 241000651110 SARS coronavirus Shanhgai LY Species 0.000 description 1
- 241000649112 SARS coronavirus Sin2500 Species 0.000 description 1
- 241000649111 SARS coronavirus Sin2677 Species 0.000 description 1
- 241000649110 SARS coronavirus Sin2679 Species 0.000 description 1
- 241000649109 SARS coronavirus Sin2748 Species 0.000 description 1
- 241000649108 SARS coronavirus Sin2774 Species 0.000 description 1
- 241000346162 SARS coronavirus TW1 Species 0.000 description 1
- 241000632404 SARS coronavirus TWC Species 0.000 description 1
- 241000315688 SARS coronavirus Taiwan Species 0.000 description 1
- 241000582842 SARS coronavirus Taiwan JC-2003 Species 0.000 description 1
- 241000675940 SARS coronavirus Taiwan TC1 Species 0.000 description 1
- 241000675962 SARS coronavirus Taiwan TC2 Species 0.000 description 1
- 241000316168 SARS coronavirus Tor2 Species 0.000 description 1
- 241000582368 SARS coronavirus ZJ01 Species 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 1
- 102000003673 Symporters Human genes 0.000 description 1
- 108090000088 Symporters Proteins 0.000 description 1
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- WPVFJKSGQUFQAP-GKAPJAKFSA-N Valcyte Chemical compound N1C(N)=NC(=O)C2=C1N(COC(CO)COC(=O)[C@@H](N)C(C)C)C=N2 WPVFJKSGQUFQAP-GKAPJAKFSA-N 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- WREGKURFCTUGRC-POYBYMJQSA-N Zalcitabine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)CC1 WREGKURFCTUGRC-POYBYMJQSA-N 0.000 description 1
- PRFPIACVSZTCRX-VEELZWTKSA-N [HH].[H]/C(=C\C1=CC=C2OCOC2=C1)C(=O)NC(=N)N Chemical compound [HH].[H]/C(=C\C1=CC=C2OCOC2=C1)C(=O)NC(=N)N PRFPIACVSZTCRX-VEELZWTKSA-N 0.000 description 1
- ZLHBIWZXHDEOFT-CMDGGOBGSA-N [H]/C(=C\C1=C(C(C)(C)C)C=CC=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C(C)(C)C)C=CC=C1)C(=O)NC(=N)N ZLHBIWZXHDEOFT-CMDGGOBGSA-N 0.000 description 1
- ZAPVDFDIPMJGRX-AATRIKPKSA-N [H]/C(=C\C1=C(C(F)(F)F)C=CC=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C(F)(F)F)C=CC=C1)C(=O)NC(=N)N ZAPVDFDIPMJGRX-AATRIKPKSA-N 0.000 description 1
- YHGKUFXGCRISMT-AATRIKPKSA-N [H]/C(=C\C1=C(C)C(C)=CC(C)=C1C)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C)C(C)=CC(C)=C1C)C(=O)NC(=N)N YHGKUFXGCRISMT-AATRIKPKSA-N 0.000 description 1
- CHKULGQCBATXKS-SNAWJCMRSA-N [H]/C(=C\C1=C(C)C=C(C)C=C1C)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C)C=C(C)C=C1C)C(=O)NC(=N)N CHKULGQCBATXKS-SNAWJCMRSA-N 0.000 description 1
- MMVUASXGHTWYSF-VOTSOKGWSA-N [H]/C(=C\C1=C(C)C=CC=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C)C=CC=C1)C(=O)NC(=N)N MMVUASXGHTWYSF-VOTSOKGWSA-N 0.000 description 1
- LTGYAZVREDUARQ-ZHACJKMWSA-N [H]/C(=C\C1=C(C2CCCCC2)C=CC=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(C2CCCCC2)C=CC=C1)C(=O)NC(=N)N LTGYAZVREDUARQ-ZHACJKMWSA-N 0.000 description 1
- LNOGCEAJDCCGSB-SNAWJCMRSA-N [H]/C(=C\C1=C(Cl)C=CC=C1Cl)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(Cl)C=CC=C1Cl)C(=O)NC(=N)N LNOGCEAJDCCGSB-SNAWJCMRSA-N 0.000 description 1
- AJOKNWFEJJNBCY-SNAWJCMRSA-N [H]/C(=C\C1=C(F)C=CC=C1Cl)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=C(F)C=CC=C1Cl)C(=O)NC(=N)N AJOKNWFEJJNBCY-SNAWJCMRSA-N 0.000 description 1
- AORSRQOKSFUBQU-DAFODLJHSA-N [H]/C(=C\C1=CC(Br)=CC=C1F)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC(Br)=CC=C1F)C(=O)NC(=N)N AORSRQOKSFUBQU-DAFODLJHSA-N 0.000 description 1
- IZTOMICYUSXUFV-GORDUTHDSA-N [H]/C(=C\C1=CC(Br)=CC=C1OC)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC(Br)=CC=C1OC)C(=O)NC(=N)N IZTOMICYUSXUFV-GORDUTHDSA-N 0.000 description 1
- BSQJIOHWMHUCTN-NSCUHMNNSA-N [H]/C(=C\C1=CC(CO)=C(CO)C(OC)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC(CO)=C(CO)C(OC)=C1)C(=O)NC(=N)N BSQJIOHWMHUCTN-NSCUHMNNSA-N 0.000 description 1
- MYIAILVVWSAAHT-RMKNXTFCSA-N [H]/C(=C\C1=CC=C(C(C)(C)C)C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(C(C)(C)C)C=C1)C(=O)NC(=N)N MYIAILVVWSAAHT-RMKNXTFCSA-N 0.000 description 1
- PISVGNWQIULYBS-VMPITWQZSA-N [H]/C(=C\C1=CC=C(C([H])(C)C)C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(C([H])(C)C)C=C1)C(=O)NC(=N)N PISVGNWQIULYBS-VMPITWQZSA-N 0.000 description 1
- UGJNJXYDMZXDLY-DHZHZOJOSA-N [H]/C(=C\C1=CC=C(C2=CC=CC=C2)C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(C2=CC=CC=C2)C=C1)C(=O)NC(=N)N UGJNJXYDMZXDLY-DHZHZOJOSA-N 0.000 description 1
- YJJRJCGALAGVMY-DUXPYHPUSA-N [H]/C(=C\C1=CC=C(Cl)C(Cl)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(Cl)C(Cl)=C1)C(=O)NC(=N)N YJJRJCGALAGVMY-DUXPYHPUSA-N 0.000 description 1
- UFSJJMVCFQLTKW-DUXPYHPUSA-N [H]/C(=C\C1=CC=C(Cl)C=C1Cl)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(Cl)C=C1Cl)C(=O)NC(=N)N UFSJJMVCFQLTKW-DUXPYHPUSA-N 0.000 description 1
- IPGOWJWLSZFUMA-DUXPYHPUSA-N [H]/C(=C\C1=CC=C(F)C(F)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(F)C(F)=C1)C(=O)NC(=N)N IPGOWJWLSZFUMA-DUXPYHPUSA-N 0.000 description 1
- VCBGPXCHKPPINZ-ZZXKWVIFSA-N [H]/C(=C\C1=CC=C(F)C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C(F)C=C1)C(=O)NC(=N)N VCBGPXCHKPPINZ-ZZXKWVIFSA-N 0.000 description 1
- DGSSRZZIDUQFRA-ZZXKWVIFSA-N [H]/C(=C\C1=CC=C([N+](=O)[O-])C=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=C([N+](=O)[O-])C=C1)C(=O)NC(=N)N DGSSRZZIDUQFRA-ZZXKWVIFSA-N 0.000 description 1
- RNJYBXUVPPUWLN-ZTUQJBCJSA-N [H]/C(=C\C1=CC=CC(/C=C/CCCCC)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(/C=C/CCCCC)=C1)C(=O)NC(=N)N RNJYBXUVPPUWLN-ZTUQJBCJSA-N 0.000 description 1
- HRKGSHPEYGOZHJ-BQYQJAHWSA-N [H]/C(=C\C1=CC=CC(C(C)(C)C)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C(C)(C)C)=C1)C(=O)NC(=N)N HRKGSHPEYGOZHJ-BQYQJAHWSA-N 0.000 description 1
- DKJONGCRYHKAGI-SNAWJCMRSA-N [H]/C(=C\C1=CC=CC(C(F)(F)F)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C(F)(F)F)=C1)C(=O)NC(=N)N DKJONGCRYHKAGI-SNAWJCMRSA-N 0.000 description 1
- PZNOJKMDUBWCBQ-AATRIKPKSA-N [H]/C(=C\C1=CC=CC(C)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C)=C1)C(=O)NC(=N)N PZNOJKMDUBWCBQ-AATRIKPKSA-N 0.000 description 1
- WYZGHFCGQGCOPZ-VOTSOKGWSA-N [H]/C(=C\C1=CC=CC(C)=C1C)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C)=C1C)C(=O)NC(=N)N WYZGHFCGQGCOPZ-VOTSOKGWSA-N 0.000 description 1
- DRIQBBXJVJVPGI-MDZDMXLPSA-N [H]/C(=C\C1=CC=CC(C2=CC=CC=C2)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C2=CC=CC=C2)=C1)C(=O)NC(=N)N DRIQBBXJVJVPGI-MDZDMXLPSA-N 0.000 description 1
- IBFSKNNSMJANAC-MDZDMXLPSA-N [H]/C(=C\C1=CC=CC(C2=CCCCC2)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(C2=CCCCC2)=C1)C(=O)NC(=N)N IBFSKNNSMJANAC-MDZDMXLPSA-N 0.000 description 1
- OLALSUPQCJAGAU-SNAWJCMRSA-N [H]/C(=C\C1=CC=CC(F)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(F)=C1)C(=O)NC(=N)N OLALSUPQCJAGAU-SNAWJCMRSA-N 0.000 description 1
- NGFWDHLKIUYSIP-SNAWJCMRSA-N [H]/C(=C\C1=CC=CC(F)=C1F)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(F)=C1F)C(=O)NC(=N)N NGFWDHLKIUYSIP-SNAWJCMRSA-N 0.000 description 1
- ZAYDWNACZRBICF-SNAWJCMRSA-N [H]/C(=C\C1=CC=CC(OC(F)(F)F)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(OC(F)(F)F)=C1)C(=O)NC(=N)N ZAYDWNACZRBICF-SNAWJCMRSA-N 0.000 description 1
- JRSLBEIEBBOHCW-VOTSOKGWSA-N [H]/C(=C\C1=CC=CC(OCC)=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC(OCC)=C1)C(=O)NC(=N)N JRSLBEIEBBOHCW-VOTSOKGWSA-N 0.000 description 1
- MHTGKDXWKXQUAQ-SNAWJCMRSA-N [H]/C(=C\C1=CC=CC([N+](=O)[O-])=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC([N+](=O)[O-])=C1)C(=O)NC(=N)N MHTGKDXWKXQUAQ-SNAWJCMRSA-N 0.000 description 1
- MASFCCGAEYGKRN-ZHACJKMWSA-N [H]/C(=C\C1=CC=CC=C1C1=CC=CC=C1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1C1=CC=CC=C1)C(=O)NC(=N)N MASFCCGAEYGKRN-ZHACJKMWSA-N 0.000 description 1
- CYHJBJGMWOSTKY-ZHACJKMWSA-N [H]/C(=C\C1=CC=CC=C1C1C=CCCC1)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1C1C=CCCC1)C(=O)NC(=N)N CYHJBJGMWOSTKY-ZHACJKMWSA-N 0.000 description 1
- HYBPCGHPOGXYLO-BQYQJAHWSA-N [H]/C(=C\C1=CC=CC=C1CC)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1CC)C(=O)NC(=N)N HYBPCGHPOGXYLO-BQYQJAHWSA-N 0.000 description 1
- FGLKXTSTMPDAMW-AATRIKPKSA-N [H]/C(=C\C1=CC=CC=C1F)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1F)C(=O)NC(=N)N FGLKXTSTMPDAMW-AATRIKPKSA-N 0.000 description 1
- QKUJGONOHHSOQJ-BQYQJAHWSA-N [H]/C(=C\C1=CC=CC=C1OCC)C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1OCC)C(=O)NC(=N)N QKUJGONOHHSOQJ-BQYQJAHWSA-N 0.000 description 1
- LCRHPQDZNWNTDJ-AATRIKPKSA-N [H]/C(=C\C1=CC=CC=C1[N+](=O)[O-])C(=O)NC(=N)N Chemical compound [H]/C(=C\C1=CC=CC=C1[N+](=O)[O-])C(=O)NC(=N)N LCRHPQDZNWNTDJ-AATRIKPKSA-N 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000009056 active transport Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 238000005273 aeration Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 229960001830 amprenavir Drugs 0.000 description 1
- YMARZQAQMVYCKC-OEMFJLHTSA-N amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 230000001455 anti-clotting effect Effects 0.000 description 1
- 230000036436 anti-hiv Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- GCGYREODZIZPLJ-UHFFFAOYSA-N azepan-1-ium;chloride Chemical compound Cl.C1CCCNCC1 GCGYREODZIZPLJ-UHFFFAOYSA-N 0.000 description 1
- ZSIQJIWKELUFRJ-UHFFFAOYSA-N azepane Chemical compound C1CCCNCC1 ZSIQJIWKELUFRJ-UHFFFAOYSA-N 0.000 description 1
- 125000000051 benzyloxy group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])O* 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000006189 buccal tablet Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 239000007958 cherry flavor Substances 0.000 description 1
- 210000000991 chicken egg Anatomy 0.000 description 1
- 150000001805 chlorine compounds Chemical class 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 229960000724 cidofovir Drugs 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 229940125810 compound 20 Drugs 0.000 description 1
- 229940125898 compound 5 Drugs 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- NXQGGXCHGDYOHB-UHFFFAOYSA-L cyclopenta-1,4-dien-1-yl(diphenyl)phosphane;dichloropalladium;iron(2+) Chemical compound [Fe+2].Cl[Pd]Cl.[CH-]1C=CC(P(C=2C=CC=CC=2)C=2C=CC=CC=2)=C1.[CH-]1C=CC(P(C=2C=CC=CC=2)C=2C=CC=CC=2)=C1 NXQGGXCHGDYOHB-UHFFFAOYSA-L 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229960002656 didanosine Drugs 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 230000010339 dilation Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 230000000857 drug effect Effects 0.000 description 1
- 238000003255 drug test Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229960004396 famciclovir Drugs 0.000 description 1
- GGXKWVWZWMLJEH-UHFFFAOYSA-N famcyclovir Chemical compound N1=C(N)N=C2N(CCC(COC(=O)C)COC(C)=O)C=NC2=C1 GGXKWVWZWMLJEH-UHFFFAOYSA-N 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- JAXFJECJQZDFJS-XHEPKHHKSA-N gtpl8555 Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)N[C@H](B1O[C@@]2(C)[C@H]3C[C@H](C3(C)C)C[C@H]2O1)CCC1=CC=C(F)C=C1 JAXFJECJQZDFJS-XHEPKHHKSA-N 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 125000001072 heteroaryl group Chemical group 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 229960001936 indinavir Drugs 0.000 description 1
- CBVCZFGXHXORBI-PXQQMZJSSA-N indinavir Chemical compound C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 CBVCZFGXHXORBI-PXQQMZJSSA-N 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 230000037041 intracellular level Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 108040002477 ion channel activity proteins Proteins 0.000 description 1
- 239000002555 ionophore Substances 0.000 description 1
- 230000000236 ionophoric effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940120937 lamivudine and abacavir Drugs 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 238000000464 low-speed centrifugation Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- FJQXCDYVZAHXNS-UHFFFAOYSA-N methadone hydrochloride Chemical compound Cl.C=1C=CC=CC=1C(CC(C)N(C)C)(C(=O)CC)C1=CC=CC=C1 FJQXCDYVZAHXNS-UHFFFAOYSA-N 0.000 description 1
- DQVREHXACXVHHG-UHFFFAOYSA-N methyl 3-amino-5-(azepan-1-yl)-6-phenylpyrazine-2-carboxylate Chemical compound C1CCCCCN1C=1N=C(N)C(C(=O)OC)=NC=1C1=CC=CC=C1 DQVREHXACXVHHG-UHFFFAOYSA-N 0.000 description 1
- 150000004702 methyl esters Chemical class 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002941 microtiter virus yield reduction assay Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- OGYQBPMOGSUWGB-UHFFFAOYSA-N n-carbamimidoyl-3-phenyl-n-(trifluoromethyl)prop-2-enamide Chemical compound NC(=N)N(C(F)(F)F)C(=O)C=CC1=CC=CC=C1 OGYQBPMOGSUWGB-UHFFFAOYSA-N 0.000 description 1
- 229960000884 nelfinavir Drugs 0.000 description 1
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 229960000689 nevirapine Drugs 0.000 description 1
- 229940042402 non-nucleoside reverse transcriptase inhibitor Drugs 0.000 description 1
- 239000002726 nonnucleoside reverse transcriptase inhibitor Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 239000007968 orange flavor Substances 0.000 description 1
- 239000010502 orange oil Substances 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- VSZGPKBBMSAYNT-RRFJBIMHSA-N oseltamivir Chemical compound CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 VSZGPKBBMSAYNT-RRFJBIMHSA-N 0.000 description 1
- 229960003752 oseltamivir Drugs 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 229960000402 palivizumab Drugs 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000003415 peat Substances 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000003359 percent control normalization Methods 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 125000003367 polycyclic group Chemical group 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910000027 potassium carbonate Inorganic materials 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000003161 proteinsynthetic effect Effects 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 238000010814 radioimmunoprecipitation assay Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000010992 reflux Methods 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 229960000888 rimantadine Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 229960001852 saquinavir Drugs 0.000 description 1
- QWAXKHKRTORLEM-UGJKXSETSA-N saquinavir Chemical compound C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 QWAXKHKRTORLEM-UGJKXSETSA-N 0.000 description 1
- 230000001932 seasonal effect Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000010183 spectrum analysis Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 238000004347 surface barrier Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-N trans-cinnamic acid Chemical compound OC(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-N 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 229940093257 valacyclovir Drugs 0.000 description 1
- 229960002149 valganciclovir Drugs 0.000 description 1
- 229910052720 vanadium Inorganic materials 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229960003636 vidarabine Drugs 0.000 description 1
- 230000010463 virion release Effects 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000009637 wintergreen oil Substances 0.000 description 1
- 229960000523 zalcitabine Drugs 0.000 description 1
- ARAIBEBZBOPLMB-UFGQHTETSA-N zanamivir Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 1
- 229960001028 zanamivir Drugs 0.000 description 1
- 229960002555 zidovudine Drugs 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D241/00—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings
- C07D241/02—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings
- C07D241/10—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members
- C07D241/14—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D241/24—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D241/26—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with nitrogen atoms directly attached to ring carbon atoms
- C07D241/28—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with nitrogen atoms directly attached to ring carbon atoms in which said hetero-bound carbon atoms have double bonds to oxygen, sulfur or nitrogen atoms
- C07D241/34—(Amino-pyrazine carbonamido) guanidines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D277/00—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
- C07D277/02—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
- C07D277/20—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D277/32—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D277/38—Nitrogen atoms
- C07D277/44—Acylated amino or imino radicals
- C07D277/46—Acylated amino or imino radicals by carboxylic acids, or sulfur or nitrogen analogues thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/15—Oximes (>C=N—O—); Hydrazines (>N—N<); Hydrazones (>N—N=) ; Imines (C—N=C)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/38—Heterocyclic compounds having sulfur as a ring hetero atom
- A61K31/381—Heterocyclic compounds having sulfur as a ring hetero atom having five-membered rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4406—Non condensed pyridines; Hydrogenated derivatives thereof only substituted in position 3, e.g. zimeldine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/4965—Non-condensed pyrazines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C279/00—Derivatives of guanidine, i.e. compounds containing the group, the singly-bound nitrogen atoms not being part of nitro or nitroso groups
- C07C279/20—Derivatives of guanidine, i.e. compounds containing the group, the singly-bound nitrogen atoms not being part of nitro or nitroso groups containing any of the groups, X being a hetero atom, Y being any atom, e.g. acylguanidines
- C07C279/22—Y being a hydrogen or a carbon atom, e.g. benzoylguanidines
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to methods for retarding, reducing or otherwise inhibiting viral growth and/or functional activity.
- the invention also relates to compounds and compositions suitable for use in the methods.
- PCT application PCT/AU99/00872 describes the use of compounds 5-(N,N-hexamethylene)-amiloride and 5-(N,N-dimethyl)-amiloride in the treatment of HIV infection.
- HCV Hepatitis C virus
- Coronaviruses are enveloped positive-straned RNA viruses that bud from the endoplasmic reticulum-Golgi intermediate compartment or the cis-Golgi network (Fischer, Stegen et al. 1998; Maeda, Maeda et al. 1999; Cores and Machamer 2000; Maeda, Repass et al. 2001; Kuo and Masters 2003).
- Coronaviruses infest humans and animals and it is thought that there could be a coronavirus that infests every animal.
- the two human coronaviruses, 229E and OC43 are known to be the major causes of the common cold and can occasionally cause pneumonia in older adults, neonates, or immunocompromised patients (Peiris, Lai et al. 2003).
- Animal coronaviruses can cause respiratory, gastrointestinal, neurological, or hepatic diseases in their host (Peiris, Lai et al. 2003).
- Several animal coronavirus are significant veterinary pathogens (Rots, Oberste et al. 2003).
- Severe acute respiratory syndrome is caused by a newly identified virus.
- SARS is a rsespiratory illness that has recently been reported in Asia, North America, and Europe (Peiris, Lai et al. 2003).
- the causative agent of SARS was identified as a coronavirus. (Drosten, Gunther et al. 2003; Ksiazek, Erdman et al. 2003; Peiris, Lai et al. 2003).
- the World Health Organization reports that the cumulative number of reported probable cases of SARS from 1 Nov. 2002 to the 11 Jul. 2003 is 8,5437 with 813 deaths, nearly a 10% death rats. It is believed that SARS will not be eradicated, but will cause seasonal epidemics like the cold or influenza viruses (Vogel 2003).
- the inventors have surprisingly found that certain compounds that fall under the classification of substituted acylguasidines have antiviral activity against viruses from a range of different virus families. Without intending to be bound by any particular theory or mechanism of action, and despite current dogma, it appears possible that viral replication can be retarded by inibiting otherwise down-regulating the activity of ion channels expressed in the host cell.
- the negative impact of the compounds of the present invention on viral replication may be mediated by the inhibition or otherwise down-regulation of membrane ion channel relied upon by the virus for replication.
- This membrane ion channel may be a viral membrane ion channel (exogenous to the host cell) or a host cell ion channel induced as a result of viral infection (endogenous to the host cell).
- the compounds of the present invention may inhibit Vpu or p7 function and thereby inhibit the continuation of the respective HIV or HCV life cycle.
- the SARS virus encodes an E protein which is shown for the first time, by the presaat inventors, to act as an ion channel.
- E proteins are present in other coronaviruses, the compounds, compositions and methods of the present invention would have utility in the inhibition and/or treatment of infections by other coronaviruses.
- the present invention is concerned with novel antiviral compounds that fall under the classification of substituted acylguanidines. It does not include in its scope the use of compounds 5-(N,N-hexsamethylene)amiloride and 5-(N,N-dimethyl)-amiloride for retarding, reducing or otherwise inhibiting viral growth and/or functional activity of HIV.
- a first aspect of the present invention provides an acylguanidine with antiviral activity.
- the present invention provides an antiviral componnd of Formula I
- the present invention provides an antiviral compound of Formula I
- the compounds of the invention include the following:
- EIPA 5-(N-ethyl-N-isopropyl)amiloride
- N-amidino-3,5-diamino-6-phenyl-2-pyrazinecarboxamide comprising the structure
- Bodipy-FL Amiloride comprising the structure
- N-(2-napthoyl)-N′-phenylguanidine comprising the structure
- N,N′-bis(2-napthoyl)guanidine comprising the structure
- N,N′-bis(1-napthoyl)guanidine comprising the structure
- N-Cinnamoyl-N′,N′-dimethylguanidine comprising the structure
- trans-3-furanacryoylguanidine comprising the strusture
- N,N′-Bis(amidimo)napthalene-2,6-dicarboxamide comprising the structure
- N′′-Cinnamoyl-N,N′-diphenylguanidine comprising the structure
- N,N′-Bis(3-phenylpropanoyl)guanidine comprising the structure
- the compounds of the invention are capable of reducing, retarding or otherwise inhibiting viral growth and/or replication.
- the antiviral activity of the compounds of the invention is against viruses such as those belonging to the Lentivirus family, and the Coronovirus family family of viruses.
- viruses such as Human Immunodeficiency Virus (HIV), Severe Acute Respiratory Syndrome virus (SARS), Mouse Hepatitis virus ( ), and Hepatitis C virus (HCV).
- HIV Human Immunodeficiency Virus
- SARS Severe Acute Respiratory Syndrome virus
- HCV Hepatitis C virus
- a pharmaceutical composition comprising an antiviral compound according to any one of the first, second or third aspects, and optionally one or more pharmaceutical acceptable carriers or derivatives, wherein said compound is capable of reducing, retarding or otherwise inhibiting viral growth and/or replication.
- the antiviral activity of the compounds of the invention is against viruses such as those belonging to the Lentivirus family, and the Coronovirus family of viruses.
- viruses such as Human Immunodeficency Virus (HIV), Severe Acute Respiratory Syndrome virus (SARS), Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV) and Equine Arteritis Virus (EAV).
- viruses such as Human Immunodeficency Virus (HIV), Severe Acute Respiratory Syndrome virus (SARS), Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV) and Equine Arteritis Virus (EAV).
- Coronaviruses which can be inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- compositions of the invention may further comprise one or more known antiviral compounds or molecules.
- a method for reducing, retarding or otherwise inhibiting growth and/or replication of a virus comprising contacting a cell infected with said virus or exposed to said virus with a compound according to any one of the first, second or third aspects.
- the virus is from the Lentivirus family, or the Coronavirus family. More preferably, the virus is Human Immunodeficiency Virus (HIV), Severe Respiratory Syndrome virus (SARS), Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Poreiae Respiratory Ceronavims (PRCV), Mouse Hepatitis virus (MBV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, the virus is HIV-1, HIV-2, the SARS virus, Coronaviruse 229E, Coronavirus OC43, PRCV, BCV, HCV, or EAV.
- HIV Human Immunodeficiency Virus
- SARS Severe Respiratory Syndrome virus
- MHV Mouse Hepatitis virus
- BCV Bovine Coronavirus
- PRCV Poreiae Respiratory Ceronavims
- MMV Mouse Hepatitis virus
- HCV Hepatitis C
- Coronaviruses which can be inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- a method for preventing the infection of a cell exposed to a virus comprising contacting said cell with a compound according to any one of the first, second or third aspects.
- the virus is from the Lentivirus family, or the Coronavirus family. More preferably, the virus is Human immunodeficiency Virus (HIV), Severe Respiratory Syndrome virus (SARS), Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Corobavirus (PRCV), Mouse Hepatitis virus (MHV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, the virus is HIV-1, HIV-2, the SARS virus, Coronavirus 229E, Coronavirus OC43, PRCV, BCV, HCV, EAV.
- Coronaviruses which can be inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- a method for the therapeutic or prophylactic treatment of a subject infected with or exposed to a virus comprising the administration of a compound according to any one of the first, second or thitd aspects, to a subject in need of said treatment.
- infection with a virus or exposure to a virus occurs with viruses belonging to the Lentivirus family, or the Coronovirus family. More preferably, infection or exposure occurs with HIV, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (FRCV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, infection or exposure occurs with HIV-1, HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- Coranaviruses which can be inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- the subject of the viral inibition is generally a mammal such as but not limited to human, primate, livestock animal (e.g. sheep, cow, horse, donkey, pig), companion animal (e.g. dog, cat), laboratory test animal (e.g. mouse, rabbit, rat, guinea pig, hamster), captive wild animal (e.g. fox, deer).
- livestock animal e.g. sheep, cow, horse, donkey, pig
- companion animal e.g. dog, cat
- laboratory test animal e.g. mouse, rabbit, rat, guinea pig, hamster
- captive wild animal e.g. fox, deer.
- the subject is a primate, or horse.
- the subject is a human.
- a method of down regulating a membrane ion channel functional activity in a cell infected with a virus comprising contacting said cell with a compound according to any one of the first, second or third aspects.
- the membrane ion channel may be endogenous to the cell or exogenous to the cell.
- the membrane ion channel of which functional activity is down regulated is that which Lentiviruses, and Coronaviruses utilise for mediating viral replication and include, for example, the HIV membrane ion channel Vpu, the HCV membrane ion channel P7, the Coronavirus E protein membrane ion channel, and the SARS E protein membrane ion channel.
- infection with a virus or exposure to a virus occurs with viruses belonging to the Lentivirus family, or the Coronovirus family. More preferably, infection or exposure occurs with HIV, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MEV), Bovine Coronsvirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, infection or exposure occurs with HIV-1, HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43s Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- a ninth aspect of the present invention there is provided a method of reducing, retarding or otherwise inhibiting growth and/or replication of a virus that has infected a cell, said method comprising contacting said infected cell with a compound according to any one of the first, second or third aspects, wherein said compound down regulates functional activity of a membrane ion channel derived from said virus and expressed in said infected cell.
- infection occurs with a virus belonging to the Lentivirus family, or the Coronovirus family. More preferably, infection or exposure occurs with HIV, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, infection or exposure occurs with HIV-1, HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- HIV-1 HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- Coronaviruses which can be inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- the membrane ion channel of which functional activity is down regulated is that which Lentiviruses, and Coronaviruses utilise for mediating viral replication and include, for example, the HIV membrane ion channel Vpu, the HCV membrane ion channel P7, and the Coronavirus E protein membrane ion channel.
- the present invention provides a method of reducing, retarding or otherwise inhibiting growth and/or replication of a virus that has infected a cell in a mammal, said method comprising administering to said mammal a compoand according to any one of the first, second or third aspects, or a pharmaceutical composition according to the fourth aspect, wherein said compound or said composition down regulates functional activity of a membrane ion channel expressed in said infected cell.
- infection occurs with a viruss belonging to the Lentivirus family, or the Coronovirus family. More preferably, infection or exposure occurs with HIV, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, infection or exposure occurs with HIV-1, HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- HIV-1 HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- Coronaviruses which can he inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- the membrane ion channel of which functional activity is down regulated is that which Lentiviruses, and Coronaviruses utilise for mediating viral replication and include, for example, the HIV membrane ion channel Vpu, the HCV membrane ion channel P7, and the Coronavirus E protein membrane ion channel.
- the subject of the viral inhibition is generally a mammal such as but not limited to human, primate, livestock animal (e.g. sheep, cow, horse, donkey, pig), companion animal (e.g. dog, cat), laboratory test animal (e.g. mouse, rabbit, rat, guinea pig, hamster), captive wild animal (e.g. fox, deer).
- livestock animal e.g. sheep, cow, horse, donkey, pig
- companion animal e.g. dog, cat
- laboratory test animal e.g. mouse, rabbit, rat, guinea pig, hamster
- captive wild animal e.g. fox, deer.
- the subject is a primate, or horse.
- the subject is a human.
- the present invention provides a method for the therapeutic or prophylactic treatment of a subject infected with or exposed to a virus comprising administering to said subject a compound according to any one of the first, second or third aspects, or a pharmaceutical composition according to the fourth aspect, wherein said compound or said composition down-regulates functional activity of a membrane ion channel derived from said virus.
- infection occurs with a virus belonging to the Lentivirus family, or the Coronovirus family of viruses. More preferably, infection or exposure occurs with HIV, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Mouse Hepatitis virus (MHV), Bovine Coronavirus (BCV), Porcine Respiratory Coronavirus (PRCV), Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV). Most preferably, infection or exposure occurs with HIV-1, HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- HIV-1 HIV-2, SARS, Human Coronavirus 229E, Human Coronavirus OC43, Hepatitis C virus (HCV), or Equine Arteritis Virus (EAV).
- Coronaviruses which can bo inhibited or their infections treated by the compounds of the invention are those listed in Table 1.
- the membrane ion channel of which functional activity is down regulated is that which Lentiviruses, and Coronaviruses utilise for mediating viral replication and include, for example, the HIV membrane ion channel Vpu, the HCV membrane ion channel P7, and the Coronavirus E protein membrane ion channel.
- the subject of the viral inhibition is generally a mammal such as but not limited to human, primate, livestock animal (e.g. sheep, cow, horse, donkey, pig), companion animal (e.g. dog, cat), laboratory test animal (e.g. mouse, rabbit, rat, guinea pig, hamster), captive wild animal (e.g. fox, deer).
- livestock animal e.g. sheep, cow, horse, donkey, pig
- companion animal e.g. dog, cat
- laboratory test animal e.g. mouse, rabbit, rat, guinea pig, hamster
- captive wild animal e.g. fox, deer.
- the subject is a primate, or horse.
- the subject is a human.
- the invention provides an antiviral compound selected from the group consisting of:
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a compound according to the twelfth aspect, and optionally one or mors pharmaceutical acceptable carriers or derivatives.
- the pharmaceutical composition may further comprise one or more known antiviral compounds or molecules.
- FIG. 1 is a schematic representation of plasmids used for expression of Vpu in E. coli .
- A The amino acid sequence ( ⁇ 400>1) encoded by the vpu open reading frame (ORF) generated by PCR from an HIV-1 strain HXB2 oDNA clone.
- the vpu ORF was cloned in-frame at the 3′ end of the GST gene in p2GBX to generate p2GEXVpu (B). It was subsequently cloned into pPL451 to produce the plasmid pPL+Vpu (C).
- FIG. 2 is a photographic representation of the expression and purification of Vpu in E. coli .
- A Western blotting after SDS-PAGE was used to detect expressed Vpu in E. coli extracts. Lanes 1-4 contain samples, at various stages of purity, of Vpu expressed from p2GEXVpu: lane 1, GST-Vpu flasiors protein isolated by glutathione-agarose affinity chromatography; lane 2, Vpu liberated from the fusion protein by treatment with thrombin; lane 35 Vpu purified by HPLC anion exchange chromatography; lane 4, Vpu after passage through the immunoaffinity column. Lanes 5 and 6, membrane vesicles prepared from 42′C induced cells containing pPL+Vpu or pPL451, respectively.
- B Silver stained SDS-PAGE gel: lane 1, Vpu purified by HPLC anion exchange chromatography; lane 2, Vpu after passage through the immunoaffinity column.
- FIG. 3 is a graphical representation of ion channel activity observed after exposure of lipid bilayers to aliquots containing purified Vpu.
- the CIS chamber contained 500 mM NaCl and the TRANS chamber contained 50 mM NaCl; both solutions were buffered at pH 6.0 with 10 mM MES.
- B shows a current virus voltage curve generated from data similar to that shown in A.
- FIG. 4 is a photographic representation of bacterial cross-feeding assays.
- the Met ⁇ , Pro ⁇ auxotrophic strain waa used to seed a soft agar overlay.
- Plates A and B contain minimal drop-out medium minus proline; in plate C the medium was minus methionine.
- the discs labelled P and M contained added proline or methionine, respectively.
- the discs labelled C and V were inoculated with Met + , Pro + E. coli cells containing the plasmids pPL451, or pPL+Vpu, respectively. Plates were incubated at 37° C. (A and C) or 30° C.
- FIG. 5 is a graphical representation of the screening of drugs for potential Vpu channel blockers.
- the photograph shows a section of a minimal medium-lacking adenine-agarose plate onto which a lawn of XL-1-blue E. coli cells containing the Vpu expression plasmid pPLVpu has been seeded. Numbers 6-11 are located at the sites of application of various drugs being tested, which were applied in 3 ⁇ l drops and allowed to soak into the agarose. The plate was then incubated at 37° C. for 48 hr prior to being photographed. The background grey shade corresponds to areas of no bacterial growth.
- the bright circular area around “10” represents bacterial cell growth as a result of application of adenine at that location (positive control).
- the smaller halo of bacterial growth around “9” is due to the application of 5-(N,N-hexamethylene)-amiloride at that location.
- FIG. 6 SARS E protein ion channel activity observed in NaCl solutions after exposure of lipid bilayer to 3-10 ⁇ g of E protein.
- the CIS chamber contained 50 mM NaCl in 5 mM HEPES buffer pH 7.2
- the TRANS chamber contained 500 mM NaCl in 5 mM HEPES buffer pH 7.2.
- the CIS chamber was earthed and the TRANS chamber was held at various potentials between ⁇ 100 to +100 mV.
- FIG. 7 SARS E protein ion channel activity observed in NaCl solutions after exposure of lipid bilayer to 3-10 ⁇ g of E protein.
- the CIS chamber contained 50 mM NaCl in 5 mM HEPES buffer pH 7.2.
- the TRANS chamber contained 500 mM NaCl in 5 mM HEPES buffer pH 7.2.
- the CIS chamber was earthed and the TRANS chamber was held at various potentials between ⁇ 100 to +100 mV.
- FIG. 8 Cinnamoylguanidine (Bit036) inhibits SARS E protein ion channel activity in NaCl solution.
- C Average current (pA), before formation of E protein ion channel, E protein ion channel activity and after addition of 100 ⁇ pM Bit036.
- FIG. 9 229E protein ion channel activity in lipid bilayers in KCl solutions.
- FIG. 10 Part A shows raw currents generated by the 229E-E protein ion channel in a planar lipid bilayer. The top trace shows current activity prior to drug addition and the lower trace shows the effect of addition of 100 ⁇ M cinnamoylguanidine on channel activity. Part B is a graphical representation of the average current flowing across the bilayer (in arbitrary units), before and after addition of cinnamoylguanidine.
- FIG. 11 MHV E protein Ion channel activity in lipid bilayars NaCl solutions.
- FIG. 12 Part A shows raw currents generated by the MHV-E protein ion channel in a planar lipid bilayer. The top trace shows current activity prior to drug addition and the lower trace shows the effect of addition of 100 ⁇ M cinnamoylguanidine on channel activity. Part B is a graphical representation of the average current flowing across the bilayer (in arbitrary units), before and after addition of cinnamoylguanidine.
- the present invention is based, in part, on the surprising determination that certain compounds that fall under the classification of substituted acylguanidines have antiviral activity against viruses from a range of different virus families.
- the negative impact of the compounds of the present invention on viral replication may be mediated by the inhibition or otherwise down-regulation of a membrane ion channel relied upon by the virus for replication.
- This membrane ion channel may be a viral membrane ion channel (exogenous to the host cell) or a host cell ion channel induced as a result of viral infection (endogenous to the host cell).
- the compounds of the present invention may inhibit Vpu or p7 function and thereby inhibit the continuation of the respective HIV or HCV life cycle.
- the SARS virus encodes an E protein which is shown for the first time, by the present inventors, to act as an ion channel.
- E proteins are present in other coronaviruses, the compounds, compositions and methods of the present invention would have utility in the inhibition and/or treatment of infections by other coronaviruses.
- While the present invention is concerned with novel antiviral compounds falling under the classification of substituted acylguanidines, it does not include in its scope the use of compounds 5-(N,N-hexamethlene)amiloride and 5-(N,N-dimethyl)-amiloride for retarding, reducing or otherwise inhibiting viral growth and/or fractional activity of HIV.
- the compounds of the invention may be administered in the form of a composition or formulation comprising pharmaceutically acceptable carriers and excipients.
- the pharmaceutical compositions of the invention may further comprise one or more known antiviral compounds or molecules.
- the known antiviral compounds are selected from the group consisting of Vidarabine, Acyclovir, Ganciclovir, Valganciclovir, Valacyclovir, Cidofovir, Famciclovir, Ribavirin, Amantadina, Riantadine, Interferon, Oseltamivir, Palivizumab, Rimantadine, Zanamivir, nucleoside-analog reverse transcriptase inhibitors (NRTI) such as Zidovudine, Didanosine, Zalcitabine, Stavudine, Lamivudine and Abacavir, non-nucleoside reverse transcriptase inhibitors (NNRTI) such as Nevirapine, Delavirdine and Efavirenz, protease inhibitors such as Sequinavir, Ritonavir, Indinavir, Nelfinavir, Amprenavir, and
- the methods and compositions of the present invention may be particularly effective against viruses which rely on ion channel formation for their replication, however it will be understood that this is not the only mechanism relied on by viruses for replication and that the compounds and methods of the present invention are not limited to agents which exert their action by retarding or inhibiting the function of ion channels.
- membrane ion channel should be understood as a reference to a structure which transports ions across a membrane.
- the present invention extends to ion channels which may function by means such as passive, osmotic, active or exchange transport.
- the ion channel may be formed by intracellular or extracellular means.
- the ion channel may be an ion channel which is naturally formed by a cell to facilitate its normal functioning.
- the ion channel may be formed by extracellular means. Extracellular means would include, for example, the formation of ion channels due to introduced chemicals, drugs or other agents such as ionophores or due to the functional activity of viral proteins encoded by a virus which has entered a cell.
- the ion channels which are the subject of certain embodiments of the present invention facilitate the transport of ions across membranes.
- Said membrane may be any membrane and is not limited to the outer cell wall plasma membrane.
- membrane encompasses the membrane surrounding any cellular organelle, snsh as the Golgi apparatus and endoplasmic reticulum, the outer cell membrane, the membrane surrounding any foreign antigen which is located within the cell (for example, a viral envelope) or the membrane of a foreign organism which is located extraceliularly.
- the membrane is typically, but not necessarily, composed of a fluid lipid bilayer.
- the subject ion channel may be of any structure.
- Vpu ion channel is formed by Vpu which is an integral membrane protein encoded by HIV-1 which associates with, for example, the Golgi and endoplasmic reticulum membranes of infected cells.
- Vpu ion channels is a reference to all related ion channels for example P7 HCV and M2 of influenze and the like.
- HIV HIV
- SARS Session Virus
- Coronavirus Coronavirus
- HCV HCV
- references to the “functional activity” of an ion channel should be understood as a reference to any one or more of the functions which an ion channel performs or is involved in.
- the Vpu protean encoded ion channel in addition to facilitating the transportation of Na + , K + , Cl + and PO 4 3+ , also plays a role in the degradation of the CD4 molecule in the endoplasmic reticulum.
- the Vpu protein encoded ion channel is also thought to play a role in mediating the HIV life cycle.
- the present invention is not limited to treating HIV infection via the mechanism, of inhibiting the HIV life cycle and, in particular, HIV replication. Rather, the present invention should be understood to encompass any mechanism by which the compounds of the present invention exert their anti-viral activity and may include hihibition of HIV viability or functional activity. This also applies to HCV, Coronaviruses, and to other viruses.
- references to the “functional activity” of a virus should be understood as a reference to any one or more of the functions which a virus performs or is involved in.
- Ion channel mediation of viral replication may be by direct or indirect means. Said ion channel mediation is by direct means if the ion channel interacts directly with the virion at any one or more of its life cycle stages. Said ion channel mediation is indirect if it interacts with a molecule other than those of the virion, which othsr molecule either directly or indirectly modulates any one or more aspects or stages of the viral life cycle. Accordingly, the method of the present invention encompasses the mediation of viral replication via the induction of a cascade of steps which lead to the mediation of any one or more aspects or stages of the viral life cycle.
- a suitable agent may interact directly with an ion channel to prevent replication of a virus or, alternatively, may act indirectly to prevent said replication by, for example, interacting with a molecule other than an ion channel.
- a further alternative is that said other molecule interacts with and inhibits the activity of the ion channel.
- references to a “cell” infected with a virus should bo understood as a reference to any cell, prokaryotic or eukaryotlc, which has been infected with a virus. This includes, for example, immortal or primary cell lines, bacterial cultures and cells in situ. In a suitable screening system for antiviral compounds, the preferred infected cells would be macrophages/monocytes or hepatocytes/lymphoid cells infected with either HIV or HCV respectively.
- the compounds of the present invention are thought to inhibit viral replication or virion release from cells by causing ion channels, namely VPU of HIV, the E protein of SARS and other Coronaviruses, or P7 of HCV to become blocked.
- the present invention encompasses antiviral compounds that are substituted acylguanidines.
- the present invention also includes the use of compounds 5-(N,N-hexamethylene)amiloride and 5-(N,N-dimethyl)-amiloride is the control of viral replication and/or growth other than HIV.
- the subject of the viral irthibition is generally a mammal such as but not limited to human, primate, livestock animal (e.g. sheep, cow, horse, donkey, pig), companion animal (e.g. dog, cat), laboratory test animal (e.g. mouse, rabbit, rat, guinea pig, hamster), captive wild animal (e.g. fox, deer).
- livestock animal e.g. sheep, cow, horse, donkey, pig
- companion animal e.g. dog, cat
- laboratory test animal e.g. mouse, rabbit, rat, guinea pig, hamster
- captive wild animal e.g. fox, deer
- the method of the present invention is useful in the treatment and prophylaxis of viral infection such as, for example, but not limited to HIV infection, HCV infection and other viral infections.
- the antiviral activity may be effected in subjects known to be infected with HIV in order to prevent replication of HIV thereby preventing the onset of AIDS.
- the method of the present invention may be used to reduce serum viral load or to alleviate viral infection symptoms.
- antiviral treatment may be effected in subjects known to be infected with, for example, HCV, is order to prevent replication of HCV, thereby preventing the further hspatocyte involvement and the ultimate degeneration of liver tissue.
- the method of the present invention may be particularly useful either in the early stages of viral infection to prevent the establishment of a viral reservoir in affected cells or as a prophylactic treatment to be applied immediately prior to or for a period after eKpoaurc to a possible source of virus.
- therapy and prophylaxis include amelioration of the symptoms of a particular condition or preventing or otherwise reducing the risk of developing & particular condition.
- prophylaxis may be considered as reducing the severity of onset of a particular condition. Therapy may also reduce the severity of as existing condition or the frequency of acute attacks.
- more than one compound or composition may be co-administered with one or more other compounds, such as knows anti-viral compounds or molecules.
- co-administered is meant simultaneous admirdstration in the same formulation or in two different formulations via the same or different routes or sequential administration by the same or different routes.
- sequential administration is meant a time difference of from seconds, minutes, hours or days between the adminstration of the two or more separate compounds.
- the subject antiviral compounds may be administered in any order.
- Routes of administration include but are not limited to intravenously, intraperitionealy, subcutaneously, intracramialy, intradermally, intramuscularly, intraocularly, intrathecaly, intracerebrally, intranasally, transmucosally, by infusion, orally, rectally, via iv drip, patch and implant. Intravenous routes are particularly preferred.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) and sterile powders for the extemporaneous preparation of sterile injectable solutions.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol and liquid polyethylene glycol, and the like), suitable mixtures thereof and vegetable oils.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thirmerosal and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by for example, filter sterilisation or sterilization by other appropriate means.
- Dispersions are also contemplated and these may be prepared by incorporating the various sterilised active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- a preferred method of preparation includes vacuum drying and the freeze-drying technique which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution.
- the active ingredients When the active ingredients are suitably protected, they may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsule, or it may be compressed into tablets.
- the active compound may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- Such compositions and preparations should contain at least 0.01% by weight, more preferably 0.1% by weight, even more preferably 1% by weight of active compound.
- compositions and preparations may, of course, be varied and may conveniently be between, about 1 to about 99%, more preferably about 2 to about 90%, even more preferably about 5 to about 80% of the weight of the unit.
- the amount of active compound in such therapeutically useful compositions in such that a suitable dosage will be obtained.
- Preferred compositions or preparations according to the present invention are prepared so that an oral dosage unit form contains between about 0.1 ng and 2000 mg of active compound.
- the tablets, troches, pills, capsules and the like may also contain the components as listed hereafter.
- a binder such as gum, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, lactose or saccharin may be added or a flavouring agent such as peppermint, oil of wintergreen, or cherry flavouring.
- the dosage unit form When the dosage unit form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier. Various other materials may be present as coatings or to otherwise modify the physical form of the dosage unit.
- tablets, pills, or capsules may be coated with shellac, sugar or both.
- a syrup or elixir may contain the active compound, sucrose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavouring such as cherry or orange flavour. Any material used in preparing any dosage unit form should be pharmaceutically pure and substantially non-toxic in the amounts employed.
- the active compound(s) may be incorporated into sustained-release preparations and formulations.
- the present invention also extends to forms suitable for topical application such as creams, lotions and gels.
- the anti-clotting peptides may need to be modified to permit penetration of the surface barrier.
- Procedures for the preparation of dosage unit forms and topical preparations are readily available to those skilled in the art from texts such as Pharmaceutical Handbook. A Martindale Companion Volume Ed. Ainley Wade Nineteenth Edition The Pharmaceutical Press London,
- Pharmaceutically acceptable carriers and/or diluents include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like.
- the use of such media and agents for pharmaceutically active substances is well knows in the art. Except insofar as any conventional media or agent is incompatable with the active ingredient, use thereof in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the novel dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active material and the particular therapeutic effect to be achieved and (b) the limitations inherent in the art of compounding.
- Effective amounts contemplated by the present invention will vary depending on the severity of the pain and the health and age of the recipient. In general terms, effective amounts may vary from 0.01 ng/kg body weight to about 100 mg/kg body weight.
- Alternative amounts include for about 0.1 ng/kg body weight about 100 mg/kg body weight or from 1.0 ng/kg body weight to about 80 mg/kg body weight.
- the subject of the viral inhibition is generally a mammal such as but not limited to human, primate, livestock animal (e.g. sheep, cow, horse, donkey, pig), companion animal (e.g. dog, cat), laboratory test animal (e.g. mouse, rabbit, rat, guinea pig, hamster), captive wild animal (e.g. fox, deer).
- livestock animal e.g. sheep, cow, horse, donkey, pig
- companion animal e.g. dog, cat
- laboratory test animal e.g. mouse, rabbit, rat, guinea pig, hamster
- captive wild animal e.g. fox, deer
- the methods of the present invention is useful in the treatment and prophylaxis of viral infection such as, for example, but not limited to HIV infection, HCV infection and other viral infections.
- the antiviral activity may be effected in subjects known to be infected with HIV in order to prevent replication of HIV thereby preventing the onset of AIDS.
- the methods of the present invention may be used to reduce serum viral load or to alleviate viral infection symptoms.
- antiviral treatment may be effected in subjects known to be infected, with, for example, HCV, hi order to prevent replication of HCV, thereby preventing the further hepatocyte involvement and the ultimate degeneration of liver tissue.
- the methods of the present invention may be particularly useful either in the early stages of viral infection to prevent the establishment of a viral reservoir in affected cells or as a prophylactic treatment to be applied immediately prior to or for a period after exposure to a possible source of virus.
- the compounds of the present invention may be made from the corresponding acid chlorides or methyl esters as shown in Scheme 1. Both of these methods are wall described in the literature.
- trans-cinnamic acid (1.50 g, 10.12 mmol) in dry benzene (30 mL) containing a drop of N,N-dimethylformaniide was added oxalyl chloride (5.14 g, 40.5 mmol) causing the solution to effervesce. After refluxing 2 h, the solution was evaporated to dryness under reduced pressure. The resulting solid was dissolved in dry tetrahydfotaran (20 mL) and added slowly to a solution of guanidine hydrochloride in 2M aqueous sodium hydroxide (25 mL).
- Complimentary DNA (cDNA) fragments for the various viral proteins listed in Table 2 were obtained either by PCR amplication from a parental virus genome clone, or by direct chemical synthesis of the polynucleotide sequence.
- Vpu open reading frame encoding Vpu ( FIG. 1 a ) was amplified by PCR from a cDNA clone of an Nde I fragment of tbe HIV-1 genome (isolate HXB2, McFarlane Burnet Centre, Melbourne, Australia) as follows: Native Pfu DNA polymerase (Stratagene; 0.035 U//II) was chosen to catalyse the VCR reaction to minimise possible PCR introduced errors by virtue of the enzyme's proofreading activity.
- Native Pfu DNA polymerase (Stratagene; 0.035 U//II) was chosen to catalyse the VCR reaction to minimise possible PCR introduced errors by virtue of the enzyme's proofreading activity.
- the 5′, sense, primer AGTA GGATCC ATGCAACCTATACC ( ⁇ 400>2) introduces a BamHI site (underlined) for cloning in-frame with the 3′ end of the GST gene in p2GEX (41).
- This primer also repairs ths start codon (bold T replaces a Q of the vpn gene which is a threonine codon in the HXB2 isolate.
- the 3′, antisense, primer TCT GGAATT LTACAGATCAT CAAC introduces an EcoRI site (underlined) to the other end of the PGR product to facilitate cloning. After 30 cycles of 94° C. for 45 sec, 55° C. for 1 min and 72° C.
- FIG. 1 b The entire Vpu open reading frame and the BamHI and EcoRI ligation sites were sequenced by cycle sequencing, using the Applied Biosystems dye-terminator kit, to confirm the DNA sequence.
- Other cDNAs were synthesissd for us using state of the art methods by GenScript Corporation (New Jersey, USA). Codon sequences were optimised for expression in bacterial, insect or mammalian cells, as appropriate.
- Restriction endonuclease enzyme recognition sites were incorporated at the 5′ and 3′ ends of the synthetic cDNAs to facilitate cloning into plasmid expression vectors, pcDNA3.1, pFastBac and pPL451 for expression of the encoded virus proteins in mammalian, insect or bacterial cells, respectively.
- p2GEXVpu was first digested with BamHI and the 5′ base overhang was filled in the Klenow DNA polymerase in the presence of dNTPs.
- the Vpn-encoding fragment was then liberated by digestion with EcoRI, purified from an agarose gel and ligated into pPL451 which had been digested with HpaI and EcoRI.
- Western blots subsequently confirmed that the pPLVpu construct ( FIG. 1 c ) expressed Vpu after induction of cultures at 42° C. to inactivate the cI857 repressor of the PR and PL promoters.
- E. coli strain XLI-blue cells containing p2GEXVpu were grown at 30° C. with vigors aeration in LB medium supplemented with glucose (6 g/L) and ampicillin (50 mg/L) to a density of approximately 250 Klett units, at which time IPTG was added to a final concentration of 0.01 mM and growth was contained for a further 4 hr.
- the final culture density was approximately 280 Klett units.
- the osmotically sensitised cells were pelleted at 12,000 g and sesuspended to the original volume in water to burst the cells.
- the suspension was then made up to 1xMTEBS/DTT using a 10 ⁇ buffer stock and the ghosts were isolated by centrifugation and resuspendsd in MTPBS/DTT to which was then sequentially added glycerol (to 20 % wt/vol) and CHAPS (to 2 % wt/vol) to give a final volume of one quarter the original volume.
- This mixture was stirred on ice for 1 hr and then centrifuged at 400,000 g for 1 hr to remove insoluble material.
- the GST-Vpu fusion protein was purified from the detergent extract by affinity chromatography on a glutathione agarose resin (Sigma). The resin was thoroughly washed in 50 mM Tris pH 7.5 containing glycerol (5 %), DTT (1 nM), and CHAPS (0.5 %) (Buffer A) and then the Vpu portion of the fusion protein was liberated and eluted from the resin-bound GST by treatment of a 50% (v/v) suspension of the beads with human thrombm (100U/ml; 37° C. for 1 hr). PMSF (0.5 mM) was added to the eluant to eliminate any remaking thrombin activity. This Vpu fraction was farther purified on a column of MA7Q anion exchange resin attached to a BioRad HPLC and eluted with a linear NaCl gradient (0-2M) in buffer A.
- Vpu was purified to homogeneity—as determined on silver stained gels—on an immunoaffinity column as follows: HPLC factions containing Vpu were desalted on a NAP 25 column (Pharmacia) into buffer A and then mixed with the antibody-agarose beads for 1 hr at room temperature. The beads were washed thoroughly and Vpu was eluted by increasing the salt concentration to 2M. Protein was quantitated using the BioRad dye binding assay.
- the plasmid p2GEXVpn ( FIG. 1 ) was constructed to create an in-frame gene fusion between the GST and Vpu open-reading frames. This system enabled IPTG-inducible expression of the Vpu polypeptide fused to the C-terminus of GST and allowed purification of the fusion protein by affinity chromatography on glutathione agarose.
- Optimal levels of GST-Vpu expression were obtained by growing the cultures at 30° C. to a cell density of approximately 250-300 Klett units and inducing with low levels of IPTG (0.01 mM).
- a combined cellular fraction containing the cell debris aad plasma membrane was prepared by lysozyme treatment of the induced cells followed by a low-speed centrifugation. Approximately 50% of the GST-Vpu protein could be solubilised from this fraction using the zwitterionic detergent CHAPS.
- Vpu Vpu was the major protein visible on silver stained gels ( FIG. 2B , lane 1). Finally, Vpu was purified to apparent homogeneity on an immunoaffinity column ( FIG. 2B , lane 2).
- the N-terminal amino acid sequence of the protein band (excised from SDS-PAGE gels) corresponding to the immunidetected protein confirmed its identity as Vpu.
- Proteoliposomes containing Vpu were prepared by the detergent dilution method (New, 1990). A mixture of lipids (PE:PC:PS; 5:3:2; 1 mg total lipid) dissolved in chloroform was dried under a stream of nitrogen gas and resuspended in 0.1 ml of potassium phosphate buffer (50 mM pH 7.4) containing DTT (1 mM). A 25 ⁇ l aliquot containing purified Vpu was added, followed by octylglucoside to a final concentration of 1.25 % (wt/vol).
- Vpu was tested for its ability to induce channel activity in planar lipid bilayers using standard techniques as described elsewhere (Miller, 1986; and Piller et al, 1996).
- the solutions in the CIS and TRANS chambers were separated by a DelrinTM plastic wall containing a small circular hole of approximately 100 ⁇ m diameter across which a lipid bilayer was painted so as to form a higk resistance electrical seal.
- Bilayers were painted from a mixture (8:2) of palmtoyl-oleoly-phosphatidyl-ethanolamine and palmitoyl-oleolyphosphatidyl-choline (Avanti Polar Lipids, Alabaster, Ala.) in n-decane.
- Ths solutions in the two chambers contained MES buffer (10 mM, pH 6.0) to which various NaCl or KCl concentrations were added. Currents were recorded with an AxopatchTM 200 amplifier. The electrical potential between the two chambers could be manipulated between +/ ⁇ 200 mV (TRANS relative to grounded CIS). Aliquots containing Vpu were added to the CIS chamber either as a detergent solution or after incorporation of the protein into phospholipid vesicles. The chamber was stirred until currents were observed.
- Channel activity was observed in over 40 individual experiments with Vpu samples prepared from five independent purifications. In different experiments, the amplitude of the entrants varied over a large range and, again, seemed to approximately correlate with the amount of protein added. The smallest and largest channels measured had conductance of 14 pS and 280 pS, respectively. The channels were consistently smaller when lipid vesicles containing Vpu were prepared and fused to the bilayer rather than when purified protein in detergent solution was added. This may be because the former method included treatment with high concentrations of detergent and a dilution step that may have favoured the breakdown of large aggregates into monomers.
- This bio-assay is based on the observation that expression of Vpn in E. coli results in an active Vpu channel located is the plasmalemma that dissipates the transmembrane sodium gradient.
- Vpu channel activity metabolites whose accumulation within the cells is mediated by & sodium dependent co-transporter (for example proline or adenine) leak out of the cell faster than they can be synthesised so that the metabolites' intracellular levels become limiting for growth of the cell.
- & sodium dependent co-transporter for example proline or adenine
- the vpu open-reading frame was cloned into the plasmid pPL451 to create the recombinant plasmid pFL-Vpu ( FIG. 1 b ).
- the strong P L and P R lambda promoters are used to drive expression of Vpu under control of the temperature sensitive c1857 represser, such that when grown at 30° C. expression is tightly repressed and can be induced by raising the temperature to between 37° C. and 42° C.
- the temperature sensitive c1857 represser such that when grown at 30° C. expression is tightly repressed and can be induced by raising the temperature to between 37° C. and 42° C.
- On agar plates cells containing pPL-Vpu grew when incubated at 30° C. and 37° C. but not at 42° C., while control strains grew well at 42° C.
- the plasma membrane fraction was prepared and western blotting, using an antibody that specifically binds to the C-terminus of Vpu, detected a single band at approximately 16 kDa, indicating that Vpu was expressed and associated with the membranes ( FIG. 2A , lane 5).
- E. coli Uptake of proline by E. coli is well characterised and active transport of the amino acid into the cells is known to use the sodium gradient as the energy source (Yamato et al, 1994).
- the following cross-feeing assay was used: A lawn of an E. coli strain auxotrophic for proline and methionine (Met ⁇ Pro ⁇ ), was seeded and poured as a soft agar overlay on minimal drop-out media plates lacking proline but containing methionine. Sterile porous filter discs were inoculated with a Met + Pro + strain (XL-1 blue) containing either the pPL451 control plasmid or pPL-Vpu and placed onto the soft agar.
- Met + Pro + strain XL-1 blue
- the E. coli methionine permease is known to belong to the ABC transporter family (Rosen, 1987) and hence be energised by ATP. Identical crossfeeding experiments to those described above were set us except that the Met ⁇ Pro ⁇ strain was spread on minimal drop-out plates lacking methionine but containing proline. No growth of this strain was evident around any of the discs ( FIG. 4C ), indicating that methionine was not leaking out of the XL-1 blue cells even when Vpu was being expressed.
- Vpu N-terminal peptide (residues 1-32) dissolved in trifluoroethanol was added to the CIS chamber of the bilayer apparatus and the solutions was stirred until ion currents were observed, indicating incorporation of one or more Vpu ion channels into the bilayer.
- drugs were added to the solutions in the CIS and TRANS chambers—with stirring—to a final concentration of 100 ⁇ M.
- Channel activity was then recorded for at least a further three minutes and the effect of drug addition on ion current was detennined by comparing the channel activity before and after drug addition.
- Table 4 lists the scores for inhibition of Vpn protein in the bacterial bio-assay.
- Human monocytes were isolated from peripheral blood and cultured either for 24 hr (one day old monocytes) or for 7 days to allow differentiation into monocyte derived macrophages (MDM). These cells were then exposed to cell-free preparations of HIV isolates and allowed to absorb for 2 hr before complete aspiration of the medium, washing once with virus-free medium and resuspension in fresh medium. The cells were exposed to various concentration of compound either 24 hr prior to infection or after infection. Subsequent HIV replication, at various times after infection, was compared in cells exposed to drugs and in cells not exposed to drugs (controls). The progression and extent of viral replication was assayed using either an HIV DNA PCR method (Fear et al, 1998) or an ELISA method to quantitate p24 in culture supernatants (Kelly et al, 1998).
- Table 5 provides examples of results obtained using this assay and test antiviral compounds.
- a peptide corresponding to the full-length SARS-CoV (isolate Tox2 and Urbani) E protein (MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCA YCCNIVNVSLVKPTVYVYSRVKNLNSSBGVPDLLV) and a second peptide comprising the first 40 amino acids of the full length E protein which correspond to the transmembrane domain (MYSFVSEETGTLIVNSVLLFLAFVVF LLVTLAILTALRLC) were synthesized manually using FMOC chemistry and solid phase peptide synthesis The synthesis was done at the Biomolecular Resource Facility (John Curtin School of Medical Research, ANU, Australia) using a Symphony R Peptide Synthesiser from Protein Technologies Inc. (Tucson, Ariz., USA) according to the manufacturers instructions.
- the insoluble material containing the E protein was dried using Speedvac an the weight of the final product was used to calculate the yield.
- the purified peptide was analysed by Bruker Onmiflex MALDI-TOF mass spectrometry in HABA matrix at 2.5 mg/ml in methanol at a 1:1 ratio and spectra were obtained in the positive linear mode. A clear peat at m/z ratio of 8,360.1 was seen as expected for the calculated molecular weight of full-length E protein and 4422.3 for the N-terminal E protein.
- the SARS virus B protein was resuspended at 1 mg/ml in 2,2,2-trifluoroethanol.
- the SARS virus E protein's ability to form ion channels was tested on a Warner (Warner instruments, Inc. 1125 Dixwell Avenue, Hamden, Conn. 06514) bilayar rig as follows; A lipid mix of 3:1,1, 1-Palmitoyl-2-oleolyl phosphatidyl Ethanolamine: 1-Palmitoyl-2-oleolyl phosphatidyl Serine: 1-Palmitoyl-2-oleolyl phosphatidyl choline in CHCl 3 was dried under N 2 gas and suspended to 50 mg/ml in n-decane.
- Bilayers were painted across a circular hole of approximately 100 ⁇ m diameter in a DelrinTM cup separating aqueous solution in the CIS and TRANS chambers.
- the CIS chamber contained a solution of 500 mM NaCl or KCl, in a 5 mM HEPES buffer pH 7.2
- the TRANS chamber contained a solution of 50 mM NaCl or KCl, in a 5 mM HEPES buffer pH 7.2.
- Silver electrodes coated in chloride with 2% agarose bridges are placed in the CIS and TRANS chamber solutions.
- the SARS E protein full-length or N-terminal peptides (3-10 ng) were added to the CIS chamber, which was stirred until channel activity was detected.
- the CIS chamber was earthed and the TRANS chamber was held at various holding potentials ranging between +100 to ⁇ 100 mV. Currents were recorded using a Warner model BD-525D amplifier, filtered at 1 kHz, sampling at 5 kHz and digitally recorded on the hard disk of a PC using software developed in house.
- Drugs to be tested for their ability to inhibit SARS E protein ion channel activity were made up at 50 mM is a solution of 50% DMSO: 50% methanol.
- ion channel activity 100 ⁇ M to 400 ⁇ M of compound was added to the CIS chamber while stirring for 30 seconds. Bilayar currents were recorded before channel activity, during channel activity and after the addition of the drug.
- cinnamoylguanidine (Bit036), a compound which was shown in earlier experiments to be antiviral and to inhibit ion channel proteins from other viruses.
- E protein was dissolved to 1 mg/ml, 5 mg/ml and 10 mg/ml in, 6 M Urea, 10% Glycerol, 5% SDS, 500 mM DTT, 0.002% Bromophenol Blue, 62.5 mM Tris HCl (pH 8.3), Peptides in solutions were heated at 100° C. for 20 minutes before 30 ⁇ L samples were run on stacking gel 4-20% (Gradipora). SeeBlue® pre-stained standard (Invitrogen) was used for molecular weight markers.
- the purified synthetic peptide was reconstituted into planar lipid bilayers (21). Typically, 3 ⁇ g of SARS full-length E protein was added to the CIS chamber, while stirring. This CIS chamber contained 500 mM NaCl and the TRANS chamber contained 50 mM NaCl. In 60 experiments, ion currents due to SARS E protein ion channel activity were observed after about 5-15 minutes of stirring. Activity was detected more rapidly and reliably with a holding potential of approximately ⁇ 100 mV across the bilayer. Currents recorded at ⁇ 100 mV, (A) and at ⁇ 60 mV (B) in one of these experiments are shown in FIG. 6 .
- FIG. 7 a shows typical current traces recorded oyer a range of potentials in NaCl solutions.
- the IV curve shows that at the lower voltages the average current flow across the bilayer is small but at higher potentials there is an increase in average current across the bilayer, resulting in a non-linear IV relationship.
- the average reversal potential was +48.3 ⁇ 23 mV (mean ⁇ 1SEM), indicating that the channels were about 37 times more permeable to Na+ ion than to Cl ⁇ ions.
- the reversal potential is close to the Na+ equilibrium potential (+53 mV), therefore the channel is selective for Na+ ions.
- the channel conductance varied between 95-164 pS; the average conductance was 130 ⁇ 13 pS.
- FIG. 8 b shows recording of currents in KCl solutions at a range of potentials. In this experiment the currents reversed at ⁇ 31 mV. In seven similar experiments E protein ion channel average reversal potential was +34.5 ⁇ 2.5 mV. Therefore the SARS E protein ion channel is about 7.2 times more permeable to K + ions than Cl ⁇ ions. In seven experiments, the channel conductance varied ranging between 24-166 pS, the average conductance was 83.4 ⁇ 26 pS.
- SARS E protein N-terminal peptide also formed ion channels in KCl solution that were similarly selective for K+ ions compared to the full-length E protein.
- the average channel reversal potential was +39.5 ⁇ 3.6 mV, therefore the channel is about 11 times more permeable to K + ions than Cl ⁇ ions.
- SDS-PAGE of the purified full-length E protein peptide showed bands corresponding to the full-length E protein (Data not shown). Larger bands of varying size up to about 20 kDa were detected, suggesting that SARS E protein may form homo-oligomers.
- SARS E Portein Ion Channel is Blocked by Cimmamoylguamidine and Other Compounds
- the average current across the bilayer was reduced to baseline by 100 ⁇ M cinnamoylguanidine.
- 100 to 200 ⁇ M cinnamoulguanidine reduced the average current across the bilayer about 4 fold.
- 100 to 200 ⁇ M cinnamoylguanidine blocked channels formed by full-length E protein in KCl solutions.
- SARS E protein can form ion channels in lipid bilayer membranes.
- the first 40 amino acids of the N-terminal which contains thg hydrophobic domain of the SARS virus E protein is sufficient for the formation of ion channels on planar lipid bilayers.
- the N-terminal E protein ion channel has the same selectivity and conductance as the full-length E protein ion channel.
- the SARS virus full length E protein ion channel activity and N-terminal domain E protein ion channel activity on planar lipid biiayers in NaCl and KCl solutions was inhibited by addition of between 100 ⁇ M to 200 ⁇ M cinnamoylguanidine to the CIS chamber. Inhibition or partial inhibition of the E protein ion channel activity by cinnamoylguanidine has been observed in seven independent experiments in NaCl solution and four independent experiments in KCl solution.
- coronaviruses encode an E protein with a hydrophobic N-terminus transmembrane domain therefore all coronaviruses E proteins could form ion channels on planar lipid bilayers. This indicates that the E protein could be a suitable target for antiviral drugs and potentially stop the spread of coronavirus from infected host cells. Drugs that block the E protein ion channel could be effective antiviral therapy for the treatment of several significant human and veterinary coronavirus diseases including SARS and the common cold.
- a bio-assay of SARS-CoV E protein function in bacterial cells was developed.
- a synthetic cDNA fragment encoding SARS-CoV E protein was cloned into the expression plasmid pPL451, creating a vector in which E protein expression is temperature inducible, as described in Example 4.
- Inhibition of the growth of E. coli cells expressing E protein at 37° C. was observed as an indicator of p7 ion channel function dissipating the normal Na+ gradient maintained by the bacterial cells.
- Table 7 lists the scores for inhibition of SARS-CoV E protein in the bacterial bio-assay.
- SARS-CoV SARS Antiviral Assay for Testing Compounds Against Replication of SARS Coronavirus
- Monolayers of Vero cells grown in 25 cm 2 flasks were infected at a multiplicity of 1:50 and treated immediately post infection with compounds at two concentrations, 10 uM and 2 uM. A control infected monolayer remained untreated.
- Samples of culture media were taken at 48 hours post infection. Two aliquots from each of the samples (titrations 1 and 2) were serially log diluted and 12 replicates of log dilutions ⁇ 4 to ⁇ 7 added to cells is microtitre plates. Four days later, wells in the microtitre plates were scored for cytopathic effect (CPE) and the titration values calculated based on the number of CPE positive wells at the 4 dilutions. Control titres were 4.8 and 5.9 TCDD 50 ⁇ 10 6 (average 5.35 ⁇ 10 6 )
- trans-3-(1-napthyl)acryloylguanidine and cinnamoylguanidine a decrease in virus titre of approximately 80% was observed at a concentration of 10 uM and a reduction of approximately 50% was seen to persist at 2 ⁇ M trans-3-(1-naphthyl)acsyloylguanidine.
- Table 8 provides Virus titration data presented as % of a control (SARS CoV grown for 48 hours in the absence of compounds).
- a peptide corresponding to the full-length 229E-E protein was synthesized manually using FMOC chemistry and solid phase peptide synthesis. The synsthesis was done at the Biomolecular Resource Facility (John Curtin School of Medical Research, ANU, Australia) using a Symphony R Peptide Synthesiser from Protein Technologies Inc. (Woburn, Miss.
- the crude synthetic peptide was purified using the ProteoPlusTM kit (Qbiogene inc. CA), following manufactures instructions. Briefly, the peptides were diluted in loading buffer (60 mM Tris-HCl pH 8.3, 6M urea, 5% SDS, 10% glycerol, 0.2% Bromophenol blue, ⁇ 100 mM ⁇ -mercaptoethanol) and run on 4-20% gradient polyacrylamide gels (Gradipore, NSW, Australia) in tris-glycine electrophoresis buffer (25 mM Triss 250 mM glycine, 0.1% SDS). The peptides were stained with gel code blue (Promega, NSW) and the bands corresponding to the full-length peptide were excised out of the gel.
- loading buffer 60 mM Tris-HCl pH 8.3, 6M urea, 5% SDS, 10% glycerol, 0.2% Bromophenol blue, ⁇ 100 mM ⁇ -mercaptoethanol
- the gel slice was transferred to the ProteoPLUSTM tube and filled with tris-glycine electrophoresis buffer.
- the tubes were emerged in tris-glycine electrophoresis buffer and subjected to 100 volts for approximately 1 hour.
- the polarity of the electric current was reversed for 1 minute to increase the amount of protein recovered.
- the peptides were harvested and centrifuged at 13,000 rpm for 1 minute.
- the purified peptides were dried in a Speedvac and the weight of the final product was used to calculate the yield.
- Lipid bilayer studies were performed as described elsewhere (Sumtrom, 1996; Miller, 1986).
- a lipid mixture of palmitoyl-oleoyl-phosphatidylethanolamine, palmitoyl-oleoyl-phosphatidylserine and palmitoyl-oleoyl-phosphatidylcholine (5:3:2) (Avanti Polar Lipids, Alabaster, Ala.) was used.
- the lipid mixture was painted onto an aperture of 150-200 ⁇ m in the wall of a 1 ml delrin cup. The aperture separates two chambers, cis and trans, both containing salt solutions at different concentrations.
- the cis chamber was connected to ground and the trans chamber to the input of an Axopatch 200 amplifier. Normally the cis chamber contained either 500 mM NaCl or 500 mM KCl and the trans 50 mM NaCl or 50 mM KCl.
- the bilayer formation was monitored electrically by the amplitude of the current pulse generated by a current ramp. The potentials were measured in the trans chamber with respect to the cis.
- the synthetic peptide was added to the cis chamber and stirred until channel activity was seen. The currents were filtered at 1000 Hz, digitized at 5000 Hz and stored on magnetic disk.
- the 229E E synthetic peptide was dissolved in 2,2,2-trifluorethanol (TFE) at 0.05 mg/ml to 1 mg/ml. 10 ⁇ l of this was added to the cis chamber (1 ml aqueous volume) of the bilayer apparatus, which was stirred via a magnetic “flea”. Ionic currents, indicating channel activity in the bilayer, were typically detected within 15-30 min. After channels were detected the holding potential across the bilayer was varied between ⁇ 100 mV and +100 mV to characterise the size and polarity of current flow and enable the reversal potential to be determined.
- TFE 2,2,2-trifluorethanol
- FIG. 9 shows examples of raw current data for the 229E E ion channel at various holding potentials (cis relative to trans) in asymmetrical KCl solutions (500/50 mM).
- the graph is a representative plot of average bilayer current (pA; y-axis) versus holding potential (mV; x-axis).
- Compound stock solutions were typically prepared at 500 mM in DMSO. This solution was further diluted to 50 mM, or lower concentration in 50% DMSO/50% methanol and 2 ⁇ l of the appropriately diluted compound was added to the cis and/or trans chambers to yield the desired final concentration.
- a bio-asssy of 229E-CoV E-protein function in bacterial cells was developed.
- a synthetic eDNA fragment encoding 229E-CoV E-protein was cloned into the expression plasmid pPL451, creating a vector in which E protein expression is temperature inducible, as described in Example 4.
- Inhibition of the growth of E. coli cells expressing E protein at 37° C. was observed as an indicator of p7 ion channel function dissipating the normal Na+ gradient maintained by the bacterial cells.
- Table 9 list the scores for inhibition of 229E-CoV E-protein in the bacterial bio-assay.
- the infective inoculum was removed and replaced with fresh medium (DMEM supplemented with 10% fetal calf serum) containing various test concentrations of compounds or the appropriate level of solvent used for the compounds (control). Plates were subsequently incubated at 35° C. (in 5% CO 2 ) for 3-5 days post infection, after which time culture supernatant was removed and the cells were stained with 0.1% crystal violet solution in 20% ethanol for 10 minutes. Plaques were counted in all wells and the percentage reduction in plaque number compared to solvent control was calculated. Measurements were performed in duplicate to quadruplicate wells.
- an ELISA assay was developed measuring the release of the viral N-protein into culture supernatants from monolayers of OC43-infected MRC-5 cells (human lung fibroblasts; ATCC CCL-171): First, a virus working stock was prepared by amplification in MRC-5 cells. This was then used to infect confluent monolayers of MRC-5 cells grown in 6-well tissue culture plates by exposure to the virus at an MOI of approx. 0.01 pfu/cell for 1 hour at 35° C. in 5% CO 2 .
- the infective inoculum was removed and replaced with fresh medium (DMEM supplemented with 10% fetal calf serum) containing various test concentrations of compounds or the appropriate level of solvent used for the compounds (control). Plates were subsequently incubated at 35° C. (in 5% CO 2 ) for 5 days post infection, after which time cuitare supernatant was harvested and cellular debris removed by centrifugation at 5000 ⁇ g for 10 minutes. For N-antigen deteetion, 100 ⁇ l samples of clarified culture supernatant were added to duplicate wells of a 96-well Maxi-Sorb plate; 100 ⁇ l of RIPA baffer was added per well with mixing and the plate was covered and incubated at 4° C.
- DMEM fetal calf serum
- a peptide eonresponding to the full-length MHV-A59 E protein (sequence: MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL VLSPSIYLYDRSKQLYKYYNEEMRLPLLEVDDI; accession number NP — 068673) was synthesized manually using FMOC chemistry and solid phase peptide synthesis The synthesis was done at the Biomolecular Resource Facility (John Curtin School of Medical Research, ANU, Australia) using a Symphony R Peptide Synthesiser from Protein Technologies Inc.
- the crude synthetic peptide was purified using the ProteoPlusTM kit (Qbiogene inc. CA), following manufactures instructions. Briefly, the peptides were diluted in loading buffer (60 mM Tris-HCl pH 8.3, 6M urea, 5% SDS, 10% glycerol, 0.2% Bromophenol blue, ⁇ 100 mM, ⁇ -mercaptoethanol) and run on 4-20 % gradient polyacrylamide gels (Gradipore, NSW, Australia) in tris-glycine electrophoresis buffer (25 mM Tris, 250 mM glycine, 0.1 % SDS). The peptides were stained with gel code blue (Promega, NSW) and the bands corresponding to the full-length peptide were excised out of the gel.
- loading buffer 60 mM Tris-HCl pH 8.3, 6M urea, 5% SDS, 10% glycerol, 0.2% Bromophenol blue, ⁇ 100 mM, ⁇ -mercapto
- the gel slice was transferred to the ProteoPLUSTM tube and filled with tris-glycine electrophoresis buffer.
- the tubes were emerged in tris-glycine electrophoresis buffer and subjected to 100 volts for approximately 1 hour.
- the polarity of the electric current was reversed for 1 minute to increase the amount of protein recovered.
- the peptides were harvested and centrifuged at 13,000 rpm for 1 minute.
- the purified peptides were dried in a Speedvac and the weight of the final product was used to calculate the yield.
- Lipid bilayer studies were performed as described elsewhere (Sunstrom, 1996; Miller, 1936).
- a lipid mixture of palmitoyl-oleoyl-phosphatidylethanolamine, palmitoyl-oleoyl-phosphatidylserine and palmitoyl-oleoyl-phosphatidylcholine (5:3:2) (Avanti Polar Lipids, Alabaster, Ala.) was used.
- the lipid mixture was painted onto an aperture of 150-200 ⁇ m in the wall of a 1 ml delrin cup. The aperture separates two chambers, cis and trans, both containing salt solutions at different concentrations.
- the cis chamber was connected to ground and the trans chamber to the input of an Axopatch 200 amplifier. Normally the cis chamber contained either 500 mM MaCl or 500 mM KCl and the trans 50 mM NaCl or 50 mM KCl.
- the bilayer formation was monitored electrically by the amplitude of the current pulse generated by a current ramp. The potentials were measured in the trans chamber with respect to the cis.
- the synthetic peptide was added to the cis chamber and stirred until channel activity was seen. The currents were filtered at 1000 Hz, digitized at 5000 Hz and stored on magnetic disk.
- the MHV E synthetic peptide was dissolved in 2,2,2-trifluoroethanol (TFE) at 0.05 mg/ml to 1 mg/ml. 10 ⁇ l of this was added to the cis chamber (1 ml aqueous volume) of the bilayer apparatus, which was stirred via a magnetic “flea”. Ionic currents, indicating channel activity in the bilayer, were typically detected within 15-30 min. After channels were detected the holding potential across the bilayer was varied between ⁇ 100 mV and +100 mV to characterise the size and polarity of current flow and enable the reversal potential to be determined.
- TFE 2,2,2-trifluoroethanol
- FIG. 11 shows examples of raw current data for the MHV E ion channel at various holding potentials (cis relative to trans) in asymmetrical NaCl solutions (500/50 mM).
- the graph is a representative plot of average bilayer current (pA; y-axis) versus holding potential (mV; x-axis).
- Compound stock solutions were typically prepared at 500 mM in DMSO. This solution was further dilated to 50 mM, or lower ooncenrration in 50% DMSO/50% methanol and 2 ⁇ l of the appropriately diluted compound was added to the cis and/or trans chambers to yield the desired final concentration.
- a bio-assay of MHV E-protein function in bacterial cells was developed.
- a synthetic oDNA fragment encoding MHV E-protein was cloned into the expression plasmid pPL451, creating a vector in which E protein expression is temperature inducible, as described in Example 4.
- Inhibition of the growth of E. coli cells expressing E protein at 37° C. was observed as as indicator of p7 ion channel function dissipating the normal Na+ gradient maintained by the bacterial cells.
- Table 12 lists the scores for inhibition of MHV E protein in the bacterial bio-assay.
- the infective inoculum was removed and replaced with fresh medium (DMEM supplemented with 10% horse serum) containing various test coneentration of compounds or the appropriate level of solvent used for the compounds (control). Plates were subsequently incubated at 37° C. (in 5% CO 2 ) for 16-24 hours post infection, after which time culture snpematant was removed and the cells were stained with 0.1% crystal violet solution in 20% ethanol for 10 minutes. Plaques were counted in all wells and the percentage reduction in plaque number compared to solvent control was calculated. Measurements were performed in duplicate to quadruplicate wells.
- an assay measuring reduction in the number of plaques formed in monolayers of PRCV infected ST cells was developed: Confluent ST cells in 6 well plates were infected with a quaternary passage of porcine respiratory virus (PRCV) strain AR310 at three dilations 10 ⁇ 1 , 50 ⁇ 1 and 10 ⁇ 2 in PBS to provide a range of plaques numbers to coount. 100 ⁇ l of diluted virus was added per well in a volume of 1 ml of media.
- PRCV porcine respiratory virus
- the viral supernatant was removed and 2 ml/well of overlay containing 1% Sealiaque agarose in 1 ⁇ MEM, 5 % FCS was added to each well.
- Compounds to be tested were added to the overlay mixture by diluting the compounds ftom a 0.5M frozen stock to a concentration so that the same volume of compound/solvent would be added to the overlay for each concentration of compound.
- the volume of componnd/solvent never exceeded 0.07% of the volume of the overlay.
- the solvent used to dissolve compounds was DMSO and methanol mixed in equal proportions.
- Compounds were tested for anti-plaque forming activity at four concentrations, 0.1 uM, 1 uM, 10 uM and 20 uM. Quadruplicates were performed at each concentration.
- Controls were performed where the same volume of solvent was added to the overlay.
- the overlay was allowed to set at room temp for 20 mins.
- the plates were then incubated at 37° C. for 7 days.
- the monolayers were then fixed and stained by adding 1 ml/well of 0.5% methylene blue, 4% formaldehyde.
- HCV hepatitis C virus
- Lipid bilayer studies were performed as described elsewhere (Miller, 1986).
- a lipid mixture of palmitoyl-oleoyl-phosphatidylethanolamine, palmitoyl-oleoyl-phosphatidylserine and palmitoyl-oleoyl-phoshatidylcholine (5:3:2) (Avanti Polar Lipids, Alabaster, Ala.) was used.
- the lipid mixture was painted onto an aperture of 150-200 um in the wall of a 1 ml delrin cup.
- the aperture separates two chambers, cis and trans, both containing salt solutions at different concentrations.
- the cis chamber was connected to ground and the trans chamber to the input of an Axopatch 200 amplifier.
- the cis chamber contained 500 mM KCl and the trans 50 mM KCl.
- the bilayer formation was monitored electrically by the amplitude of the current pulse generated by a current ramp. The potentials were measured in the trans chamber with respect to the cis.
- the protein was added to the cis chamber and stirred until channel activity was seen. The currents were filtered at 1000 Hz, digitized at 2000 Hz and stored on magnetic disk.
- the P7 peptide was dissolved in 2,2,2-trifluorethanol (TFE) at 10 mg/ml. 10 ul of this was added to the cis chamber of the bilayer which was stirred. Channel activity was seen within 15-20 min.
- TFE 2,2,2-trifluorethanol
- the channels formed by the P7 peptide were blocked by 5-(N,N-hexamethylene) amiloride (HMA).
- cDp7.coli cDp7.coli
- cDp7.mam codons for expression in E. coli
- cDp7.mam codons ware biased for expression in mammalian cell lines.
- cDp7.coli was cloned into the plasmid pPL451 as a BamHI/EcoRI fragment for expression in E. coli .
- cDp7.mam was cltoned into vectors (for example, pcDNA3. vaccinia virus, pfastBac-1) for expression of p7 in mammalian cell lines.
- VLP virus-like particles
- pcDNAGag HIV-1 Gag protein expressed under control of the T7 promoter
- Example 33 The two methods of detecting p7 ion channel functional activity, described in Examples 33-35, were employed to assay the ability of compounds to inhibit the p7 channel.
- compounds were tested for their ability to inhibit p7 channel activity in planar lipid bilayers.
- compounds were tested for their ability to reduce the number of VLPs released from cells expressing both p7 and HIV-1 Gag.
- HCV p7 Ion Channel Inhibits Bacterial Cell Growth
- a bio-assay of p7 function in bacterial cells was developed.
- the p7-encoding synthetic cDNA fragment cDp7.coli was cloned into the expression plasmid pPL451, creating the vector pPLp7, in which p7 expression is temperature inducible, as described in Example 4.
- Inhibition of the growth of E. coli cells expressing p7 at 37° C. was observed as an indicator of p7 ion channel function dissipating the normal Na+ gradient maintained by the bacterial cells.
- Table 16 lists the scores for inhibition of HCV p7 protein in the bacterial bio-assay.
- Equine Arteritis Virus EAV
- the infective inoculum was removed and nd the cells were overlayed with a 1% sea plaque overlay (Cambrex Bio Science) in MEM containing 10% FCS containing and 10, 5 or 1 ⁇ M of compounds to be tested or the appropriate level of solvent used for the compounds (control). Plates were subsequently incubated at 37° C. (in 5% CO 2 ) for 3 days post infection, after which time culture supernatant was removed and the cells were stained with 0.1% crystal violet solution in 20% ethanol for 10 minutes. Plaques were counted in all wells and the percentage reduction in plaque number compared to solvent control was calculated. Measurements were performed in duplicate to quadruplicate wells.
- the C-terminal 40 amino acids of the M protein of the Dengue virus type 1 strain Singapore S275/90 (Fu et al 1992) (ALRHPGFTVIALFLAHAIGTSITOKGIIFILLMLVTPSMA) was synthesised using the Fmoc method. The synthesis was done on a Symphony Peptide Synthesiser form Protein Technologies Inc (Tucson, Ariz.) as used to give C-terminal amides, the coupling was done with HBTU and hydroxybenzotriazole in N-methylpyrolidone. Each of the synthesis cycle used double coupling and a 4-fold excess of the amino acids. Temporary ⁇ -N Fmoc-protecting groups were removed using 20% piperidine in DMF.
- Lipid bilayer studies were performed as described elsewhere (Sunstrom, 1996; Miller, 1986).
- a lipid mixture of palmiutoyl-oleoyl-phosphatidylethanolamine, palmitoyl-oleoyl-phosphatidylscrine and palmitoyl-oleoyl-phosphatidylcholine (5:3:2) (Avanti Polar Lipids, Alabaster, Ala.) was used.
- the lipid mixture was painted onto an aperture of 150-200 ⁇ m in the wall of a 1 ml delrin cup. The aperture separates two chambers, sis and trans, both containing salt solutions at different concentrations.
- the cis chamber was connected to ground and the trans chamber to the input of an Axopatch 200 amplifier. Normally the cis chamber contained 500 mM KCl and the trans 50 mM KCl. The bilayer formation was monitored electrically by the amplitude of the current pulse generated by a current ramp. The potentials were measured in the trans chamber with respect to the cis. The protein was added to the cis chamber and stirred until channel activity was seen. The currents were filtered at 1000 Hz, digitized at 5000 Hz and stored on magnetic disk.
- the dengue virus M protein C-terminal peptide (DMVC) was dissolved in 2,2,2-trifluorethanol (TFE) at 0.05 mg/ml to 1 mg/ml. 10 ⁇ l of this was added to the cis chamber of the bilayer which was stirred. Channel activity was seen within 15-30 min.
- HMA Hexamethylene Amiloride
- Solutions of 50 mM HMA were prepared by first making a 500 mM solution in DMSO. This solution was further diluted to 50 mM HMA using 0.1 M HCl. 2 ⁇ l of the 50 mM HMA was added to the cis chamber after channel activity was seen. The cis chamber contained 1 ml of solution making the final concentration of HMA 100 ⁇ M.
- the cultures were allowed to grow for 7 days and then Alamar Blue, a fluorescent dye that measures the metabolism of the cultures (red/ox), was added to each culture and the fluorescence value for each culture was measured.
- the negative control without experimental compound or virus was fixed at 100%.
- the positive controls and the cultures with compound were scored by calculating their average fluorescence as a percentage of the negative control. At least six replicate wells were measured for each experimental condition.
- the p24-antigen data for twelve compounds representing various substituted acyl-guanidines was compared with the activity scores obtained for those compounds in the Vpu bacterial assay.
- the data from each assay was initially rank ordered for effectiveness.
- the rank order for the Vpu bacterial assay was determined from all activity scores, the highest score indicating the greatest effectiveness.
- the rank order for the anti-HTV-1 assay was determined based on the overall average value of p24 antigen measured in culture supernatants at all of the drug concentration tested, with the lowest score indicating the greatest effectiveness.
- the two rank orders generated were then compared statistically by generating the Spearman's Rank correlation coefficient.
- the bacterial assay may therefore be a useful tool in screening for compounds that exhibit anti-viral activity.
- Bacterial assay p24 Compound rank order rank order di ⁇ circumflex over ( ) ⁇ 2 (3-bromocinnamoyl)guanidine 1 1 0 3-(trifluoromethyl)cinnamoylguanidine 2 2 0 3-methylcinnamoylguanidine 3 3 0 cinnamoylguanidine 4 4 0 trans-3-(1-napthyl)acryloylguanidine 5.5 7 2.25 6-methoxy-2-naphthoylguanidine 5.5 5 0.25 4-phenylbenzoylguanidine 7 11 16 (5-phenyl-penta-2,4-dienoyl)guanidine 8 9 1 N-(3-phenylpropanoyl)-N′- 9 12 9 phenylguanidine Hexamethylene am
- MHV plaque reduction activity data for 96 compounds screened were sorted from greatest to least percent plaque reduction and rank orders were assigned to the list of compounds. This was performed for the data generated by exposure to both 10 ⁇ M and 1 ⁇ M concentrations of the compounds, giving rise to two rank order lists. Similarly, a rank order list was generated for the MHVE bacterial bioassay scores for the same 96 compounds. Where one or more compounds had the same score, the rank values for that group were averaged.
- This table summarises the Rs and P values generated as a result of the indicated pairwise comparisons between rank orders.
- the rank order comparison of 96 compounds assayed in the bacterial bio-assay and the antiviral assay show that MHVE bacterial assay rank order for the compounds tested is significantly positively correlated with the rank orders generated by the MHV plaque reduction assay.
- the significant correlation between the assays is highly indicative that either assay may be utilised to identify compounds that may be useful.
- the bacterial assay may thereby be a useful tool in screening for compounds that exhibit anti-viral activity.
- 229E plaque reduction activity data for 97 compounds screened against 2.5 ⁇ M compound concentration were sorted from greatest to least percent plaque reduction and rank orders were assigned to the list of compounds.
- a rank order list was generated for the 229E E bacterial bioassay scores for the same 97 compounds. Where one or more compounds had the same scores the rank values for that group were averaged.
- This table summarises the Rs and P values generated as a result of the indicated pairwise comparisons between rank orders.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Molecular Biology (AREA)
- Pulmonology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- AIDS & HIV (AREA)
- Tropical Medicine & Parasitology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Compositions Of Macromolecular Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Furan Compounds (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Quinoline Compounds (AREA)
- Pyridine Compounds (AREA)
- Heterocyclic Compounds That Contain Two Or More Ring Oxygen Atoms (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/553,239 US20130035328A1 (en) | 2003-06-26 | 2012-07-19 | Antiviral compounds and methods |
| US14/615,616 US20150313909A1 (en) | 2003-06-26 | 2015-02-06 | Antiviral compounds and methods |
| US15/602,526 US10472332B2 (en) | 2003-06-26 | 2017-05-23 | Antiviral compounds and methods |
| US16/554,990 US11192863B2 (en) | 2003-06-26 | 2019-08-29 | Antiviral compounds and methods |
Applications Claiming Priority (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2003903251A AU2003903251A0 (en) | 2003-06-26 | 2003-06-26 | Antiviral compounds and methods |
| AU2003903251 | 2003-06-26 | ||
| AU2003903850 | 2003-07-25 | ||
| AU2003903850A AU2003903850A0 (en) | 2003-07-25 | 2003-07-25 | Anti-coronavirus compounds and methods |
| AU2003904692 | 2003-08-29 | ||
| AU2003904692A AU2003904692A0 (en) | 2003-08-29 | Anti-flavivirus compounds and methods | |
| AU2004902902 | 2004-05-31 | ||
| AU2004902902A AU2004902902A0 (en) | 2004-05-31 | Anti-flavivirus compounds and methods | |
| PCT/AU2004/000866 WO2004112687A2 (en) | 2003-06-26 | 2004-06-26 | Antiviral acylguanidine compounds and methods |
| US56229605A | 2005-12-22 | 2005-12-22 | |
| US13/553,239 US20130035328A1 (en) | 2003-06-26 | 2012-07-19 | Antiviral compounds and methods |
Related Parent Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/562,296 Continuation US20070099968A1 (en) | 2004-06-26 | 2004-06-24 | Antiviral compounds and methods |
| PCT/AU2004/000866 Continuation WO2004112687A2 (en) | 2003-06-26 | 2004-06-26 | Antiviral acylguanidine compounds and methods |
| US56229605A Continuation | 2003-06-26 | 2005-12-22 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/615,616 Continuation US20150313909A1 (en) | 2003-06-26 | 2015-02-06 | Antiviral compounds and methods |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20130035328A1 true US20130035328A1 (en) | 2013-02-07 |
Family
ID=33545379
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/553,239 Abandoned US20130035328A1 (en) | 2003-06-26 | 2012-07-19 | Antiviral compounds and methods |
| US14/615,616 Abandoned US20150313909A1 (en) | 2003-06-26 | 2015-02-06 | Antiviral compounds and methods |
| US15/602,526 Expired - Lifetime US10472332B2 (en) | 2003-06-26 | 2017-05-23 | Antiviral compounds and methods |
| US16/554,990 Expired - Fee Related US11192863B2 (en) | 2003-06-26 | 2019-08-29 | Antiviral compounds and methods |
Family Applications After (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/615,616 Abandoned US20150313909A1 (en) | 2003-06-26 | 2015-02-06 | Antiviral compounds and methods |
| US15/602,526 Expired - Lifetime US10472332B2 (en) | 2003-06-26 | 2017-05-23 | Antiviral compounds and methods |
| US16/554,990 Expired - Fee Related US11192863B2 (en) | 2003-06-26 | 2019-08-29 | Antiviral compounds and methods |
Country Status (8)
| Country | Link |
|---|---|
| US (4) | US20130035328A1 (https=) |
| EP (2) | EP1646371A4 (https=) |
| JP (1) | JP5030587B2 (https=) |
| KR (1) | KR101153254B1 (https=) |
| BR (1) | BRPI0411900B8 (https=) |
| CA (1) | CA2529949C (https=) |
| NZ (1) | NZ544671A (https=) |
| WO (1) | WO2004112687A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9440926B2 (en) | 2005-06-24 | 2016-09-13 | Biotron Limited | Antiviral compounds and methods |
Families Citing this family (45)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP5030587B2 (ja) | 2003-06-26 | 2012-09-19 | バイオトロン・リミテッド | 抗ウイルスアシルグアニジン化合物および方法 |
| US7745442B2 (en) * | 2003-08-20 | 2010-06-29 | Parion Sciences, Inc. | Methods of reducing risk of infection from pathogens |
| AU2013205388B2 (en) * | 2005-06-24 | 2016-05-05 | Biotron Limited | Antiviral compounds and methods |
| GB0526240D0 (en) * | 2005-12-22 | 2006-02-01 | Novartis Ag | Organic compounds |
| GB0526244D0 (en) | 2005-12-22 | 2006-02-01 | Novartis Ag | Organic compounds |
| US20100254942A1 (en) * | 2007-08-03 | 2010-10-07 | Biotron Limited | Hepatitis c antiviral compositions and methods |
| AU2013219202B2 (en) * | 2007-08-03 | 2016-12-08 | Biotron Limited | Hepatitis C antiviral compositions and methods |
| US20110217265A1 (en) * | 2008-09-23 | 2011-09-08 | Glenn Jeffrey S | Screening for Inhibitors of HCV Amphipathic Helix (AH) Function |
| ES2524356T3 (es) | 2010-07-22 | 2014-12-05 | Gilead Sciences, Inc. | Métodos y compuestos para tratar infecciones provocadas por virus Paramyxoviridae |
| TWI687432B (zh) | 2014-10-29 | 2020-03-11 | 美商基利科學股份有限公司 | 絲狀病毒科病毒感染之治療 |
| DK3785717T3 (da) | 2015-09-16 | 2022-03-21 | Gilead Sciences Inc | Fremgangsmåder til behandling af coronaviridae-infektioner |
| WO2018081863A1 (en) * | 2016-11-04 | 2018-05-11 | University Of Wollongong | 6-SUBSTITUTED DERIVATIVES OF HEXAMETHYLENE AMILORIDE AS INHIBITORS OF uPA AND USES THEREOF |
| US10682368B2 (en) | 2017-03-14 | 2020-06-16 | Gilead Sciences, Inc. | Methods of treating feline coronavirus infections |
| CA3059777C (en) | 2017-05-01 | 2023-02-21 | Gilead Sciences, Inc. | Crystalline forms of (s)-2-ethylbutyl 2-(((s)-(((2r,3s,4r,5r)-5-(4-aminopyrrolo[2,1-f] [1,2,4]triazin-7-yl)-5-cyano-3,4-dihydroxytetrahydrofuran-2-yl)methoxy)(phenoxy) phosphoryl)amino)propanoate |
| WO2019014247A1 (en) | 2017-07-11 | 2019-01-17 | Gilead Sciences, Inc. | COMPOSITIONS COMPRISING POLYMERASE RNA INHIBITOR AND CYCLODEXTRIN FOR THE TREATMENT OF VIRAL INFECTIONS |
| JP2023512656A (ja) | 2020-01-27 | 2023-03-28 | ギリアード サイエンシーズ, インコーポレイテッド | SARS CoV-2感染を治療するための方法 |
| JP2021138619A (ja) * | 2020-03-02 | 2021-09-16 | フマキラー株式会社 | 抗コロナウイルス剤 |
| KR20220153619A (ko) | 2020-03-12 | 2022-11-18 | 길리애드 사이언시즈, 인코포레이티드 | 1'-시아노 뉴클레오사이드의 제조 방법 |
| US20230127965A1 (en) * | 2020-03-30 | 2023-04-27 | Thomas Jefferson University | Methods for treating, ameliorating, or preventing viral infections |
| CA3172483A1 (en) | 2020-04-06 | 2021-10-14 | Scott Ellis | Inhalation formulations of 1'-cyano substituted carbanucleoside analogs |
| TW202203941A (zh) | 2020-05-29 | 2022-02-01 | 美商基利科學股份有限公司 | 瑞德西韋之治療方法 |
| PE20230618A1 (es) | 2020-06-24 | 2023-04-14 | Gilead Sciences Inc | Analogos de nucleosido de 1'-ciano y usos de los mismos |
| US20220054575A1 (en) * | 2020-08-19 | 2022-02-24 | Natreon, Inc. | Protection against coronavirus infection by extracts and extract components |
| IL300412A (en) | 2020-08-24 | 2023-04-01 | Gilead Sciences Inc | Phospholipid compounds and their uses |
| EP3960165A1 (en) * | 2020-08-25 | 2022-03-02 | Fondation EspeRare | Nhe-1 inhibitors for the treatment of coronavirus infections |
| IL300453A (en) | 2020-08-27 | 2023-04-01 | Gilead Sciences Inc | COMPOSITIONS AND METHODS FOR THE TREATMENT OF VIRAL INFECTIONS |
| TW202344257A (zh) | 2020-10-16 | 2023-11-16 | 美商基利科學股份有限公司 | 磷脂化合物及其用途 |
| WO2022251318A1 (en) | 2021-05-26 | 2022-12-01 | Gilead Sciences, Inc. | Phospholipid formulations of 1'-cyano substituted carba-nucleoside analogs |
| CA3226836A1 (en) | 2021-08-06 | 2023-02-09 | Intervet International B.V. | Method of treating veterinary viral diseases |
| AU2022328698B2 (en) | 2021-08-18 | 2025-02-20 | Gilead Sciences, Inc. | Phospholipid compounds and methods of making and using the same |
| KR20240154646A (ko) | 2022-03-02 | 2024-10-25 | 길리애드 사이언시즈, 인코포레이티드 | 바이러스성 감염 치료를 위한 화합물 및 방법 |
| KR20240154647A (ko) | 2022-03-02 | 2024-10-25 | 길리애드 사이언시즈, 인코포레이티드 | 바이러스성 감염 치료를 위한 화합물 및 방법 |
| WO2023167055A1 (ja) * | 2022-03-03 | 2023-09-07 | 日本曹達株式会社 | 抗ウイルス剤 |
| JP2025508941A (ja) | 2022-03-03 | 2025-04-10 | ギリアード サイエンシーズ, インコーポレイテッド | 抗ウイルス化合物並びにその作製及び使用方法 |
| KR20240155326A (ko) | 2022-03-03 | 2024-10-28 | 길리애드 사이언시즈, 인코포레이티드 | 항바이러스 화합물 및 이의 제조와 사용 방법 |
| US20240009220A1 (en) | 2022-06-06 | 2024-01-11 | Gilead Sciences, Inc. | Methods for treatment of viral infections |
| WO2024006376A1 (en) | 2022-06-29 | 2024-01-04 | Gilead Sciences, Inc. | Solid forms of a nucleoside analogue and uses thereof |
| EP4547665A1 (en) | 2022-06-30 | 2025-05-07 | Gilead Sciences, Inc. | Solid forms of a nucleoside analogue and uses thereof |
| US12357577B1 (en) | 2024-02-02 | 2025-07-15 | Gilead Sciences, Inc. | Pharmaceutical formulations and uses thereof |
| WO2024112712A1 (en) * | 2022-11-21 | 2024-05-30 | Henderson Theodore | Treatment using an antiviral compound and spironolactone |
| WO2024173458A1 (en) | 2023-02-16 | 2024-08-22 | Gilead Sciences, Inc. | Phospholipid compounds and methods of making and using the same |
| US20250090537A1 (en) | 2023-08-31 | 2025-03-20 | Gilead Sciences, Inc. | Antiviral compounds and methods of making and using the same |
| AU2024330988A1 (en) | 2023-08-31 | 2026-02-19 | Gilead Sciences, Inc. | Antiviral compounds and methods of making and using the same |
| WO2025054278A1 (en) | 2023-09-06 | 2025-03-13 | Gilead Sciences, Inc. | Solid forms of a nucleoside analogue and uses thereof |
| US20250109157A1 (en) | 2023-09-28 | 2025-04-03 | Gilead Sciences, Inc. | Compounds and methods for treatment of viral infections |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE2531343A1 (de) * | 1975-07-14 | 1977-02-10 | Henkel & Cie Gmbh | Antimikrobielle mittel |
| US4496573A (en) * | 1982-08-24 | 1985-01-29 | William H. Rorer, Inc. | 1-Pyridylmethyl-3-acyl guanidines |
| DE4301739A1 (de) * | 1993-01-22 | 1994-07-28 | Sauer Professor Dr Gerhard | Guanidin-Derivate zur Behandlung von Primär-Tumoren und viralen Erkrankungen |
| US5567734A (en) * | 1994-01-25 | 1996-10-22 | Hoechst Aktiengesellschaft | Phenyl-substituted alkylcarboguanidides carrying perfluoroalkyl groups, a process for their preparation, their use as a medicament or a diagnostic agent, and a medicament containing them |
| US5719169A (en) * | 1993-07-31 | 1998-02-17 | Hoechst Aktiengesellschaft | Substituted benzoylguanidines, their use as a medicament or diagnostic, and medicament containing them |
| US5733934A (en) * | 1995-04-18 | 1998-03-31 | Hoechst Aktiengesellschaft | Antiarrythmic and cardioprotective substituted indenoylguanidines |
| US6011059A (en) * | 1997-12-24 | 2000-01-04 | Bristol-Myers Squibb Company | Acyl guanidine sodium/proton exchange inhibitors and method |
| WO2000021538A1 (en) * | 1998-10-12 | 2000-04-20 | The Australian National University | A method of modulating ion channel functional activity |
| US7041702B1 (en) * | 1997-10-21 | 2006-05-09 | Scion Pharmaceuticals, Inc. | Pharmaceutically active compounds and methods of use |
Family Cites Families (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2734904A (en) * | 1956-02-14 | Xcxnhxc-nh | ||
| BE639386A (https=) * | 1962-10-30 | |||
| FR1435379A (fr) * | 1964-07-30 | 1966-04-15 | American Cyanamid Co | Procédé pour stabiliser le chlorure de polyvinyle rigide contre les effets de la lumière |
| US3527758A (en) * | 1967-04-13 | 1970-09-08 | Merck & Co Inc | Process for the preparation of pyrazinoylguanidines from a pyrazinoic azide and a guanidine |
| DE2006186A1 (de) | 1970-02-11 | 1971-08-19 | Huebner Vamag | Verfahren zum Einsetzen eines Sitz ringes fur den Absperrkorper einer Armatur |
| DD200618A1 (de) * | 1981-10-05 | 1983-05-25 | Manfred Augustin | Verfahren zur herstellung von neuen n-aroyl-und hetaroylimiden |
| US4894376A (en) * | 1988-02-26 | 1990-01-16 | Trustees Of The University Of Pennsylvania | Methods of treating diseases characterized by hyperexcitability of neurons |
| JPH0789859A (ja) * | 1990-04-05 | 1995-04-04 | Celtrix Pharmaceut Inc | ピラジン誘導体を含む薬剤学的組成物と眼の新血管新生を阻止する治療法 |
| IN177137B (https=) * | 1992-12-11 | 1996-11-16 | Hoechst India | |
| JPH0725768A (ja) * | 1993-07-09 | 1995-01-27 | Mitsubishi Chem Corp | 血管内膜肥厚抑制剤 |
| DE4415873A1 (de) * | 1994-05-05 | 1995-11-09 | Hoechst Ag | Substituierte bizyklische Heteroaroylguanidine, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| DE4421536A1 (de) * | 1994-06-20 | 1995-12-21 | Hoechst Ag | Perfluoralkylgruppen tragende phenylsubstituierte Alkenylcarbonsäure-guanidine, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| JPH08225513A (ja) * | 1994-12-21 | 1996-09-03 | Kanebo Ltd | ナフトイルグアニジン誘導体 |
| AT408330B (de) | 1995-01-27 | 2001-10-25 | Colop Stempelerzeugung Skopek | Selbstfärbestempel |
| DE19518796A1 (de) * | 1995-05-22 | 1996-11-28 | Hoechst Ag | Fluorphenylsubstituierte Alkenylcarbonsäure-guanidine, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| DE19527305A1 (de) * | 1995-07-26 | 1997-01-30 | Hoechst Ag | Substituierte Zimtsäureguanidide, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| US5628984A (en) | 1995-07-31 | 1997-05-13 | University Of North Carolina At Chapel Hill | Method of detecting lung disease |
| JPH0967332A (ja) * | 1995-08-29 | 1997-03-11 | Yamanouchi Pharmaceut Co Ltd | N−(2−プロペノイル)グアニジン誘導体 |
| DE19621482A1 (de) * | 1996-05-29 | 1997-12-04 | Hoechst Ag | Substituierte 1-Naphthoylguanidine, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| DE19622222A1 (de) * | 1996-06-03 | 1997-12-04 | Hoechst Ag | Verwendung von Inhibitoren des zellulären Na·+·/H·+·-Exchangers (NHE) zur Herstellung eines Medikament zur Normalisierung der Serumlipide |
| AUPO545297A0 (en) * | 1997-03-04 | 1997-03-27 | Fujisawa Pharmaceutical Co., Ltd. | Guanidine derivatives |
| IL126276A0 (en) * | 1997-09-24 | 1999-05-09 | Hoechst Marion Roussel De Gmbh | The use of an inhibitor of the na+/H+ exchanger for the production of a medicament for the treatment or prophylaxis of disorders of the central nervous system |
| DK1032556T3 (da) * | 1997-10-21 | 2008-03-25 | Wyeth Corp | Farmaceutisk aktive forbindelser og anvendelsesfremgangsmåder |
| JP2002508507A (ja) * | 1997-12-18 | 2002-03-19 | セプラコア インコーポレーテッド | 新規な生物学的標的および創薬リード構造体の同時同定方法 |
| DE19849722A1 (de) * | 1998-10-28 | 2000-05-04 | Aventis Pharma Gmbh | Substituierte Phenyl-alkenoylguanidine, Verfahren zu ihrer Herstellung, ihre Verwendung als Medikament oder Diagnostikum sowie sie enthaltendes Medikament |
| DE19859727A1 (de) * | 1998-12-23 | 2000-06-29 | Aventis Pharma Gmbh | Die Verwendung von Hemmern des Natrium-Wasserstoff-Austauschers zur Herstellung eines Medikaments zur Verhinderung von altersbedingten Organ-Dysfunktionen, altersbedingten Erkrankungen zur Lebensverlängerung |
| AUPQ223999A0 (en) * | 1999-08-16 | 1999-09-09 | University Of Sydney, The | Intracellular feedback controls in the diagnosis and treatment of human disease |
| AUPS022802A0 (en) * | 2002-01-31 | 2002-02-21 | Macfarlane Burnet Institute For Medical Research And Public Health Limited, The | Anti-viral compounds |
| JP5030587B2 (ja) | 2003-06-26 | 2012-09-19 | バイオトロン・リミテッド | 抗ウイルスアシルグアニジン化合物および方法 |
| EP2826770B1 (en) * | 2005-06-24 | 2018-09-12 | Biotron Limited | Acylguanidine compounds with antiviral activity |
-
2004
- 2004-06-26 JP JP2006515560A patent/JP5030587B2/ja not_active Expired - Lifetime
- 2004-06-26 CA CA2529949A patent/CA2529949C/en not_active Expired - Lifetime
- 2004-06-26 WO PCT/AU2004/000866 patent/WO2004112687A2/en not_active Ceased
- 2004-06-26 NZ NZ544671A patent/NZ544671A/en not_active IP Right Cessation
- 2004-06-26 BR BRPI0411900A patent/BRPI0411900B8/pt not_active IP Right Cessation
- 2004-06-26 EP EP04737487A patent/EP1646371A4/en not_active Withdrawn
- 2004-06-26 KR KR1020057024860A patent/KR101153254B1/ko not_active Expired - Fee Related
- 2004-06-26 EP EP13164504.6A patent/EP2617709B8/en not_active Expired - Lifetime
-
2012
- 2012-07-19 US US13/553,239 patent/US20130035328A1/en not_active Abandoned
-
2015
- 2015-02-06 US US14/615,616 patent/US20150313909A1/en not_active Abandoned
-
2017
- 2017-05-23 US US15/602,526 patent/US10472332B2/en not_active Expired - Lifetime
-
2019
- 2019-08-29 US US16/554,990 patent/US11192863B2/en not_active Expired - Fee Related
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE2531343A1 (de) * | 1975-07-14 | 1977-02-10 | Henkel & Cie Gmbh | Antimikrobielle mittel |
| US4496573A (en) * | 1982-08-24 | 1985-01-29 | William H. Rorer, Inc. | 1-Pyridylmethyl-3-acyl guanidines |
| DE4301739A1 (de) * | 1993-01-22 | 1994-07-28 | Sauer Professor Dr Gerhard | Guanidin-Derivate zur Behandlung von Primär-Tumoren und viralen Erkrankungen |
| US5719169A (en) * | 1993-07-31 | 1998-02-17 | Hoechst Aktiengesellschaft | Substituted benzoylguanidines, their use as a medicament or diagnostic, and medicament containing them |
| US5567734A (en) * | 1994-01-25 | 1996-10-22 | Hoechst Aktiengesellschaft | Phenyl-substituted alkylcarboguanidides carrying perfluoroalkyl groups, a process for their preparation, their use as a medicament or a diagnostic agent, and a medicament containing them |
| US5733934A (en) * | 1995-04-18 | 1998-03-31 | Hoechst Aktiengesellschaft | Antiarrythmic and cardioprotective substituted indenoylguanidines |
| US7041702B1 (en) * | 1997-10-21 | 2006-05-09 | Scion Pharmaceuticals, Inc. | Pharmaceutically active compounds and methods of use |
| US6011059A (en) * | 1997-12-24 | 2000-01-04 | Bristol-Myers Squibb Company | Acyl guanidine sodium/proton exchange inhibitors and method |
| WO2000021538A1 (en) * | 1998-10-12 | 2000-04-20 | The Australian National University | A method of modulating ion channel functional activity |
Non-Patent Citations (3)
| Title |
|---|
| Iwanowicz et al. Bioorganic & Medicinal Chemistry Letters 12 (2002) 2931-2934. * |
| Lamb et al. Virology (1997), 229(1), 1-11 * |
| Lamb et al. Virology (1997), 229(1), 1-11. * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9440926B2 (en) | 2005-06-24 | 2016-09-13 | Biotron Limited | Antiviral compounds and methods |
| US10683263B2 (en) | 2005-06-24 | 2020-06-16 | Biotron Limited | Antiviral compounds and methods |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2007508234A (ja) | 2007-04-05 |
| CA2529949A1 (en) | 2004-12-29 |
| BRPI0411900A (pt) | 2006-09-19 |
| US20150313909A1 (en) | 2015-11-05 |
| US11192863B2 (en) | 2021-12-07 |
| CA2529949C (en) | 2013-08-06 |
| US20170260147A1 (en) | 2017-09-14 |
| EP2617709A1 (en) | 2013-07-24 |
| BRPI0411900B8 (pt) | 2021-05-25 |
| BRPI0411900B1 (pt) | 2018-11-21 |
| KR101153254B1 (ko) | 2012-07-02 |
| US10472332B2 (en) | 2019-11-12 |
| KR20060103086A (ko) | 2006-09-28 |
| EP2617709B8 (en) | 2022-12-21 |
| EP1646371A4 (en) | 2010-09-22 |
| JP5030587B2 (ja) | 2012-09-19 |
| EP1646371A2 (en) | 2006-04-19 |
| EP2617709B1 (en) | 2022-11-16 |
| NZ544671A (en) | 2009-02-28 |
| WO2004112687A3 (en) | 2007-07-12 |
| WO2004112687A2 (en) | 2004-12-29 |
| US20190389816A1 (en) | 2019-12-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11192863B2 (en) | Antiviral compounds and methods | |
| JP2010202674A (ja) | 病原体感染を処置するためのチロシンキナーゼインヒビターの組成物および使用 | |
| WO1997028802A1 (en) | Inhibition of viral replication | |
| US20120064062A1 (en) | Inhibitors of bacterial plasminogen activators | |
| CN107922343A (zh) | 用于抑制病毒感染的组合物和方法 | |
| US20070099968A1 (en) | Antiviral compounds and methods | |
| US11376306B2 (en) | Peptides and uses therefor as antiviral agents | |
| AU2004248859C1 (en) | Antiviral acylguanidine compounds and methods | |
| JP2009242247A (ja) | ヒト免疫不全ウイルス感染阻害剤およびエイズの治療薬または予防薬 | |
| CN101111475A (zh) | 抗病毒化合物及方法 | |
| HK1187600A (en) | Guanidine derivatives as antiviral agents | |
| JP4624562B2 (ja) | イオンチャネル機能活性の調節方法 | |
| KR20050092103A (ko) | 이온 채널 활성을 억제하는 이미노슈가 유도체의 용도 | |
| KR20230158020A (ko) | 외막형 바이러스 감염의 치료에 이용하기 위한 화합물 | |
| KR101209344B1 (ko) | 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 | |
| US20230190769A1 (en) | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents | |
| US20230390235A1 (en) | Therapeutic agent for covid-19 | |
| EP0684818B1 (en) | Method of reversing resistance of hiv-1 strains to zidovudine | |
| WO2018189566A1 (en) | Use of a chemical compound as a therapeutic agent | |
| EP0879055A1 (en) | Inhibition of viral replication |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |