US20090239796A1 - Methods for treating diabetes and reducing body weight - Google Patents
Methods for treating diabetes and reducing body weight Download PDFInfo
- Publication number
- US20090239796A1 US20090239796A1 US12/064,216 US6421606A US2009239796A1 US 20090239796 A1 US20090239796 A1 US 20090239796A1 US 6421606 A US6421606 A US 6421606A US 2009239796 A1 US2009239796 A1 US 2009239796A1
- Authority
- US
- United States
- Prior art keywords
- xaa
- exendin
- agonist
- pmoles
- liter
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/34—Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
Definitions
- the present invention relates to the fields of medicine, health and nutrition. More particularly, the present invention relates to methods and compositions for treating diabetes and reducing body weight or altering body composition in a subject.
- Obesity is a condition that affects millions of Americans. Recent statistics from the Center for Disease Control (“CDC”) estimate that approximately 65% of all Americans are overweight or obese and it is generally believed that these numbers are increasing. Being obese or overweight may substantially increase the risk of morbidity from hypertension; dyslipidemia; type 2 diabetes; coronary heart disease; stroke; gallbladder disease; osteoarthritis; sleep apnea and respiratory problems; and endometrial, breast, prostate, and colon cancers. Higher body weights are also associated with increases in all-cause mortality. Furthermore, being obese or overweight may cause a person to have negative self-image about him or her self.
- CDC Center for Disease Control
- BMI Body Mass Index
- Lean body mass is comprised of muscle, vital organs, bone, connective and other non-fatty tissues in the body. Lean body mass is 50-60% muscle by weight, with the majority of the muscle being skeletal muscle. Lean body mass is highly active, metabolically and physiologically, and it is believed that loss of lean body mass is deleterious to the health of an individual. An increase in lean body mass helps increase body metabolism and so aids in weight loss and the maintenance of any weight reduction. Thus, during the process of weight loss, it is desirable that the loss of lean body mass be prevented or minimized.
- Caloric restriction regardless of its form, is often associated with catabolism of body protein resulting in a negative nitrogen balance and a loss of lean body mass.
- Protein supplemented diets have been used as a means of lessening nitrogen loss during caloric restriction.
- Protein-sparing modified fasting has been reported to be effective in weight reduction in adolescents; however, these diets may produce only moderate nitrogen sparing.
- Diabetes mellitus is a serious metabolic disease that is defined by the presence of chronically elevated levels of blood glucose (hyperglycemia). This state of hyperglycemia is the result of a relative or absolute lack of activity of the peptide hormone, insulin. Insulin is produced and secreted by the ⁇ cells of the pancreas. Insulin is reported to promote glucose utilization, protein synthesis, and the formation and storage of carbohydrate energy as glycogen. Glucose is stored in the body as glycogen, a form of polymerized glucose, which may be converted back into glucose to meet metabolism requirements. Under normal conditions, insulin is secreted at both a basal rate and at enhanced rates following glucose stimulation, all to maintain metabolic homeostasis by the conversion of glucose into glycogen.
- diabetes mellitus encompasses several different hyperglycemic states. These states include Type I (insulin-dependent diabetes mellitus or IDDM) and Type II (non-insulin dependent diabetes mellitus or NIDDM) diabetes.
- IDDM insulin-dependent diabetes mellitus
- NIDDM non-insulin dependent diabetes mellitus
- the hyperglycemia present in individuals with Type I diabetes is associated with deficient, reduced, or nonexistent levels of insulin which are insufficient to maintain blood glucose levels within the physiological range.
- Treatment of Type I diabetes involves administration of replacement doses of insulin, generally by a parenteral route.
- the hyperglycemia present in individuals with Type II diabetes is initially associated with normal or elevated levels of insulin; however, these individuals are unable to maintain metabolic homeostasis due to a state of insulin resistance in peripheral tissues and liver and, as the disease advances, due to a progressive deterioration of the pancreatic ⁇ cells which are responsible for the secretion of insulin.
- initial therapy of Type II diabetes may be based on diet and lifestyle changes augmented by therapy with oral hypoglycemic agents such as sulfonylureas. Insulin therapy is often required, however, especially in the latter states of the disease, in order to produce some control of hyperglycemia and minimize complications of the disease.
- Exendins are peptides that are found in the saliva of the Gila-monster, a lizard endogenous to Arizona, and the Mexican Beaded Lizard. Exendin-3 is present in the saliva of Heloderma horridum , and exendin-4 is present in the saliva of Heloderma suspectum (Eng, J., et al., J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al., J. Biol. Chem ., 267:7402-05, 1992).
- exendins have some amino acid sequence similarity to several members of the glucagon-like peptide family, with the highest amino acid identity, 53%, being to GLP-1 (Goke, et al, J. Biol. Chem., 268:19650-55, 1993).
- Exendin-4 is a potent GLP-1 receptor agonist in vitro.
- the peptide also stimulates somatostatin release and inhibits gastrin release in isolated stomachs (Goke, et al., J. Biol. Chem., 268:19650-55, 1993; Schepp, et al., Eur. J. Pharmacol., 69:183-91, 1994; Eissele, et al., Life Sci., 55:629-34, 1994).
- Exendin-3 and exendin-4 were found to be GLP-1 receptor agonists in stimulating cAMP production in, and amylase release from, pancreatic acinar cells (Malhotra, R., et al., Regulatory Peptides, 41:149-56, 1992; Raufman, et al., J. Biol. Chem., 267:21432-37, 1992; Singh, et al., Regulatory Peptides., 53:47-59, 1994).
- the use of the insulinotropic activities of exendin-3 and exendin-4 for the treatment of diabetes mellitus and the prevention of hyperglycemia has been proposed (Eng, U.S. Pat. No. 5,424,286). Twice daily and sustained administration of exendins has been proposed (U.S. Pat. No. 6,924,264 and U.S. Pat. App. No. 20040053819).
- a method for reducing body weight comprising administering to a subject in need of reducing body weight, or a subject who desires to reduce their body weight, a formulation comprising an amount of at least one exendin, exendin agonist or exendin analog agonist sufficient to maintain an average plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the average plasma concentration of the exendin, exendin agonist, or exendin analog agonist is from about 25 pg/ml to about 600 pg/ml, from about 170 pg/ml to about 600 pg/ml or from about 170 pg/ml to about 350 pg/ml.
- the average plasma concentration is at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 85 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml at least about 250 pg/ml, at least about 300 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml at least about 550 pg/ml, or at least about 600 pg/ml.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, equivalent to that observed with a given concentration of exendin-4.
- the subject suffers from diabetes or impaired glucose tolerance.
- Another embodiment provides a method for reducing body weight in a subject comprising administering to a subject in need of reducing body weight, or desirous of reducing body weight an amount of a formulation containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain a minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is maintained at greater than or equal to about 25 pg/ml, greater than or equal to about 65 pg/ml, greater than or equal to about 75 pg/ml, greater than or equal to about 85 pg/ml, greater than or equal to about 100 pg/ml, greater than or equal to about 150 pg/ml, greater than or equal to about 170 pg/ml, greater than or equal to about 175 pg/ml, greater than or equal to about 200 pg/ml, greater than or equal to about 225 pg/ml, greater than or equal to about 250 pg/ml, greater than or equal to about 300 pg/ml, greater than or equal to about 350 pg/ml, greater than or equal to about 400 pg/ml, greater than or equal to about 450 pg/ml, greater than or equal to about 500 p
- the concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonists is greater than 40 pmoles/liter, but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, equivalent to that observed with a given concentration of exendin-4.
- the subject suffers from diabetes or impaired glucose tolerance.
- FIG. 1 For example reducing the ratio of body fat to lean tissue in an individual comprising administering to a subject in need of altering body composition, or desirous of altering body composition, an amount of a formulation containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain either an average or a minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the average or minimum plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, at least about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml, or about 600 pg/ml.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. alteration in body composition, equivalent to that observed with a given concentration of exendin-4.
- the subject suffers from diabetes or impaired glucose tolerance.
- Additional embodiments provide a method for treating diabetes, for example, type I, type II, or gestational diabetes, in a subject in need thereof, comprising administering to said subject an amount of a formulation containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain either an average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the subject in need thereof is also obese or desirous or in need of reducing body weight.
- the average or minimum plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, at least about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, 170 pg/ml, 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml, or about 600 pg/ml.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, lowering fasting glucose, reducing postprandial glucose excursions, etc., equivalent to that observed with a given concentration of exendin-4.
- Still another embodiment provides a method for reducing hemoglobin A 1c (HbA 1c ) in a subject in need thereof comprising administering to said subject an amount of a formulation containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain either an average or a minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the subject in need thereof is also obese or desirous or need of reducing body weight.
- the average or sustained plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, at least about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml or about 600 pg/ml.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. reducing HbA 1c , equivalent to that observed with a given concentration of exendin-4.
- Yet another embodiment provides a means for reducing the increase in postprandial blood glucose as compared to preprandial or fasting blood glucose in subjects in need thereof, for example subjects with type I, type II or gestational diabetes, or as compared to subjects not receiving the methods, formulations or medicaments described herein, comprising administering to said subject an amount of a formulation or medicament containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain either an average or a minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the average or minimum plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml, or about 600 pg/ml.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the subject in need thereof is obese or is desirous or in need of reducing body weight.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. reducing postprandial circulating glucose excursions, equivalent to that observed with a given concentration of exendin-4.
- a further embodiment provides a method for reducing overall daily average blood glucose concentration in a subject in need thereof, for example a subject with type I, type II or gestational diabetes, comprising administering to said subject an amount of a formulation or medicament containing at least one exendin, exendin analog or exendin analog agonist, sufficient to maintain either an average or a minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the average or minimum plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 85 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 300 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the subject in need thereof is obese or is desirous or in need of reducing body weight.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. reducing average daily blood glucose concentrations, equivalent to that observed with a given concentration of exendin-4.
- any of the above average or minimum plasma concentrations of at least one exendin, exendin agonist, or exendin analog agonist is maintained between about 12 hours, one day, one week or one month and about one year.
- any of the above average or sustained plasma concentrations are maintained for at least about 3 days, at least about 5 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about one month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months or at least about one year.
- the formulations disclosed herein can be administered by any appropriate means known in the art, for example, intravenously, transmucosally, intranasally, orally, intramuscularly, subcutaneously, transdermally, by inhalation or by pulmonary administration.
- the formulation is a sustained release or long acting formulation, that is, the formulation releases the at least one exendin, exendin agonist, or exendin analog agonist into the body over a given period of time, for example about 1 day, about 1 week or about 1 month.
- the formulation is administered once a day, every other day, once a week, every other week, every third week, once a month, every other month, or every third month.
- the formulation further comprises a biocompatible polymer and sugar, for example sucrose.
- the formulation is a long-acting formulation containing 5% (w/w) of at least one exendin, exendin agonist or exendin analog agonist, which is administered once a week at a dose of 2.0 mg.
- the formulation long-acting formulation containing 5% (w/w) of at least one exendin, exendin agonist or exendin analog agonist is administered once a week at a dose of 0.8 mg.
- Any formulation for sustained release of the exendin, exendin agonist or exendin analog agonist can be used, including, but not limited to, U.S. Pat. No. 6,828,303; U.S.
- any of the methods or medicaments disclosed herein result in the subject's body weight being reduced by at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40% or at least 50%.
- any of the methods disclosed herein result in the subject's body weight being reduced by at least about 5 pounds or 2 kg, at least about 10 pounds or 5 kg, at least about 20 pounds or 10 kg, at least about 30 pounds or 15 kg, at least about 40 pounds or 20 kg, at least about 50 pounds or 25 kg, at least about 75 pounds or 35 kg, at least about 100 pounds or 50 kg, at least about 125 pounds or 55 kg, at least about 150 pounds or 75 kg, at least about 175 pounds or 80 kg, or at least about 200 pounds or 100 kg.
- practice of any of the methods disclosed herein results in weight reduction, wherein less than about 40%, less than about 20%, less than about 10%, less than about 5%, less than about 2%, less than about 1%, or 0% of the weight loss is due to loss of mean body mass.
- HbA 1c is reduced by at least 0.5%, at least 1.0%, at least 1.5%, at least 2.0%, at least 2.5% or at least 3.0%. In further embodiments, HbA 1c , is reduced to less than 7.5%, less than 7.0%, less than 6.5%, less than 6.0%, less than 5.5%, less than 5.0%, less than 4.5% or less than 4.0%. In still another embodiment, average postprandial glucose levels do not exceed 175 mg/dl, 170 mg/dl, 165 mg/dl, 160 mg/dl, 155 mg/dl or 150 mg/dl.
- overall average daily blood glucose concentration is less than 175 mg/dl, less than 165 mg/dl, less than 160 mg/dl, less than 155 mg/dl, less than 150 mg/dl, less than 145 mg/dl, less than 140 mg/dl, less than 135 mg/dl, less than 130 mg/dl, less than 125 mg/dl, less than 120 mg/dl, less than 110 mg/dl or less than 100 mg/dl.
- fasting glucose levels are reduced to less than 200 mg/dl, less than 190 mg/dl, less than 180 mg/dl, less than 170 mg/dl, less than 160 mg/dl, less than 150 mg/dl, less than 140 mg/dl, less than 130 mg/dl, less than 120 mg/dl, less than 110 mg/dl, less than 100 mg/dl, less than 90 mg/dl, or less than 80 mg/dl.
- exendin, exendin analog or exendin analog agonist is one or more of exendin-3, exendin-4 or an exendin analog agonist.
- the exendin, exendin analog or exendin analog agonist is not exendin-3 or exendin-4.
- exendin analog agonists are those described by any one of SEQ ID NOs 3 to 22.
- the subject is overweight or obese.
- methods disclosed herein further provide that the exendin, exendin analog or exendin analog agonist is co-administered with one or more oral diabetic agents.
- agents include, but are not limited to metformin, a sulphonylurea (SU), a thiazolidinedione (TZD) or any combination thereof.
- a subject need of reducing body weight has a body mass index (BMI) of greater than or equal to about 25, while in other embodiments the subject has a BMI of greater than or equal to about 30.
- BMI body mass index
- the subject in need of or desirous of reducing body weight suffers from diabetes, insulin resistance or impaired glucose tolerance, while in other embodiments the subject does not suffer from diabetes, insulin resistance or impaired glucose tolerance.
- the subject may be a human or an animal, for example a mammal, and in particular a domestic animal.
- the domestic animal is a companion animal, such as a dog, cat, etc.
- the domestic animal is a livestock species, such as sheep, cattle, swine, horses, buffalo, poultry, etc.
- One particular embodiment provides a method for reducing body weight comprising administering by weekly subcutaneous injections to a subject in need of, or desirous of weight reduction, a long acting or sustained release formulation comprising an amount of at least one compound selected from the group consisting of an exendin, an exendin agonist, and an exendin analog agonist, sufficient to maintain an average plasma concentration of the exendin, exendin agonist, or exendin analog agonist of at least 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the average plasma concentration is between about 25 pg/ml and about 600 pg/ml, between about 100 pg/ml and about 600 pg/ml, between about 170 pg/ml and about 600 pg/ml, between about 200 pg/ml and about 600 pg/ml, and between about 225 pg/ml and about 600 pg/ml.
- the average plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml or about 600 pg/ml.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, equivalent to that observed with a given concentration of exendin-4.
- Another particular embodiment provides, a method for reducing body weight comprising administering by weekly subcutaneous injections to a subject in need or, or desirous of weight reduction, a long acting or sustained release formulation comprising an amount of at least one compound selected from the group consisting of an exendin, an exendin agonist, and an exendin analog agonist, sufficient to maintain a minimum plasma concentration of the exendin, exendin agonist, or exendin analog agonist of at least 50 pg/ml for at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the minimum plasma concentration is between about 25 pg/ml and about 600 pg/ml, between about 100 pg/ml and about 600 pg/ml, between about 170 pg/ml and about 600 pg/ml, between about 200 pg/ml and about 600 pg/ml, and between about 225 pg/ml and about 600 pg/ml.
- the minimum plasma concentration of the at least one exendin, exendin agonist or exendin analog agonist is at least about 25 pg/ml, about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml or about 600 pg/ml.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, equivalent to that observed with a given concentration of exendin-4.
- the subject suffers from diabetes or impaired glucose tolerance.
- a formulation comprising an amount of at least one exendin, exendin agonist or exendin analog agonist sufficient to mediate the effects or treat the diseases or disorders disclosed herein. Also provided is the use of at least one exendin, exendin agonist or exendin analog agonist to manufacture a medicament to mediate the effects or treat the diseases or disorders disclosed herein.
- FIG. 2 Glycemic parameters.
- the present disclosure is directed to compositions, medicaments and methods for reducing body weight, maintaining body weight, reducing body weight gain, altering body composition, treating diabetes, lower fasting glucose, lowering HbA 1c , reducing average daily blood glucose, or lowering postprandial glucose in a subject in need or desirous thereof, by chronically administering an exendin an exendin agonist or an exendin analog agonist.
- the methods contemplate the chronic or sustained administration of an effective amount of an exendin, an exendin agonist or an exendin analog agonist to a subject to affect the desired results as described herein.
- exendin, exendin agonist, or exendin analog agonist may be in the form of a peptide, a pro-drug, or as a pharmaceutical salt or salts thereof.
- prodrug refers to a compound that is a drug precursor that, following administration, releases the drug in vivo via some chemical or physiological process, for example, proteolytic cleavage, or upon reaching an environment of a certain pH.
- the methods disclosed can be used on any individual in need of such methods or individuals for whom practice of the methods is desired. These individuals may be any mammal including, but not limited to, humans, dogs, horses, cows, pigs, and other commercially valuable or companion animals.
- the present application provides methods for reducing weight in a subject desirous or in need thereof, where the method comprises the administration of an amount of an exendin, exendin agonist, or an exendin analog agonist effective to cause weight reduction in the subject.
- the method comprises the chronic or sustained administration of an amount of an exendin, an exendin agonist, or an exendin analog agonist effective to cause weight reduction to the subject.
- the weight reduction is due to a reduction in body fat or adipose tissue without a corresponding reduction in lean body mass or muscle mass.
- the reduction in body weight due to loss of body fat is greater than the reduction in weight due to loss of lean body mass or muscle mass.
- the reduction in body fat as compared to lean tissue or muscle is based on an absolute weight basis while in another embodiment it is based a percent of weight lost basis.
- the loss of visceral fat is greater than the loss of non-visceral fat.
- the loss of non-visceral fat is greater than the loss of visceral fat.
- the application provides methods for altering body composition, for example by reducing the ratio of fat to lean tissue, reducing the percent body fat, or increasing the percent lean tissue in an individual.
- weight reduction refers to a decrease in a subject's body weight.
- the decrease in body weight is a result of a preferential decrease in the body fat of the subject.
- the loss of visceral fat is greater than the loss of non-visceral fat. In another embodiment, the loss of non-visceral fat is greater than the loss of visceral fat.
- the methods described herein will, in various embodiments, reduce the subject's weight by at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 10%, at least about 15, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, or at least about 70% compared to the subject's body weight prior to initiation of the methods disclosed herein.
- the weight reduction occurs over a period of about 1 week, about 2 weeks, about 3 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 1 year or more.
- the subject may lose about 5, about 6, about 7, about 8, about 9, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50 about 100, about 125, about 150, about 175, about 200 or more pounds.
- a reduction in weight can be measured using any reproducible means of measurement.
- weight reduction can be measured by calculating a subject's body mass index and comparing that subject's BMI over a period of time. Body mass index can be calculated using any method available, for example by using a nomogram or similar device.
- the exendin, exendin agonist or exendin analog agonists is given by chronic administration.
- chronic administration refers to administration of the agent(s) in a continuous mode as opposed to an acute mode, so as to maintain the plasma concentration needed to obtain the desired therapeutic effect (activity) for an extended period of time.
- chronic administration refers to the administration of the exendin or exendin agonist in a continuous mode, so as to maintain a plasma concentration at or above the therapeutically effective or desired amount.
- such chronic administration maintains an average plasma exendin, exendin agonist or exendin analog agonist concentration of at least about 25 pg/ml, at least about 50 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 85 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 300 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml for an extended period of time.
- the average concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- such chronic administration maintains a minimum plasma exendin, exendin agonist or exendin analog agonist concentration at or above about 25 pg/ml, at or above about 50 pg/ml, at or above about 65 pg/ml, at or above about 75 pg/ml, at or above about 85 pg/ml, at or above about 100 pg/ml, at or above about 150 pg/ml, at or above about 170 pg/ml, at or above about 175 pg/ml, at or above about 200 pg/ml, at or above about 225 pg/ml, at or above about 250 pg/ml, at or above about 300 pg/ml, at or above about 350 pg/ml, at or above about 400 pg/ml, at or above about 450 pg/ml, at or above about 500 pg/ml, at or above about 550 pg/ml or at or above about 600
- the minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- chronic administration maintains the plasma concentration, either average or minimum, of the exendin, exendin agonist or exendin analog agonist for a period of at least about 12 hours or at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, or at least about 7 days.
- chronic administration maintains the plasma concentration of the exendin, exendin agonist or exendin analog agonist for at least 1, at least about 2, at least about 3, or at least about 4 weeks or at least about 1, at least about 2, or at least about 3 months.
- the exendin, exendin agonist or exendin analog agonist is administered by continuous mode.
- continuous mode refers to the introduction of the exendin, exendin agonist or exendin analog agonist into the body, for example, the circulation, and not the means of administration.
- chronic administration by a continuous mode can result from continuous infusion, either intravenously or subcutaneously; the use of a pump or metering system, either implanted or external, for continuous or intermittent delivery; or by the use of an extended release, slow release, sustained release or long acting formulation that is administered, for example, once daily, twice weekly, weekly, twice monthly, monthly, every other month or every third month.
- the average or minimum plasma level need not be reached immediately upon administration of the formulation, but may take anywhere from hours to days to weeks to be reached. Once reached, the average or minimum plasma concentration is then maintained for the desired period of time to have its therapeutic effect.
- a “subject in need thereof” is a subject who is overweight or obese.
- a “desirous” subject is a subject who wishes to reduce their body weight or alter their body composition, for example, by lessening their ratio of fat to lean tissue.
- the subject is an obese or overweight subject.
- an “overweight subject” refers to a subject with a body mass index (BMI) greater than 25, or a BMI between 25 and 30. It should be recognized, however, that meaning of overweight is not limited to individuals with a BMI of greater than 25, but refers to any subject where weight loss is desirable or indicated for medical or cosmetic reasons.
- any subject, who needs or wishes to reduce body weight is included in the scope of “obese.”
- subjects who are insulin resistant, glucose intolerant, or have any form of diabetes mellitus e.g., type 1, 2 or gestational diabetes
- a subject in need thereof is obese. It should be noted, however, that the method described herein may be applied to subjects who do not have and/or have not been diagnosed with impaired glucose tolerance, insulin resistance or diabetes mellitus.
- a subject in need thereof may include subjects with diabetes, impaired glucose tolerance, insulin resistance, or subjects unable to auto-regulate blood glucose.
- HbA 1c or A 1c or glycated hemoglobin or glycohemoglobin as commonly used in the art refers to glycosylated hemoglobin.
- methods for reducing body weight, reducing the ratio of fat to lean tissue or reducing BMI comprising chronically administering an amount of an exendin, an exendin agonist or an exendin analog agonist to a subject in need or desirous thereof.
- the weight loss attributed to loss of fat or adipose tissue is greater than the weight loss due to lean tissue.
- the percent of weight reduction due to loss of lean body mass is less than about 40%, less that about 30%, less than about 20%, less than about 10%, less than about 5%, less than about 2%, less than about 1%, or 0% of the total weight reduction.
- the exendin, exendin agonist or exendin analog agonist is administered in an extended release, slow release, sustained release or long acting formulation.
- the exendin or exendin agonist is administered in a polymer-based sustained release formulation.
- Such polymer-based sustained release formulations are described, for example, in U.S. patent application Ser. No. 09/942,631, filed Aug. 31, 2001 (now U.S. Pat. No. 6,824,822) and related application Ser. No. 11/312,371, filed Dec. 21, 2005; U.S. Provisional Application No. 60/419,388, filed Oct. 17, 2002 and related U.S. patent application Ser. Nos. 10/688,786 and 10/688,059 filed Oct. 17, 2003; U.S.
- exendin, exendin agonist or exendin analog agonist can be administered by any method available.
- the exendin or exendin agonist is administered subcutaneously.
- Also provided are methods for reducing body weight comprising administering an amount of an exendin or exendin agonist sufficient to achieve an average or minimum circulating blood plasma level of an exendin, an exendin agonist, or an exendin analog agonist of at least about 50 pg/ml for a period of at least about 12 hours, 1 day, 2 days, 3 days, 1 week, 2 weeks, 3 weeks, 1 month, 3 months, or 6 months.
- the methods comprise the administration of an exendin, an exendin agonist or an exendin analog agonist sufficient to achieve an average or minimum circulating blood plasma concentration of at least about 50 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml of the exendin, exendin agonist or exendin analog agonist.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, equivalent to that observed with a given concentration of exendin-4.
- the average or minimum circulating blood plasma concentrations are achieved for a period of about 2, about 3, about 4, about 5, about 6, or about 7 days. In a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16 weeks. In still a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 5, about 6, about 7, about 8, about 9, about 10, about 11, or about 12 months. Any method for determining circulating blood concentrations of exendin or exendin agonist may be employed with the claimed methods.
- Also provided are methods for treating diabetes for example, type I, type II or gestational diabetes, comprising administering an amount of an exendin or exendin agonist sufficient to achieve an average or minimum circulating blood plasma level of an exendin, an exendin agonist, or an exendin analog agonist of at least about 50 pg/ml for a period of at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- an exendin or exendin agonist sufficient to achieve an average or minimum circulating blood plasma level of an exendin, an exendin agonist, or an exendin analog agonist of at least about 50 pg/ml for a period of at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about
- the methods comprise the administration of an exendin, an exendin agonist or an exendin analog agonist sufficient to achieve an average or minimum circulating blood plasma concentration of at least about 25 pg/ml, at least about 50 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml of the exendin, exendin agonist or exendin analog agonist.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. lowering fasting glucose, reducing postprandial glucose excursion, reducing HbA 1c , etc., equivalent to that observed with a given concentration of exendin-4.
- Another embodiment provides a method of reducing circulating glucose levels, and in particular fasting glucose, without inducing weight loss, reducing appetite, slowing gastric emptying, lowering postprandial glucose levels, or any combination thereof, by administering an exendin, exendin agonist or exendin analog agonist to maintain an average or minimum blood plasma level of the exendin, exendin agonist or exendin analog agonist of between about 25 pg/ml to about 100 pg/ml or between about 50 pg/ml and about 100 pg/ml.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. glucose lowering, especially fasting glucose, equivalent to that observed with a given concentration of exendin-4.
- the average or minimum circulating blood plasma concentrations are achieved for a period of about 2, about 3, about 4, about 5, about 6, or about 7 days.
- the average or minimum plasma concentrations are achieved for a period of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16 weeks.
- the average or minimum plasma concentrations are achieved for a period of about 5, about 6, about 7, about 8, about 9, about 10, about 11, or about 12 months.
- administration of the exendin, exendin agonist or exendin analog agonist as described herein results in a decrease in fasting glucose levels, postprandial glucose levels or both. Any method for determining circulating blood concentrations of exendin or exendin agonist may be employed with the claimed methods.
- Additional embodiments provide methods for the reduction of HbA 1c , overall daily average blood glucose concentration, fasting blood glucose and/or postprandial blood glucose by administering, for example to a subject in need of a reduction in HbA 1c , daily average blood glucose, or fasting glucose, an amount of an exendin or exendin agonist sufficient to achieve an average or minimum circulating blood plasma level of an exendin, an exendin agonist, or an exendin analog agonist of at least about 50 pg/ml for a period of at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the methods comprise the administration of an exendin, an exendin agonist or an exendin analog agonist sufficient to achieve an average or minimum circulating blood plasma concentration of at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml of the exendin, exendin agonist or exendin analog agonist.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. lowering HbA 1c , equivalent to that observed with a given concentration of exendin-4.
- the average or minimum circulating blood plasma concentrations are achieved for a period of about 2, about 3, about 4, about 5, about 6, or about 7 days. In a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16 weeks. In still a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 5, about 6, about 7, about 8, about 9, about 10, about 11, or about 12 months. Any method for determining circulating blood concentrations of exendin or exendin agonist may be employed with the claimed methods. In further embodiments, the subject is in need of or desirous of a reduction in body weight.
- This method comprises administering an amount of an exendin or exendin agonist sufficient to achieve an average or minimum circulating blood plasma level of an exendin, an exendin agonist, or an exendin analog agonist of at least about 50 pg/ml for a period of at least about 12 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 3 months, or at least about 6 months.
- the methods comprise the administration of an exendin, an exendin agonist or an exendin analog agonist sufficient to achieve an average or minimum circulating blood plasma concentration of at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml of the exendin, exendin agonist or exendin analog agonist.
- the average or minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average or minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. reducing postprandial blood glucose excurions, average daily blood glucose, etc., equivalent to that observed with a given concentration of exendin-4.
- the average or minimum circulating blood plasma concentrations are achieved for a period of about 2, about 3, about 4, about 5, about 6, or about 7 days. In a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16 weeks. In still a further embodiment, the average or minimum plasma concentrations are achieved for a period of about 5, about 6, about 7, about 8, about 9, about 10, about 11, or about 12 months. Any method for determining circulating blood concentrations of exendin or exendin agonist may be employed with the claimed methods.
- the circulating plasma exendin, exendin agonist or exendin analog agonist concentrations may be maintained at the average given plasma concentration or within about 10%, about 15%, about 20%, or about 25% of the average given plasma concentration. In other embodiments, the circulating plasma concentrations are maintained at the average given concentration or at about 98%, about 97%, about 96%, about 95%, about 90%, about 80%, about 70%, or about 60% of the average given concentration. Plasma concentrations of the exendin or exendin agonist can be measured using any method available to the skilled artisan.
- the administration of the exendin, exendin agonist, or exendin analog agonist is effective to sustain a minimum circulating plasma exendin, exendin agonist or exendin analog agonist of at least about 50 pg/ml for at least about 12, about 24 or about 48 hours.
- the methods comprise the administration of an exendin, an exendin agonist, or an exendin analog agonist sufficient to sustain a minimum circulating plasma concentration of at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml of the exendin, exendin agonist or exendin analog agonist.
- the minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- the minimum concentration of the exendin, exendin agonist or exendin analog agonist is sustained for a period of at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, or at least about 7 days.
- minimum circulating plasma concentrations are sustained for at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15 or at least about 16 weeks.
- the minimum circulating plasma levels are sustained for at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11 or at least about 12 months. Plasma concentrations of the exendin, exendin agonist or exendin analog agonist can be measured using any method available to the skilled artisan.
- the administration the exendin, exendin agonist, or exendin analog agonist is effective to maintain an average plasma exendin, exendin agonist or exendin analog agonist concentrations of at least about 50 pg/ml for at least about 12, at least about 24 or at least about 48 hours.
- the methods comprise the administration of an exendin, an exendin agonist, or an exendin analog agonist sufficient to sustain an average circulating plasma concentration of at least about 25 pg/ml, at least about 65 pg/ml, at least about 75 pg/ml, at least about 100 pg/ml, at least about 150 pg/ml, at least about 170 pg/ml, at least about 175 pg/ml, at least about 200 pg/ml, at least about 225 pg/ml, at least about 250 pg/ml, at least about 350 pg/ml, at least about 400 pg/ml, at least about 450 pg/ml, at least about 500 pg/ml, at least about 550 pg/ml or at least about 600 pg/ml.
- the average concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- the average concentration of the exendin, exendin agonist or exendin analog agonist is sustained for a period of at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, or at least about 7 days.
- average circulating plasma concentrations are sustained for at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15 or at least about 16 weeks.
- the average circulating plasma levels are sustained for at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11 or at least about 12 months. Plasma concentrations of the exendin, exendin agonist or exendin analog agonist can be measured using any method available to the skilled artisan.
- the methods disclosed herein are useful in maintaining levels of an exendin, exendin agonist, or exendin analog that control fasting blood glucose with limited effects on, no detectable effects on or without inducing weight loss, reducing appetite, slowing gastric emptying, or exerting postprandial glucose level control.
- the methods disclosed herein are useful in controlling fasting blood glucose levels without inducing weight loss.
- Patient populations benefiting from controlled fasting blood glucose levels without accompanying weight loss include, but are not limited to, elderly patients, patients with human immunodeficiency virus (HIV) infections, or other patients where weight loss is contraindicated.
- HIV human immunodeficiency virus
- the methods disclosed herein are useful in maintaining an exendin, exendin agonist, or exendin analog at levels, either average or minimum, of between 10 pg/ml and 150 pg/ml, between 10 pg/ml and 100 pg/ml, between 50 pg/ml and 100 pg/ml, or between 50 pg/ml and 150 pg/ml to control fasting blood glucose without inducing weight loss.
- the methods disclosed herein are useful in maintaining an exendin, exendin agonist, or exendin analog at levels, either average or minimum, of between 10 pg/ml and 150 pg/ml, between 10 pg/ml and 100 pg/ml, between 50 pg/ml and 100 pg/ml, or between 50 pg/ml and 150 pg/ml to control fasting blood glucose with no detectable effects on or without inducing weight loss, reducing appetite, slowing gastric emptying, and/or exerting postprandial glucose level control.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of an exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. glucose lowering, and in particular fasting glucose, equivalent to that observed with a given concentration of exendin-4.
- the exendin, exendin agonist or exendin analog agonist is continuously administered.
- the exendin, exendin agonist, or exendin analog agonist is administered in a slow release, extended release, sustained release or long acting formulation.
- the exendin, exendin agonist or exendin analog agonist can be administered once per day, every other day, three times per week, twice per week, once per week, twice a month, monthly, every other month or every three months.
- the length of the total time of administration of the exendin, exendin agonist, or exendin agonist analog can be determined by the amount of weight reduction desired.
- the exendin, exendin agonist, or exendin analog agonist can be administered according to the methods disclosed herein for a period sufficient to achieve a given target weight, BMI or body composition after which administration can be terminated.
- the dose of the exendin, exendin agonist, or exendin analog agonist can be decreased to a level to maintain the desired target.
- the amount of exendin, exendin agonist, or exendin analog agonist can be increased or, if previously terminated, the administration can be reinitiated.
- the exendin, exendin agonist or exendin analog agonist can be administered according to the methods disclosed herein for a period sufficient to achieve a target HbA 1c , a target fasting glucose level, a target overall daily blood glucose concentration, etc. after which the plasma concentration of the exendin, exendin agonist or exendin analog agonist may be reduced to a maintenance level or discontinued. If discontinued, the administration can be resumed later if necessary.
- the exendin, exendin agonist or exendin analog agonist is administered according to methods disclosed herein for a period sufficient to lower or stabilize fasting glucose levels, reducing or eliminating high or higher than desired fasting glucose levels.
- methods disclosed herein further provide that the exendin, exendin analog or exendin analog agonist is co-administered with one or more oral diabetic agents.
- agents include, but are not limited to metformin, a sulphonylurea (SU), a thiazolidinedinoe (TZD) or any combination thereof.
- exemplary agents include pioglitazone, rosiglitazone, glibenclamide, gliclazide, glimepiride, glipizide, gliquidone, chlorpropamide, and tolbutamide.
- the exendin, exendin agonist or exendin analog agonist can also be con-administered with insulin. Co-administration can be achieved by any suitable means or dosing regimen.
- methods are provided for the decrease in the frequency and/or severity of gastrointestinal effects associated with exendin, exendin agonist, or exendin analog agonist administration comprising chronically administering an exendin, exendin agonist or exendin analog agonist by any of the methods described herein.
- chronic administration beginning with low or lower doses can induce a tolerance to the administered exendin, exendin agonist, or exendin analog agonist such that high doses that typically elicit unacceptable frequency and/or severity of gastrointestinal effects can be administered to the subject with reduced or absent gastrointestinal effects.
- chronic administration can be initiated with suboptimal dosing of the exendin, exendin agonist or exendin analog agonist using, for example, a formulation that releases the administered exendin, exendin agonist or exendin analog agonist over a period of time where the formulation is administered weekly. Over a period of weeks, the plasma levels of the administered exendin, exendin agonist or exendin analog will increase and eventually achieve a plateau concentration. In some embodiments, this plateau is at a concentration that could not be tolerated due to adverse gastrointestinal effects if administered in a single or initiating dose. Any suitable extended-release formulation and administration regimen can be used to achieve the plateau effect.
- each successive sustained release dose increases the concentration of the agent or agents in the patient, wherein a therapeutically effective concentration of agent or agents is achieved in the patient.
- each successive sustained release dose is administered such that its sustained phase overlaps with the sustained phase of the previous dose.
- exendin includes naturally occurring exendin peptides that are found in the salivary secretions of the Gila monster. Exendins of particular interest include exendin-3 [SEQ ID NO:2], which is present in the salivary secretions of Heloderma horridum , and exendin-4 [SEQ ID NO:1], a 39 amino acid peptide which is naturally present in the salivary secretions of Heloderma suspectum (Eng, J., et al., J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al., J. Biol. Chem., 267:7402-05, 1992).
- Exendin-4 Animal testing of exendin-4 has shown that its ability to lower blood glucose persists for several hours.
- Exendin-4 as it occurs in the salivary secretions of the Gila monster, is an amidated peptide. It should be appreciated, however, that the exendins, exendin agonists and exendin analog agonists for use in the methods described herein are not limited to the amidated forms, but include that acid form or any other physiologically active form of the molecule.
- Exendin-4 was first thought to be a component of the venom. It now appears that exendin-4 is devoid of toxicity, and that it instead is made in salivary glands in the Gila monster.
- the exendins have some amino acid sequence similarity to several members of the glucagon-like peptide family, with the highest amino acid identity, 53%, being to GLP-1[7-36]NH 2 (Goke, et al., J. Biol. Chem., 268:19650-55, 1993).
- Exendin “agonist activity” as used herein means having the biological activity of an exendin, but it is understood that the activity of the agonist can be either less potent or more potent than the native exendin.
- Other exendin agonists include, e.g., chemical compounds specifically designed to activate that receptor or receptors at which an exendin exerts its affect on body weight, body composition, blood glucose, etc.
- exendin analog agonist refers to an exendin analog having agonist activity.
- insulinotropic refers to an ability to stimulate the release of insulin into the circulation.
- insulin resistance describes a subnormal biological response to a given concentration of insulin (i.e., decreased glucose transport across the cell membrane in response to insulin).
- pharmaceutically acceptable carrier or adjuvant refers to a non-toxic carrier or adjuvant that may be administered to a patient together with a compound of the invention, and which does not destroy the pharmacological activity thereof.
- therapeutically or pharmaceutically effective or “therapeutically or pharmaceutically effective amount or concentration” refers to an amount of the compound described herein required to reduce body weight, treat obesity, alter body composition, treat diabetes, treat impaired glucose tolerance, reduce fasting glucose, reduce postprandial glucose levels, lower HbA 1c , or reduce average daily blood glucose in a subject.
- exendin agonists and exendin analog agonists may have a biological activity greater or lesser than a reference exendin such as exendin-4.
- concentration of the exendin, exendin agonist or exendin agonist analog is relative to a reference exendin. That is, the concentration is that of the reference exendin or a concentration of the exendin agonist or exendin analog agonist necessary to achieve a biological or therapeutic effect equivalent to the reference exendin.
- the reference exendin is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the amount of the exendin, exendin agonists or exendin analog necessary to achieve a given effect, such as weight loss, alteration of body composition, or reduction of blood glucose or HbA 1c , that is achieved by a given dose of exendin-4.
- pharmaceutically refers to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human.
- pharmaceutically acceptable carrier includes any and all such solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
- type-2 diabetes mellitus refers to a disease, also known as non-insulin-dependent diabetes mellitus (NIDDM) or adult-onset diabetes mellitus (AODM), in which a patient has elevated concentrations of blood sugar levels.
- NIDDM non-insulin-dependent diabetes mellitus
- AODM adult-onset diabetes mellitus
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (NH 2 )
- HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (NH 2 )
- DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (NH 2 )
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (NH 2 )
- HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS g.
- HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP (NH 2 ) h.
- b exendin 3 (NH 2 ) [SEQ ID NO:2].
- c exendin 4 (9-39)(NH 2 ) [SEQ ID NO:4].
- d exendin 4 (NH 2 ) [SEQ ID NO:1].
- e helospectin I [SEQ ID NO:5].
- f helospectin II [SEQ ID NO:6].
- g helodermin (NH 2 ) [SEQ ID NO:7].
- h Q 8 , Q 9 helodermin (NH 2 ) [SEQ ID NO:8].
- exendin agonist is meant a compound which elicits a biological activity of a exendin reference peptide, preferably having a potency better than the exendin reference peptide, or within five orders of magnitude (plus or minus) of potency compared to the exendin reference peptide, for example, 4, 3, 2, or 1 order of magnitude, when evaluated by art-known measures such as receptor binding/competition studies.
- the term refers to a compound which elicits a biological effect similar to that of the exendin reference peptide, for example a compound (1) having activity in glucose lowering and/or weight loss assays similar to the exendin reference peptide, and (2) which optionally binds specifically in a reference receptor assay or in a competitive binding assay with labeled exendin reference peptide.
- the agonists will bind in such assays with an affinity of less than 1 ⁇ M, and more preferably with an affinity of less than 1-5 nM.
- Such agonists may comprise a polypeptide comprising an active fragment of a reference peptide or a small chemical molecule.
- the exendin agonist is a peptide.
- exendin agonists do not include GLP-1 and variants, analogs and derivatives thereof.
- the reference peptide is exendin-4.
- exendin analog agonists include exendin analogs with agonist activity in which one or more naturally occurring amino acids are inserted, eliminated or replaced with another amino acid(s).
- exendin analogs are peptide analogs of exendin-4.
- the methods of reducing body weight, reducing BMI, altering body composition, treating diabetes, reducing fasting glucose, or reducing postprandial glucose comprise the chronic administration of an exendin analog, preferably an analog having agonist activity, to a subject in need thereof.
- Exendin analogs include peptides that are encoded by polynucleotides that express biologically active exendin analogs with agonist activity, as defined herein.
- exendin analogs may be peptides containing one or more amino acid substitutions, additions or deletions, compared with reference exendin, for example, exendin-4.
- the number of substitutions, deletions, or additions is 30 amino acids or less, 25 amino acids or less, 20 amino acids or less, 15 amino acids or less, 10 amino acids or less, 5 amino acids or less or any integer between 30 and 1, inclusive.
- the substitutions include one or more conservative substitutions.
- a “conservative” substitution denotes the replacement of an amino acid residue by another, biologically active, similar residue.
- conservative substitutions include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine, or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, and the like.
- the following table lists illustrative, but non-limiting, conservative amino acid substitutions.
- exendin analogs include the peptides described herein which have been chemically derivatized or altered, for example, peptides with non-natural amino acid residues (e.g., taurine, ⁇ - and ⁇ -amino acid residues and D-amino acid residues), C-terminal functional group modifications, such as amides, esters, and C-terminal ketone modifications and N-terminal functional group modifications, such as acylated amines, Schiff bases, or cyclization, as found, for example, in the amino acid pyroglutamic acid.
- non-natural amino acid residues e.g., taurine, ⁇ - and ⁇ -amino acid residues and D-amino acid residues
- C-terminal functional group modifications such as amides, esters
- C-terminal ketone modifications such as acylated amines, Schiff bases, or cyclization, as found, for example, in the amino acid pyroglutamic acid.
- Such derivativatized peptides include exendins, exendin agonists and exendin analog agonists conjugated to one or more polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, etc.), or by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala.
- PEG polyethylene glycol
- fatty acid chains e.g., stearyl, palmitoyl, octanoyl, etc.
- polyamino acids such as poly-his, poly-arg, poly-lys, and poly-ala.
- exendins, exendin agonists and exendin analog agonists can also include small molecule substituents, such as short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
- the polymer molecules will typically have a molecular weight ranging from about 500 to about 20,000 Daltons.
- polymer-conjugations and small molecule substituent modifications may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the polypeptides.
- Substitution of one or more amino acids with lysine, aspartic acid, glutamic acid, or cysteine may provide additional sites for derivatization. See, e.g., U.S. Pat. Nos. 5,824,784 and 5,824,778.
- the polypeptides may be conjugated to one, two, or three polymer molecules.
- the polymer molecules may be linked to an amino, carboxyl, or thiol group, and may be linked by N or C terminus, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine. Alternatively, the polymer molecules may be linked with diamine and dicarboxylic groups. In one embodiment, the polypeptides are conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid.
- exendin analog sequences having greater than 50% sequence identity, greater than 60% sequence identity, greater than 70% sequence identity, greater than 80% sequence identity, greater than 90% sequence identity, greater than 95% sequence identity, greater than 97% sequence identity or any percent identity between 50% and 97%, to a reference exendin peptide, for example, (1) SEQ ID NOS: 1 and 2; and (2) to truncated sequences thereof, wherein said truncated sequences containing at least 10 amino acids, at least 20 amino acids, at least 25 amino acids, at least 30 amino acids, at least 35 amino acids, at least 38 amino acids or N-1 amino acids where N equals the number of amino acids in the full length or reference peptide or protein.
- sequence identity refers to a comparison made between two molecules using standard algorithms well known in the art.
- the algorithm for calculating sequence identity for the present invention is the Smith-Waterman algorithm, where an exendin, for example SEQ ID NO:1 [i.e., exendin-4], is used as the reference sequence to define the percentage identity of a comparison peptide over its length.
- exendin for example SEQ ID NO:1 [i.e., exendin-4]
- the choice of parameter values for matches, mismatches, and insertions or deletions is discretionary, although some parameter values have been found to yield more biologically realistic results than others.
- Novel exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US98/16387 filed Aug. 6, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 10/181,102, which claims the benefit of U.S. Patent Application Ser. No. 60/055,404, filed Aug. 8, 1997, which are herein incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US98/00449, filed Jan. 7, 1998, entitled “Use of Exendins and Agonists Thereof for the Reduction of Food Intake,” U.S. patent application Ser. No. 09/003,869, which claims priority to U.S. Provisional Application No. 60/034,90 filed Jan. 7, 1997, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US01/00719, filed Jan. 9, 2001, entitled “Use of Exendins and Agonists Thereof for Modulation of Triglyceride Levels and Treatment of Dyslipidemia,” U.S. patent application Ser. No. 09/756,690, which claims priority to U.S. Provisional Application No. 60/175,365 filed Jan. 10, 2000, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US00/00902, filed Jan. 14, 2000, entitled “Novel Exendin Agonist Formulations and Methods of Administration Thereof,” U.S. patent application Ser. No. 09/889,330, which claims priority to U.S. Provisional Application No. 60/116,380 filed Jan. 14, 1999, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US03/16699, filed May 28, 2003, entitled “Novel Exendin Agonist Formulations and Methods of Administration Thereof,” U.S. patent application Ser. No. 10/522,103, which claims priority to U.S. application Ser. No. 10/157,224 filed May 28, 2002, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US00/14231, filed May 23, 2000, entitled “Use of Exendins and Agonists Thereof for the Treatment of Gestational Diabetes Mellitus,” which claims priority to U.S. application Ser. No. 09/323,867 filed Jun. 1, 1999, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US99/02554, filed Feb. 5, 1999, entitled “Inotropic and Diuretic Effects of Exendin and GLP-1,” U.S. patent application Ser. No. 09/622,105, which claims priority to U.S. Provisional Application No. 60/075,122 filed Feb. 13, 1998, which are hereby incorporated by reference.
- exendin analogs with agonist activity include those described in commonly owned PCT Application Serial No. PCT/US05/04178 filed Feb. 11, 2005, entitled “Hybrid Polypeptides with Selectable Properties,” U.S. patent application Ser. No. 11/055,093 which are hereby incorporated by reference.
- exendin agonists and exendin analog agonist can be indicated, for example, by activity in the assays described herein. Effects of exendins or exendin agonists on body weight and body composition can be identified, evaluated, or screened for, using the methods described herein, or other art-known or equivalent methods for determining effect on body weight BMI, body composition blood glucose, HbA 1c , etc.
- exendin-4 (1-30) [SEQ ID NO:9: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly]; exendin-4 (1-30) amide [SEQ ID NO:10: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly-NH 2 ]; exendin-4 (1-28) amide [SEQ ID NO: 11: His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn-NH 2 ]; 14 Leu, 25 Phe exendin-4 amide [
- compositions including said compounds and salts thereof.
- Exendin analogs with agonist activity also include those described in U.S. Provisional Application No. 60/065,442, now U.S. patent application Ser. No. 09/554,533, including compounds of the formula (I) [SEQ ID NO:15]:
- Xaa 1 Xaa 2 Xaa 3 Gly Xaa 5 Xaa 6 Xaa 7 Xaa 8 Xaa 9 Xaa 10 Xaa 11 Xaa 12 Xaa 13 Xaa 14 Xaa 15 Xaa 16 Xaa 17 Ala Xaa 19 Xaa 20 Xaa 21 Xaa 22 Xaa 23 Xaa 24 Xaa 25 Xaa 26 Xaa 27 Xaa 28 -Z1; wherein
- Xaa 1 is His, Arg or Tyr
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Ala, Asp or Glu
- Xaa 5 is Ala or Thr
- Xaa 6 is Ala, Phe, Tyr or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ala, Ser or Thr;
- Xaa 9 is Asp or Glu
- Xaa 10 is Ala, Leu, Ile, Val, pentylglycine or Met;
- Xaa 11 is Ala or Ser
- Xaa 12 is Ala or Lys
- Xaa 13 is Ala or Gln
- Xaa 14 is Ala, Leu, Ile, pentylglycine, Val or Met;
- Xaa 15 is Ala or Glu
- Xaa 16 is Ala or Glu
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala or Leu
- Xaa 22 is Ala, Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp, Phe, Tyr or naphthylalanine
- Xaa 26 is Ala or Leu
- Xaa 27 is Ala or Lys
- Xaa 28 is Ala or Asn
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently Pro, homoproline, 3Hyp, 4Hyp, thiopro line, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine; and
- Z 2 is —OH or —NH 2 ;
- N-alkyl groups for N-alkylglycine, N-alkylpentylglycine and N-alkylalanine include lower alkyl groups, for example, of 1 to about 6 carbon atoms, or of 1 to 4 carbon atoms.
- Exemplary exendin analogs include those wherein Xaa 1 is His or Tyr. More preferably Xaa 1 is His.
- Xaa 14 is Leu, pentylglycine or Met.
- Exemplary compounds are those wherein Xaa 25 is Trp or Phe.
- Exemplary compounds are those where Xaa 6 is Phe or naphthylalanine; Xaa 22 is Phe or naphthylalanine and Xaa 23 is Ile or Val.
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline and N-alkylalanine.
- Z 1 is —NH 2 .
- Z 2 is —NH 2 .
- Xaa 1 is His or Tyr, more preferably His
- Xaa 2 is Gly
- Xaa 6 is Phe or naphthylalanine
- Xaa 14 is Leu, pentylglycine or Met
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine. More preferably Z 1 is —NH 2 .
- exemplary compounds include those of formula (I) wherein: Xaa 1 is His or Arg; Xaa 2 is Gly or Ala; Xaa 3 is Asp or Glu; Xaa 5 is Ala or Thr; Xaa 6 is Ala, Phe or nephthylalaine; Xaa 7 is Thr or Ser; Xaa 8 is Ala, Ser or Thr; Xaa 9 is Asp or Glu; Xaa 10 is Ala, Leu or pentylglycine; Xaa 11 is Ala or Ser; Xaa 12 is Ala or Lys; Xaa 13 is Ala or Gln; Xaa 14 is Ala, Leu or pentylglycine; Xaa 15 is Ala or Glu; Xaa 16 is Ala or Glu; Xaa 17 is Ala or Glu; Xaa 19 is Ala or Val; Xaa 20 is Al
- Xaa 14 is Leu, Ile, Val or pentylglycine, more preferably Leu or pentylglycine
- Xaa 25 is Phe, Tyr or naphthylalanine, more preferably Phe or naphthylalanine.
- Exendin analogs with agonist activity also include those described in U.S. Provisional Application No. 60/066,029, now U.S. patent application Ser. No. 09/554,531, including compounds of the formula (II)[SEQ ID NO: 16]:
- Xaa 1 is His, Arg, Tyr, Ala, Norval, Val or Norleu;
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Ala, Asp or Glu
- Xaa 4 is Ala, Norval, Val, Norleu or Gly;
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala or Leu
- Xaa 22 is Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp, Phe, Tyr or naphthylalanine
- Xaa 26 is Ala or Leu
- Xaa 27 is Ala or Lys
- Xaa 28 is Ala or Asn
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine;
- Xaa 39 is Ser or Tyr
- N-alkyl groups for N-alkylglycine, N-alkylpentylglycine and N-alkylalanine include lower alkyl groups, for example, of 1 to about 6 carbon atoms, or of 1 to 4 carbon atoms.
- Suitable compounds of formula (II) include those described in application Serial No. PCT/US98/24273, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 09/554,531.
- exendin analogs include those wherein Xaa 1 is His, Ala or Norval. More preferably Xaa 1 is His or Ala. Most preferably Xaa 1 is His.
- Exemplary compounds of formula (II) are those wherein Xaa 25 is Trp or Phe.
- Exemplary compounds of formula (II) are those where Xaa 6 is Ala, Phe or naphthylalanine; Xaa 22 is Phe or naphthylalanine; and Xaa 23 is Ile or Val.
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline and N-alkylalanine.
- Z 1 is —NH 2 .
- Z 2 is —NH 2 .
- Xaa 1 is Ala, His or Tyr, more preferably Ala or His
- Xaa 2 is Ala or Gly
- Xaa 6 is Phe or naphthylalanine
- Xaa 14 is Ala, Leu, pentylglycine or Met
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine
- Xaa 39 is Ser or Tyr, more preferably Ser. More preferably Z 1 is —NH 2 .
- Exemplary compounds of formula (II) include those described in application Serial No. PCT/US98/24273, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds” as having the amino acid sequence of SEQ ID NOS:5-93 therein which are hereby incorporated by reference.
- Xaa 14 is Ala, Leu, Ile, Val or pentylglycine, more preferably Leu or pentylglycine
- Xaa 25 is Ala, Phe, Tyr or naphthylalanine, more preferably Phe or naphthylalanine.
- the present invention includes narrower genera of compounds described in PCT Application Serial No. PCT/US98/24210, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 09/554,533, and having particular amino acid sequences, for example, compounds of the formula (III) [SEQ ID NO: 17]:
- Xaa 1 Xaa 2 Xaa 3 Gly Xaa 5 Xaa 6 Xaa 7 Xaa 8 Xaa 9 Xaa 10 Xaa 11 Xaa 12 Xaa 13 Xaa 14 Xaa 15 Xaa 16 Xaa 17 Ala Xaa 19 Xaa 20 Xaa 21 Xaa 22 Xaa 23 Xaa 24 Xaa 25 Xaa 26 Xaa 27 Xaa 28 -Z1; wherein:
- Xaa 1 is His or Arg
- Xaa 2 is Gly or Ala
- Xaa 3 is Ala, Asp or Glu
- Xaa 5 is Ala or Thr
- Xaa 6 is Ala, Phe or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ala, Ser or Thr;
- Xaa 9 is Asp or Glu
- Xaa 10 is Ala, Leu or pentylglycine
- Xaa 11 is Ala or Ser
- Xaa 12 is Ala or Lys
- Xaa 13 is Ala or Gln
- Xaa 14 is Ala, Leu or pentylglycine
- Xaa 15 is Ala or Glu
- Xaa 16 is Ala or Glu
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala or Leu
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile, Val or tert-butylglycine
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp, or Phe;
- Xaa 26 is Ala or Leu
- Xaa 27 is Ala or Lys
- Xaa 28 is Ala or Asn
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, thioproline and N-methylalanine;
- Z 2 is —OH or —NH 2 ;
- the present invention includes narrower genera of peptide compounds described in PCT Application Serial No. PCT/US98/24273, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 09/554,531, as having particular amino acid sequences, for example, compounds of the formula [IV] [SEQ ID NO: 18]:
- Xaa 1 is His or Ala
- Xaa 2 is Gly or Ala
- Xaa 3 is Ala, Asp or Glu
- Xaa 4 is Ala or Gly
- Xaa 5 is Ala or Thr
- Xaa 6 is Ala, Phe or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ala, Ser or Thr;
- Xaa 9 is Ala, Asp or Glu
- Xaa 10 is Ala, Leu or pentylglycine
- Xaa 11 is Ala or Ser
- Xaa 12 is Ala or Lys
- Xaa 13 is Ala or Gln
- Xaa 14 is Ala, Leu, Met or pentylglycine
- Xaa 15 is Ala or Glu
- Xaa 16 is Ala or Glu
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala or Leu
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile, Val or tert-butylglycine
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp or Phe;
- Xaa 26 is Ala or Leu
- Xaa 27 is Ala or Lys
- Xaa 28 is Ala or Asn
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently Pro, homoproline, thioproline, or N-methylalanine;
- Z 2 is —OH or —NH 2 ;
- Exemplary compounds of formula (IV) include those wherein Xaa 1 is His or Ala. Preferably, Xaa 1 is His.
- Exemplary compounds of formula (IV) include those wherein Xaa 2 is Gly.
- Exemplary compounds of formula (IV) include those wherein Xaa 4 is Ala.
- Exemplary compounds of formula (IV) include those wherein Xaa 9 is Ala.
- Exemplary compounds of formula (IV) include those wherein Xaa 14 is Leu, pentylglycine or Met.
- Exemplary compounds of formula (IV) include those wherein Xaa 25 is Trp or Phe.
- Exemplary compounds of formula (IV) include those wherein Xaa 6 is Ala, Phe or naphthylalanine; Xaa 22 is Phe or naphthylalanine; and Xaa 23 is Ile or Val.
- Exemplary compounds of formula (IV) include those wherein Z 1 is —NH 2 .
- Exemplary compounds of formula (IV) include those wherein Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, thioproline and N-alkylalanine.
- Exemplary compounds of formula (IV) include those wherein Z 2 is —NH 2 .
- Exemplary compounds of formula (IV) include those wherein Z 1 is —NH 2 .
- Xaa 1 Xaa 2 Xaa 3 Gly Xaa 5 Xaa 6 Xaa 7 Xaa 8 Xaa 9 Xaa 10 Xaa 11 Xaa 12 Xaa 13 Xaa 14 Xaa 15 Xaa 16 Xaa 17 Ala Xaa 19 Xaa 20 Xaa 21 Xaa 22 Xaa 23 Xaa 24 Xaa 25 Xaa 26 Xaa 27 Xaa 28 -Z1; wherein
- Xaa 1 is His, Arg or Tyr or 4-imidazopropionyl
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Ala, Asp or Glu
- Xaa 5 is Ala or Thr
- Xaa 6 is Ala, Phe, Tyr or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ala, Ser or Thr;
- Xaa 9 is Asp or Glu
- Xaa 10 is Ala, Leu, Ile, Val, pentylglycine or Met;
- Xaa 11 is Ala or Ser
- Xaa 12 is Ala or Lys
- Xaa 13 is Ala or Gln
- Xaa 14 is Ala, Leu, Ile, pentylglycine, Val or Met;
- Xaa 15 is Ala or Glu
- Xaa 16 is Ala or Glu
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala, Leu or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Xaa 22 is Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp, Phe, Tyr or naphthylalanine
- Xaa 26 is Ala or Leu
- Xaa 27 is Lys, Asn, Ala or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- X 28 is Lys, Asn, Ala or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine and N-alkylalanine; and
- Z 2 is —OH or —NH 2 ; provided that no more than three of Xaa 3 , Xaa 5 , Xaa 6 , Xaa 8 , Xaa 10 , Xaa 11 , Xaa 12 , Xaa 13 , Xaa 14 , Xaa 15 , Xaa 16 , Xaa 17 , Xaa 19 , Xaa 20 , Xaa 21 , Xaa 24 , Xaa 25 , and Xaa 26 are Ala.
- pharmaceutically acceptable salts of the compound of formula (V) and pharmaceutical compositions including said compounds and salts thereof are also within the scope of the present invention.
- exendin analogs of formula (V) include those wherein Xaa 1 is His, Tyr or 4-imidazopropionyl. More preferably Xaa 1 is His.
- Exemplary compounds of formula (V) are those wherein Xaa 14 is Leu, pentylglycine or Met.
- Exemplary compounds of formula (V) are those wherein Xaa 25 is Trp or Phe.
- Xaa 6 is Phe or naphthylalanine
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val.
- Z 1 is —NH 2 .
- compounds of formula (V) wherein Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, thioproline and N-alkylalanine.
- Z 2 is —NH 2 .
- Exemplary compounds of formula (V) include those wherein X 27 is Lys or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl and Xaa 28 is Asn or Ala.
- Preferred compounds of formula (V) include compounds described in PCT application Serial No. PCT/US98/24210, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 09/554,533, and identified therein as Compound Nos. 62-69.
- exendin analogs include those wherein Xaa 1 is His.
- Xaa 25 is Trp or Phe.
- Exemplary compounds of formula (V) are those where Xaa 6 is Ala, Phe or naphthylalanine; Xaa 22 is Phe or naphthylalanine; and Xaa 23 is Ile or Val.
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline and N-alkylalanine.
- Z 1 is —NH 2 .
- Z 2 is —NH 2 .
- Xaa 1 is His or Tyr, more preferably His
- Xaa 2 is Ala or Gly
- Xaa 6 is Phe or naphthylalanine
- Xaa 14 is Ala, Leu, pentylglycine or Met
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine
- Xaa 39 is Ser or Tyr, more preferably Ser. More preferably Z 1 is —NH 2 .
- Particular compounds of formula (V) include those described in PCT application Serial No. PCT/US98/24210, filed Nov. 13, 1998, entitled “Novel Exendin Agonist Compounds” and having the amino acid sequences identified therein as SEQ ID NOS:5-65 and 67-74, herein SEQ ID NOS: 23-91.
- Xaa 14 is Ala, Leu, Ile, Val or pentylglycine, more preferably Leu or pentylglycine
- Xaa 25 is Ala, Phe, Tyr or naphthylalanine, more preferably Phe or naphthylalanine.
- Xaa 1 is His, Arg, Tyr, Ala, Norval, Val, Norleu or 4-imidazopropionyl
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Ala, Asp or Glu
- Xaa 4 is Ala, Norval, Val, Norleu or Gly;
- Xaa 5 is Ala or Thr
- Xaa 6 is Ala, Phe, Tyr or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ala, Ser or Thr;
- Xaa 9 is Ala, Norval, Val, Norleu, Asp or Glu;
- Xaa 10 is Ala, Leu, Ile, Val, pentylglycine or Met;
- Xaa 11 is Ala or Ser
- Xaa 12 is Ala or Lys
- Xaa 13 is Ala or Gln
- Xaa 14 is Ala, Leu, Ile, pentylglycine, Val or Met;
- Xaa 15 is Ala or Glu
- Xaa 16 is Ala or Glu
- Xaa 17 is Ala or Glu
- Xaa 19 is Ala or Val
- Xaa 20 is Ala or Arg
- Xaa 21 is Ala, Leu or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkyl-alkanoyl;
- Xaa 22 is Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Ala, Glu or Asp
- Xaa 25 is Ala, Trp, Phe, Tyr or naphthylalanine
- Xaa 26 is Ala or Leu
- Xaa 27 is Lys, Asn, Lys-NH ⁇ —R or Ala where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Xaa 28 is Lys, Asn, Lys-NH ⁇ —R or Ala where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Z 1 is —OH
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine and N-alkylalanine;
- Xaa 39 is Ser or Tyr
- Z 2 is —OH or —NH 2 ;
- Exemplary compounds of formula (VI) include those wherein Xaa 1 is His, Ala, Norval or 4-imidazopropionyl.
- Xaa 1 is His, or 4-imidazopropionyl or Ala, more preferably His or 4-imidazopropionyl.
- Exemplary compounds of formula (VI) include those wherein Xaa 2 is Gly.
- Exemplary compounds of formula (VI) include those wherein Xaa 4 is Ala.
- Exemplary compounds of formula (VI) include those wherein Xaa 9 is Ala.
- Exemplary compounds of formula (VI) include those wherein Xaa 14 is Leu, pentylglycine or Met.
- Exemplary compounds of formula (VI) include those wherein Xaa 25 is Trp or Phe.
- Exemplary compounds of formula (VI) include those wherein Xaa 6 is Ala, Phe or naphthylalanine; Xaa 22 is Phe or naphthylalanine; and Xaa 23 is Ile or Val.
- Exemplary compounds of formula (VI) include those wherein Z 1 is —NH 2 .
- Exemplary compounds of formula (VI) include those wherein Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from the group consisting of Pro, homoproline, thioproline and N-alkylalanine.
- Exemplary compounds of formula (VI) include those wherein Xaa 39 is Ser.
- Exemplary compounds of formula (VI) include those wherein Z 2 is —NH 2 .
- Exemplary compounds of formula (VI) include those 42 wherein Z 1 is —NH 2 .
- Exemplary compounds of formula (VI) include those wherein Xaa 21 is Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl.
- Exemplary compounds of formula (VI) include those wherein X 27 is Lys or Lys-NH ⁇ —R, where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl and X 28 is Asn or Ala.
- Xaa 1 is His, Arg or Tyr
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Asp or Glu
- Xaa 6 is Phe, Tyr or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ser or Thr
- Xaa 9 is Asp or Glu
- Xaa 10 is Leu, Ile, Val, pentylglycine or Met;
- Xaa 14 is Leu, Ile, pentylglycine, Val or Met;
- Xaa 22 is Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Glu or Asp
- Xaa 25 is Trp, Phe, Tyr, or naphthylalanine
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine;
- Xaa 39 is Ser, Thr or Tyr; and Z is —OH or —NH 2 ;
- N-alkyl groups for N-alkylglycine, N-alkylpentylglycine and N-alkylalanine include lower alkyl groups preferably of 1 to about 6 carbon atoms, more preferably of 1 to 4 carbon atoms. Also useful in the present invention are pharmaceutically acceptable salts of the compounds of formula (VII).
- Exemplary exendin analogs include those wherein Xaa 1 is His or Tyr. More preferably Xaa 1 is His.
- Xaa 14 is Leu, pentylglycine or Met.
- Exemplary compounds include those wherein Xaa 25 is Trp or Phe.
- Xaa 6 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine.
- N-alkylalanine has a N-alkyl group of 1 to about 6 carbon atoms.
- Xaa 36 , Xaa 37 and Xaa 38 are the same amino acid reside.
- Xaa 39 is Ser or Tyr, more preferably Ser.
- Z is —NH 2 .
- Xaa 1 is His or Tyr, preferably His
- Xaa 2 is Gly
- Xaa 6 is Phe or naphthylalanine
- Xaa 14 is Leu, pentylglycine or Met
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine
- Xaa 39 is Ser or Tyr, more preferably Ser. More preferably Z is —NH 2 .
- exemplary compounds include those of formula (VII) wherein: Xaa 1 is His or Arg; Xaa 2 is Gly; Xaa 3 is Asp or Glu; Xaa 6 is Phe or napthylalanine; Xaa 7 is Thr or Ser; Xaa 8 is Ser or Thr; Xaa 9 is Asp or Glu; Xaa 10 is Leu or pentylglycine; Xaa 14 is Leu or pentylglycine; Xaa 22 is Phe or naphthylalanine; Xaa 23 is Ile, Val or t-butyltylglycine; Xaa 24 is Glu or Asp; Xaa 25 is Trp or Phe; Xaa 31 , Xaa 36 , Xaa 37 , and Xaa 38 are independently Pro, homoproline, thioproline, or N-methylalanine; Xaa 39 is
- Xaa 14 is Leu, Ile, Val or pentylglycine, more preferably Leu or pentylglycine
- Xaa 25 is Phe, Tyr or naphthylalanine, more preferably Phe or naphthylalanine.
- Xaa 1 is His, Arg, Tyr or 4-imidazopropionyl
- Xaa 2 is Ser, Gly, Ala or Thr;
- Xaa 3 is Asp or Glu
- Xaa 6 is Phe, Tyr or naphthylalanine
- Xaa 7 is Thr or Ser
- Xaa 8 is Ser or Thr
- Xaa 9 is Asp or Glu
- Xaa 10 is Leu, Ile, Val, pentylglycine or Met;
- Xaa 14 is Leu, Ile, pentylglycine, Val or Met;
- Xaa 22 is Phe, Tyr or naphthylalanine
- Xaa 23 is Ile, Val, Leu, pentylglycine, tert-butylglycine or Met;
- Xaa 24 is Glu or Asp
- Xaa 25 is Trp, Phe, Tyr, or naphthylalanine
- Xaa 27 is Lys, Asn, or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Xaa 28 is Lys, Asn, or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl or cycloalkylalkanoyl;
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine;
- Xaa 39 is Ser, Thr or Tyr
- Z is —OH or —NH 2 ;
- Suitable compounds of formula (VIII) include compounds described in PCT Application Serial No. PCT/US98/16387, filed Aug. 6, 1998, entitled “Novel Exendin Agonist Compounds,” U.S. patent application Ser. No. 10/181,102, having the amino acid sequences of SEQ ID NOS: 5-39 therein, herein identified as SEQ ID NOS: 108-142.
- exendin analogs of formula (VIII) include those wherein Xaa 1 is His, Tyr or 4-imidazopropionyl. More preferably, Xaa 1 is His or 4-imidazopropionyl.
- Xaa 27 is Lys or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl and Xaa 28 is Asn.
- Xaa 6 is Phe or naphthylalanine
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine.
- Xaa 39 is Ser or Tyr.
- Z is —NH 2 .
- Xaa 6 is Phe or naphthylalanine
- Xaa 22 is Phe or naphthylalanine
- Xaa 23 is Ile or Val
- Xaa 27 is Lys or Lys-NH ⁇ —R where R is Lys, Arg, C 1 -C 10 straight chain or branched alkanoyl, and Xaa 28 is Asn
- Xaa 31 , Xaa 36 , Xaa 37 and Xaa 38 are independently selected from Pro, homoproline, thioproline or N-alkylalanine.
- exendins and exendin analogs of the invention do not include the peptides of SEQ ID NOS:3-14.
- exendin analogs include the analogs of Formulas (I-VIII), with the proviso that the analogs do not include the peptides of SEQ ID NOs:1-2.
- Also useful within the scope of the present invention are narrower genera of compounds of the disclosed formulae, for example formulae I through VIII, having peptides of various lengths, for example genera of compounds that do not include peptides having a length of greater than 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37 or 38 amino acid residues.
- Exendins, exendin analog agonists and exendin agonists that are peptides, described herein may be prepared through peptide purification as described in, for example, Eng, et al., J. Biol. Chem. 265:20259-62, 1990; and Eng, et al., J. Biol. Chem. 267:7402-05, 1992, which are incorporated by reference herein.
- exendins, exendin peptide agonists and exendin analog agonists may be prepared by methods known to those skilled in the art, for example, as described in Raufinan, et al., J. Biol. Chem.
- an ⁇ -N-carbamoyl protected amino acid and an amino acid attached to the growing peptide chain on a resin are coupled at room temperature in an inert solvent such as dimethylformamide, N-methylpyrrolidinone or methylene chloride in the presence of coupling agents such as dicyclohexylcarbodiimide and 1-hydroxybenzotriazole in the presence of a base such as diisopropylethylamine.
- an inert solvent such as dimethylformamide, N-methylpyrrolidinone or methylene chloride
- coupling agents such as dicyclohexylcarbodiimide and 1-hydroxybenzotriazole in the presence of a base such as diisopropylethylamine.
- the ⁇ -N-carbamoyl protecting group is removed from the resulting peptide-resin using a reagent such as trifluoroacetic acid or piperidine, and the coupling reaction repeated with the next desired N-protected amino acid to be added to the peptide chain.
- a reagent such as trifluoroacetic acid or piperidine
- Suitable N-protecting groups are well known in the art, with, for example, t-butyloxycarbonyl (tBoc) and fluorenylmethoxycarbonyl (Fmoc).
- the solvents, amino acid derivatives and 4-methylbenzhydryl-amine resin used in the peptide synthesizer may be purchased from Applied Biosystems Inc. (Foster City, Calif.).
- the following side-chain protected amino acids may be purchased from Applied Biosystems, Inc.: BSD-112344.1-Arg(Pmc), Boc-Thr(Bzl), Fmoc-Thr(t-Bu), Boc-Ser(Bzl), Fmoc-Ser(t-Bu), Boc-Tyr(BrZ), Fmoc-Tyr(t-Bu), Boc-Lys(Cl-Z), Fmoc-Lys(Boc), Boc-Glu(Bzl), Fmoc-Glu(t-Bu), Fmoc-His(Trt), Fmoc-Asn(Trt), and Fmoc-Gln(Trt).
- Boc-His(BOM) may be purchased from Applied Biosystems, Inc. or Bachem Inc. (Torrance, Calif.).
- Anisole, dimethylsulfide, phenol, ethanedithiol, and thioanisole may be obtained from Aldrich Chemical Company (Milwaukee, Wis.). Air Products and Chemicals (Allentown, Pa.) supplies HF.
- Ethyl ether, acetic acid and methanol may be purchased from Fisher Scientific (Pittsburgh, Pa.).
- Solid phase peptide synthesis may be carried out with an automatic peptide synthesizer (Model 430A, Applied Biosystems Inc., Foster City, Calif.) using the NMP/HOBt (Option 1) system and tBoc or Fmoc chemistry (see, Applied Biosystems User's Manual for the ABI 430A Peptide Synthesizer, Version 1.3B Jul. 1, 1988, section 6, pp. 49-70, Applied Biosystems, Inc., Foster City, Calif.) with capping. Boc-peptide-resins may be cleaved with HF ( ⁇ 50° C. to 0° C., 1 hour).
- the peptide may be extracted from the resin with alternating water and acetic acid, and the filtrates lyophilized.
- the Fmoc-peptide resins may be cleaved according to standard methods (Introduction to Cleavage Techniques, Applied Biosystems, Inc., 1990, pp. 6-12).
- Peptides may also be assembled using an Advanced Chem Tech Synthesizer (Model MPS 350, Louisville, Ky.).
- Peptides may be purified by RP-HPLC (preparative and analytical) using a Waters Delta Prep 3000 system.
- a C4, C8 or C18 preparative column (10 ⁇ , 2.2 ⁇ 25 cm; Vydac, Hesperia, Calif.) may be used to isolate peptides, and purity may be determined using a C4, C8 or C18 analytical column (5 ⁇ , 0.46 ⁇ 25 cm; Vydac).
- Peptides may be hydrolyzed by vapor-phase acid hydrolysis (115° C., 20-24 h). Hydrolysates may be derivatized and analyzed by standard methods (Cohen, et al., The Pico Tag Method: A Manual of Advanced Techniques for Amino Acid Analysis, pp. 11-52, Millipore Corporation, Milford, Mass. (1989)). Fast atom bombardment analysis may be carried out by M-Scan, Incorporated (West Chester, Pa.). Mass calibration may be performed using cesium iodide or cesium iodide/glycerol. Plasma desorption ionization analysis using time of flight detection may be carried out on an Applied Biosystems Bio-Ion 20 mass spectrometer. Electrospray mass spectroscopy may be carried and on a VG-Trio machine.
- Exendins, exendin analog agonists and exendin agonists that are peptides may also be prepared using recombinant DNA techniques, using methods now known in the art. See, e.g., Sambrook et al., Molecular C LONING : A L ABORATORY M ANUAL, 2d Ed., Cold Spring Harbor (1989). Alternatively, such compounds may be prepared by homogeneous phase peptide synthesis methods. Non-peptide compounds useful in the present invention may be prepared by art-known methods. For example, phosphate-containing amino acids and peptides containing such amino acids, may be prepared using methods known in the art. See, e.g., Bartlett and Landen, Biorg. Chem. 14:356-377 (1986).
- Exendins, exendin agonists or exendin analog agonists may be formulated into pharmaceutical compositions for administration to subjects, including humans. These pharmaceutical compositions preferably include an amount of an exendin, an exendin agonist or exendin analog agonist effective to reduce body weight in the subject, reduce BMI, alter body composition, treat diabetes, lower fasting blood glucose, or reduce postprandial blood glucose and a pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers useful in these pharmaceutical compositions include, e.g., ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
- ion exchangers e.g., ion exchangers, alumina, aluminum stearate, lecithin
- serum proteins such as human serum albumin
- buffer substances such as phosphat
- compositions disclosed herein may be administered parenterally, orally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
- the compositions are administered by an infusion pump or subcutaneous injection of a slow release, extended release, sustained release or long acting formulation.
- subcutaneous injections are administered once a day; once every two, three, four, five, or six days; once per week; twice per month; once a month; every other month or every third month.
- any of the exendins, exendin agonists or exendin analog agonists may be administered in the acid or amide form. Additionally, any of the exendins, exendin agonists or exendin analog agonists may form salts with various inorganic and organic acids and bases. Such salts include, without limitation, salts prepared with organic and inorganic acids, for example, HCl, HBr, H 2 SO 4 , H 3 PO 4 , trifluoroacetic acid, acetic acid, formic acid, methanesulfonic acid, toluenesulfonic acid, maleic acid, fumaric acid and camphorsulfonic acid.
- Salts prepared with bases include, without limitation, ammonium salts, alkali metal salts, e.g., sodium and potassium salts, and alkali earth salts, e.g., calcium and magnesium salts.
- Acetate, hydrochloride, and trifluoroacetate salts are particular examples.
- the salts may be formed by conventional means, as by reacting the free acid or base forms of the product with one or more equivalents of the appropriate base or acid in a solvent or medium in which the salt is insoluble, or in a solvent such as water which is then removed in vacuo or by freeze-drying or by exchanging the ions of an existing salt for another ion on a suitable ion exchange resin.
- the route of administration results in an average plasma exendin, exendin agonist or exendin analog agonist concentration of greater than or equal to about 50 pg/ml for a period of at least about 12 hours, or least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, or least about 7 days; at least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, least about 12, least about 13, least about 14, least about 15, or least about 16 weeks; or at least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, or least about 12 months.
- the route of administration results in a minimum plasma exendin, exendin agonist or exendin analog agonist concentration of greater than or equal to about 50 pg/ml for a period of at least about 12 hours, or least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, or least about 7 days; at least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, least about 12, least about 13, least about 14, least about 15, or least about 16 weeks; or at least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, or least about 12 months.
- any route of administration can be used in the present methods so long as the administration results in an average plasma exendin, exendin agonist or exendin analog agonist concentration of at least about 65 pg/ml, about 75 pg/ml, about 85 pg/ml, about 100 pg/ml, about 150 pg/ml, about 170 pg/ml, about 175 pg/ml, about 200 pg/ml, about 225 pg/ml, about 250 pg/ml, about 300 pg/ml, about 350 pg/ml, about 400 pg/ml, about 450 pg/ml, about 500 pg/ml, about 550 pg/ml, or about 600 pg/ml.
- the average concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the average plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of the exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- These average concentrations are maintained for a period of at least about 12 hours, or least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, or least about 7 days; at least about 1, least about 2, least about 3, least about 4, least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, least about 12, least about 13, least about 14, least about 15, or least about 16 weeks; or at least about 5, least about 6, least about 7, least about 8, least about 9, least about 10, least about 11, or least about 12 months.
- the route of administration results in a sustained minimum plasma exendin, exendin agonist or exendin analog agonist concentration of greater than or equal to about 65 pg/ml, greater than or equal to about 75 pg/ml, greater than or equal to about 85 pg/ml, about 100 pg/ml, greater than or equal to about 150 pg/ml, greater than or equal to about 170 pg/ml, greater than or equal to about 175 pg/ml, greater than or equal to about 200 pg/ml, greater than or equal to about 225 pg/ml, greater than or equal to about 250 pg/ml, greater than or equal to about 300 pg/ml, greater than or equal to about 350 pg/ml, greater than or equal to about 400 pg/ml, greater than or equal to about 450 pg/ml, greater than or equal to about 500 pg/ml, greater than or equal to about 550 pg/
- the minimum concentration of the exendin, exendin agonist or exendin analog agonist is between at least about 170 pg/ml and 600 pg/ml or between at least about 170 pg/ml and 350 pg/ml.
- minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter, greater than 50 pmoles/liter, greater than 60 pmoles/liter, greater than 70 pmoles/liter, greater than 80 pmoles/liter, greater than 90 pmoles/liter, greater than 100 pmoles/liter, greater than 110 pmoles/liter, greater than 120 pmoles/liter, greater than 130 pmoles/liter, greater than 140 pmoles/liter, or greater than 150 pmoles/liter.
- the minimum plasma concentration of the exendin, exendin agonist or exendin analog agonist is greater than 40 pmoles/liter but less than 150 pmoles/liter or greater than 40 pmoles/liter but less than 80 pmoles/liter.
- the exendin, exendin agonist or exendin analog agonist is exendin-4.
- the concentration of the exendin, exendin agonist or exendin analog agonist is the concentration of the exendin, exendin agonist or exendin analog agonist that results in a biological or therapeutic effect, e.g. weight reduction, glucose lowering, alteration in body composition, etc., equivalent to that observed with a given concentration of exendin-4.
- Plasma exendin, exendin agonist or exendin agonist analog concentrations can be measured using any method available.
- Average concentrations can be determined over the entire time period of interest, or alternatively, within a subunit of the time period of interest. For example, and without limitation, the average daily concentration of an exendin, exendin agonist or exendin analog agonist over a period of one week, one month, three months, six months or a year; the average weekly concentration over a period of one month, three months, six months, nine months or a year; or the average monthly concentration over six months, nine months or one year; etc. It should be recognized that the average (mean) concentrations will encompass individual measurements that are above or below the mean. Thus, at any given measurement of concentration may be below the desired minimum average so long as the average value over the desired time period is at or above the required minimum value. As used herein in reference to concentration, the term “average or minimum” refers to the alternative and should be read as the either the average concentration or the minimum concentration.
- Sterile injectable forms of the compositions of this invention may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art, using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or di-glycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms, including emulsions and suspensions.
- a long-chain alcohol diluent or dispersant such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms, including emulsions and suspensions.
- Other commonly used surfactants such as TWEENs, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
- Parenteral formulations may be a single bolus dose, an infusion, or a loading bolus dose followed with a maintenance dose. These compositions may be administered according to any dosage schedule described herein.
- compositions of this invention may be orally administered in any orally acceptable dosage form including, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- compositions of this invention may be administered in the form of suppositories for rectal administration.
- suppositories for rectal administration.
- suppositories can be prepared by mixing the agent with a suitable non-irritating excipient which is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug.
- suitable non-irritating excipient include cocoa butter, beeswax and polyethylene glycols.
- compositions of this invention may also be administered topically.
- Topical application can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation.
- Topical transdermal patches may also be used.
- the pharmaceutical compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers.
- Carriers for topical administration of the compounds of this invention include, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the pharmaceutical compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers.
- Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol, and water.
- the pharmaceutical compositions may be formulated as micronized suspensions in isotonic, pH-adjusted sterile saline, or, preferably, as solutions in isotonic, pH-adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride.
- the pharmaceutical compositions may be formulated in an ointment such as petrolatum.
- compositions of this invention may also be administered by nasal aerosol or inhalation.
- Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
- the amount of exendin, exendin agonist or exendin analog agonist that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
- the compositions can be formulated so that a dosage of between 0.1-1000 pmoles/kg body weight/minute (when administered by infusion) of exendin, exendin agonists or exendin analog agonist is administered to a patient receiving these compositions. In some embodiments of the invention, the dosage is 1-10 pmoles/kg body weight/minute (when administered by infusion). In one embodiment the dosage is 0.5-2.0 pmoles/kg/min when administered by intravenous infusion.
- the composition may be administered as a single dose, multiple doses, or over an established period of time.
- the dosage is about 0.8 mg of a long acting formulation containing about 5% of an exendin, exendin agonist, or exendin analog agonist, for example, exendin-4. In another embodiment, the dosage is about 2.0 mg of a long acting formulation containing about 5% of an exendin, exendin agonist, or exendin analog agonist for example, exendin-4.
- the dosage is about 1.0, about 1.25, about 1.5, about 1.75, about 2.25, about 2.5, about 2.75, about 3.0, about 3.25, about 3.5, about 3.75, about 4.0, about 4.25, about 4.5, about 4.75, or about 5.0 mg of a long acting formulation containing about 5% of an exendin, exendin agonist, or exendin analog agonist for example, exendin-4. It will be recognized that the exact dosage will vary with the percent exendin and the amount of carriers and/or excipients in a particular formulation. It is well within the skill of those of ordinary skill in the art to make such adjustments in order to obtain the desired plasma concentrations of an exendin, exendin agonist or exendin analog agonist described herein. It should be noted that any combination of doses and means of administration may be utilized as long as the dose in combination with the means of administration as long as the desired therapeutically effective level of the exendin, exendin agonist, or exendin agonist analog is achieved.
- exendin or exendin agonists or analogs thereof are administered to patients identified as overweight, obese, diabetic or a combination thereof.
- the exendin or exendin agonists or analogs thereof is administered by injection at least once a day, once a week, or by continuous infusion via pump.
- the exendin or exendin agonists or exendin analog agonists are formulated for administration from a subcutaneous depot over a period of days, weeks or months.
- the exendins exendin agonists or exendin analog agonists are formulated in a sustained release or long acting formulation.
- the sustained release formulation comprises a biocompatible polymer, an exendin, or exendin analog agonist, and a sugar.
- Exemplary formulations are disclosed in U.S. patent application Ser. No. 09/942,631, filed Aug. 31, 2001 (now U.S. Pat. No. 6,824,822) and related application Ser. No. 11/312,371, filed Dec. 21, 2005; U.S. Provisional Application No. 60/419,388, filed Oct. 17, 2002 and related U.S. patent application Ser. Nos. 10/688,786 and 10/688,059 filed Oct. 17, 2003; U.S.
- Such formulations can be administered, for example by subcutaneous injection, once per day, every 2 days, 3 days, 4 days, 5 days, or 6 days; once per week, once every 2 weeks, or once every three weeks; or once per month, once every other month or once every 3 months.
- Sustained release compositions can be prepared by a phase separation process.
- the general process for producing a sustained release or long acting formulation comprising microparticles containing an exendin, exendin agonist or exendin analog agonist and sucrose for a 1 kg batch size is described below.
- a water-in-oil emulsion is created with the aid of a homogenizer.
- Suitable homogenizers include an in-line Megatron homogenizer MT-V 3-65 F/FF/FF, Kinematica AG, Switzerland.
- the water phase of the emulsion can be prepared by dissolving an exendin, exendin agonist or exendin analog agonist, for example, exendin-4, and excipients such as sucrose in water.
- the concentration of exendin in the resulting solution can be from about 50 mg/g to about 100 mg/g.
- the concentration of drug in solution can be from about 30 g to about 60 g per 600 g of water.
- 50 g exendin-4 and 20 g sucrose are dissolved in 600 g water for irrigation (WFI).
- WFI water for irrigation
- the oil phase of the emulsion is prepared by dissolving PLGA polymer (e.g., 930 g of purified 50:50 DL4A PLGA (Alkermes, Inc.) in methylene chloride (14.6 kg or 6% w/w)).
- PLGA polymer e.g., 930 g of purified 50:50 DL4A PLGA (Alkermes, Inc.) in methylene chloride (14.6 kg or 6% w/w)
- the water phase is then added to the oil phase to form a coarse emulsion with an overhead mixer for about three minutes. Then, the coarse emulsion is homogenized at approximately 21300 rpm at ambient temperature for three discrete periods. This should result in an inner emulsion droplet size of less than 1 micron. It is understood that inner emulsion formation can be achieved using any suitable means. Suitable means of emulsion formation include, but are not limited to, homogenization as described above and sonication.
- a coacervation step is then performed by adding silicone oil (21.8 kg of Dimethicone, NF, 350 cs) over a time period of less than or equal to about 5 minutes to the inner emulsion. This is equivalent to a ratio of 1.5:1, silicone oil to methylene chloride.
- the methylene chloride from the polymer solution partitions into the silicone oil and begins to precipitate the polymer around the water phase containing the exendin, leading to microencapsulation.
- the embryonic microspheres thus formed are soft and require hardening. Frequently, the embryonic microspheres are permitted to stand for a short period of time, for example, less than 1 minute or from about 1 minute to about 5 minutes prior to proceeding to the microsphere hardening step.
- the embryonic microspheres are immediately transferred into a heptane/ethanol solvent mixture.
- the volume of heptane/ethanol mixture needed can be determined based on the microsphere batch size, typically a 16:1 ratio of heptane/ethanol solvent to methylene chloride. For example, about 210 kg heptane and 23 kg ethanol in a 3° C. cooled, stirred tank can be used.
- This solvent mixture hardens the microspheres by extracting additional methylene chloride from the microspheres. This hardening step can also be referred to as quenching. After being quenched for 1 hour at 3° C., the solvent mixture is either decanted and fresh heptane (13 Kg) is added at 3° C. and held for 1 hour to rinse off residual silicone oil, ethanol and methylene chloride on the microsphere surface or pumped directly to the collection step.
- the microspheres are transferred and collected, for example, on a 12′′ Sweco Pharmasep Filter/Dryer Model PH12Y6.
- the filter/dryer uses a 25 micron multilayered collection screen and is connected to a motor that vibrates the screen during collection and drying.
- a final rinse with heptane (6 Kg at 3° C.) can be performed to ensure maximum line transfer and to remove any excess silicone oil.
- the microspheres can then be dried under vacuum with or without a constant purge of nitrogen gas at controlled rate, for example,: 3 to 10 hours (e.g. 6 hours) at 3° C.; 3 to 10 hours ramping to 41° C. (e.g. 6 hours); and maintaining for a long period (e.g. 80-90 hours) at 41° C.
- the microspheres are discharged into a collection vessel, sieved through a 150 ⁇ m sieve, and stored at about ⁇ 20° C. until filling.
- a water-in-oil emulsion is created with the aid of a sonicator.
- Suitable sonicators include Vibracell VCX 750 with model CV33 probe head, Sonics and Materials Inc., Newtown, Conn.
- the water phase of the emulsion is prepared by dissolving an exendin, for example, exendin-4, and excipients such as sucrose in water.
- the concentration of drug in the resulting solution can be from about 50 mg/ml to about 100 mg/ml.
- the concentration of drug in solution can be from about 3.28 g to about 6.55 g per 65.5 g of water.
- exendin-4 and 2.18 g sucrose are dissolved in 65.5 g water for irrigation or WFI.
- the specified amounts listed above represent a 4% overage to target load in order to compensate for losses upon filter sterilization of the components.
- the oil phase of the emulsion is prepared by dissolving PLGA polymer (e.g., 97.7 g of purified 50:50 DL4A PLGA (Alkermes, Inc.)) in methylene chloride (1539 g or 6% w/v).
- the water phase is then added to the oil phase over about a three-minute period while sonicating at 100% amplitude at ambient temperature.
- the water phase containing the sucrose/exendin-4 is charged to the coacervation reactor.
- Reactor is then stirred at 1400 to 1600 rpm, with additional sonication at 100% amplitude for 2 minutes, followed by a 30 second hold, and then 1 minute more of sonication.
- inner emulsion formation can be achieved using any suitable means. Suitable means of emulsion formation include, but are not limited to, sonication as described above and homogenization.
- a coacervation step is then performed by adding silicone oil (2294 gr of Dimethicone, NF, 350 cs) over time period of less than five minutes to the inner emulsion. This is equivalent to a ratio of 1.5:1, silicone oil to methylene chloride.
- the methylene chloride from the polymer solution partitions into the silicone oil and begins to precipitate the polymer around the water phase containing exendin, leading to microencapsulation.
- the embryonic microspheres thus formed are soft and require hardening. Frequently, the embryonic microspheres are permitted to stand for a short period of time, for example, of less than 1 minute or from about 1 minute to about 5 minutes prior to proceeding to the microsphere hardening step.
- the embryonic microspheres are then immediately transferred into a heptane/ethanol solvent mixture.
- the volume of heptane/ethanol mixture needed can be determined based on the microsphere batch size. In the present example, about 22 kg heptane and 2448 g ethanol in a 3° C. cooled, stirred tank (350 to 450 rpm) are used.
- This solvent mixture hardens the microspheres by extracting additional methylene chloride from the microspheres. This hardening step can also be referred to as quenching. After being quenched for 1 hour at 3° C., the solvent mixture is decanted and fresh heptane (13 Kg) is added at 3° C. and held for 1 hour to rinse off residual silicone oil, ethanol and methylene chloride on the microsphere surface.
- the microspheres are transferred and collected, for example, on a 6′′ diameter, 20 micron multilayered screen inside the cone shaped drying chamber which acts as a dead-end filter.
- a final rinse with heptane (6 Kg at 4° C.) is performed to ensure maximum line transfer.
- the microspheres are then dried with a constant purge of nitrogen gas at a controlled rate, for example, according to the following schedule: 18 hours at 3° C.; 24 hours at 25° C.; 6 hours at 35° C.; and 42 hours at 38° C.
- the microspheres are discharged into a teflon/stainless steel sterilized collection vessel attached to the drying cone.
- the collection vessel is sealed, removed from the drying cone and stored at ⁇ 20 ⁇ 5° C. until filling. Material remaining in the cone upon disassembly for cleaning is taken for drug content analysis.
- Non-limiting examples of specific PLG polymers suitable for use in the general methods described above are listed below.
- the listed polymers can be obtained from Lakeshore Biomaterials of Birmingham, Ala., or Boehringer Ingelheim Pharma GmbH & Co. KG, Germany, although other sources may be available, and can be described as follows:
- a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the particular exendin or exendin agonists or analogs thereof the patient's age, body weight, general health, gender, and diet, and the time of administration, rate of excretion, drug combination, and the severity of the particular disease being treated. Judgment of such factors by medical caregivers is within ordinary skill in the art.
- the amount of exendin or exendin agonists or analogs thereof will also depend on the individual patient to be treated, the route of administration, the type of formulation, the characteristics of the compound used, the severity of the disease, and the desired effect.
- the amounts of exendin or exendin agonists or analogs thereof can be determined by pharmacological and pharmacokinetic principles well-known in the art.
- the pharmacokinetics of a long-acting release (LAR) formulation of exenatide was evaluated in a randomized, double-blind, placebo controlled, multicenter study in subjects with Type 2 diabetes.
- the study population consisted of 45 individuals with type 2 diabetes treated with a stable regimen of metformin or managed with diet modification and exercise for at least 3 months prior to screening.
- Subjects, male or female, were 18 to 75 years of age with a body mass index (BMI) of 25 kg/m 2 to 45 kg/m 2 , inclusive, at screening, and HbA 1c of 7.1% to 11.0%, inclusive, at screening.
- BMI body mass index
- HbA 1c 7.1% to 11.0%, inclusive
- Lead-in medication (exenatide [exendin-4] 5 ⁇ g or placebo) was administered SC, BID, within 15 minutes prior to meals in the morning and evening. If a meal was skipped, the lead-in medication was administered and followed by a snack 15 minutes later. Administrations were given no sooner than 6 hours apart. Subjects received either exenatide 5 ug administered subcutaneously, or an equivalent dose volume of placebo, two times per day (BID).
- Exenatide injection used in this study was a clear, colorless, sterile preserved solution for SC injection containing exenatide (exendin-4) in sodium acetate buffer, pH 4.5, 4.3% mannitol as an iso-osmolality modifier and 0.22% metacresol as a preservative.
- the strength of exenatide injection is 0.25 mg/mL of exendin-4.
- the placebo injection is the same as the active formulation of exenatide injection except that the active ingredient (exendin-4) is omitted.
- subjects received weekly subcutaneous injections of exenatide LAR, at either 0.8 mg or 2.0 mg per dose, or an equivalent dose volume of placebo LAR. Subjects were also monitored for 12 weeks after the treatment period for safety and pharmacokinetic assessment.
- Exenatide LAR is a sustained-release formulation of exenatide (exendin-4) designed to provide exenatide release over a period ranging from 7 to 91 days.
- Exenatide LAR used in this study contained, on a w/w basis, 5% exenatide, 2% sucrose, and 93% MEDISORB® 50:50 poly D,L-lactic co-glycolic acid.
- the vial containing the white to off-white dry powder (2.8 mg of exenatide LAR microspheres) was stored frozen in a freezer with a recorded temperature at ⁇ 20 ⁇ 5° C. at the study site.
- the placebo LAR was the same as the active formulation of exenatide LAR except that the active ingredient (exenatide) was replaced with 0.5% ammonium sulfate.
- Subjects were monitored weekly for body weight, vital signs (including blood pressure, heart rate, respiratory rate, and temperature), urinalysis, and adverse events.
- vital signs including blood pressure, heart rate, respiratory rate, and temperature
- urinalysis e.g., urinalysis
- adverse events e.g., urinalysis, and adverse events.
- blood was drawn to assess plasma concentrations of exendin and glucose.
- HbA 1c was determined every three weeks.
- Body mass index was calculated using a nomogram.
- SMBG blood glucose
- Plasma exenatide was quantified by a validated Enzyme-Linked immunosorbant Assay (ELISA) (Fineman et al., Diabetes Care, 26:2370-2377, 2003) at LINCO Diagnostic Services, Inc (St. Charles, Mo.). Glycosylated hemoglobin was quantitated by Quintiles Laboratories (Smyrna, Ga.) using high-performance liquid chromatography (Davis et al., Diabetes, 27:102-107, 1978; Cole et al., Metabolism, 27:289-301, 1978). Anti-exenatide antibodies were measured in a similar fashion to that described previously (Fineman et al., Diabetes Care, 26:2370-2377, 2003) at LINCO Diagnostic Services.
- ELISA Enzyme-Linked immunosorbant Assay
- a sample size of 36 subjects was estimated to provide 95% confidence intervals of approximately 65 to 115 pg/mL and 170 to 290 pg/mL for the mean exenatide concentrations at steady state for 0.8 and 2.0 mg exenatide LAR, respectively.
- the intent-to-treat (ITT) population comprised all randomized subjects who received at least one injection of lead-in medication, while the evaluable population consisted of subjects who completed the study procedures through Week 15 in compliance with the protocol. Descriptive statistics on demographics, safety, glycemic endpoints and weight were provided for the ITT population. Descriptive statistics for percentage of subjects achieving glycosylated hemoglobin ⁇ 7.0% and self-monitored blood glucose measurements were performed for the evaluable population.
- Plasma exenatide concentrations by treatment and time were provided for those subjects who received exenatide LAR and completed the study.
- Exenatide pharmacokinetics were analyzed by noncompartmental methods and summarized descriptively.
- the 95% confidence intervals for the differences for baseline to Week 15 changes for the 0.8 mg and 2.0 mg exenatide LAR groups, as compared to the placebo LAR group, were calculated for glycosylated hemoglobin, fasting plasma glucose, and body weight. Differences for which the 95% confidence intervals did not include zero were considered significant.
- Fasting plasma glucose was reduced at the first measurement after exenatide LAR administration (Week 1), with significant changes from baseline to Week 15 of ⁇ 43 ⁇ 16 mg/dL (mean ⁇ SE) and ⁇ 39 ⁇ 9 mg/dL for the 0.8 and 2.0 mg exenatide LAR groups, respectively, compared to +18 ⁇ 12 mg/dL for the placebo LAR group.
- mean fasting plasma glucose values were 143 mg/dL and 128 mg/dL in the 0.8 and 2.0 mg exenatide LAR groups, compared to 198 mg/dL for the placebo LAR group ( FIG. 2A ).
- All 3 groups had similar self-monitored blood glucose profiles and similar mean average daily blood glucose concentrations at baseline (placebo LAR: 203 mg/dL, 0.8 mg: 205 mg/dL, 2.0 mg: 195 mg/dL) ( FIG. 2B ).
- the mean average daily blood glucose concentrations decreased for both LAR treatment groups (0.8 mg: to 165 mg/dL, 2.0 mg: to 149 mg/dL) and the mean average daily blood glucose concentration rose for the placebo LAR group (to 220 mg/dL).
- Preprandial and postprandial plasma glucose concentrations decreased for both exenatide LAR groups, with the magnitude of postprandial excursions decreased by as much as four-fold with 2.0 mg exenatide LAR compared to placebo LAR.
- Glycosylated hemoglobin was reduced at the first post-exenatide LAR measurement (Week 3) for both exenatide LAR groups and progressively decreased throughout the treatment period ( FIG. 2C ).
- Week 15 significant glycosylated hemoglobin changes from baseline of ⁇ 1.4 ⁇ 0.3% and ⁇ 1.7 ⁇ 0.3% were observed for the 0.8 and 2.0 mg exenatide LAR groups, respectively, compared to +0.4 ⁇ 0.3% for the placebo LAR group, resulting in mean glycosylated hemoglobin values of 7.2% and 6.6% in the 0.8 and 2.0 mg exenatide LAR groups, compared to 9.0% for the placebo LAR group.
- Body weight decreased progressively with 2.0 mg exenatide LAR treatment, with a significant change from baseline at Week 15 of ⁇ 3.8 ⁇ 1.5 kg (3.5% of total body weight) ( FIG. 3 ). Body weight was essentially unchanged for the 0.8 mg exenatide LAR and placebo LAR groups.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/064,216 US20090239796A1 (en) | 2005-08-19 | 2006-08-18 | Methods for treating diabetes and reducing body weight |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US70960405P | 2005-08-19 | 2005-08-19 | |
US77921606P | 2006-03-03 | 2006-03-03 | |
US12/064,216 US20090239796A1 (en) | 2005-08-19 | 2006-08-18 | Methods for treating diabetes and reducing body weight |
PCT/US2006/032354 WO2007024700A2 (en) | 2005-08-19 | 2006-08-18 | Exendin for treating diabetes and reducing body weight |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2006/032354 A-371-Of-International WO2007024700A2 (en) | 2005-08-19 | 2006-08-18 | Exendin for treating diabetes and reducing body weight |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/084,757 Continuation US8329648B2 (en) | 2005-08-19 | 2011-04-12 | Methods for treating diabetes and reducing body weight |
Publications (1)
Publication Number | Publication Date |
---|---|
US20090239796A1 true US20090239796A1 (en) | 2009-09-24 |
Family
ID=37772212
Family Applications (7)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/064,216 Abandoned US20090239796A1 (en) | 2005-08-19 | 2006-08-18 | Methods for treating diabetes and reducing body weight |
US13/084,757 Active US8329648B2 (en) | 2005-08-19 | 2011-04-12 | Methods for treating diabetes and reducing body weight |
US13/708,474 Active US8906851B2 (en) | 2005-08-19 | 2012-12-07 | Method for treating diabetes |
US14/553,549 Abandoned US20150150948A1 (en) | 2005-08-19 | 2014-11-25 | Methods for treating diabetes and reducing body weight |
US15/168,350 Active US9884092B2 (en) | 2005-08-19 | 2016-05-31 | Methods for treating diabetes and reducing body weight |
US15/888,519 Abandoned US20180333468A1 (en) | 2005-08-19 | 2018-02-05 | Methods for treating diabetes and reducing body weight |
US16/752,386 Abandoned US20200222509A1 (en) | 2005-08-19 | 2020-01-24 | Methods for treating diabetes and reducing body weight |
Family Applications After (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/084,757 Active US8329648B2 (en) | 2005-08-19 | 2011-04-12 | Methods for treating diabetes and reducing body weight |
US13/708,474 Active US8906851B2 (en) | 2005-08-19 | 2012-12-07 | Method for treating diabetes |
US14/553,549 Abandoned US20150150948A1 (en) | 2005-08-19 | 2014-11-25 | Methods for treating diabetes and reducing body weight |
US15/168,350 Active US9884092B2 (en) | 2005-08-19 | 2016-05-31 | Methods for treating diabetes and reducing body weight |
US15/888,519 Abandoned US20180333468A1 (en) | 2005-08-19 | 2018-02-05 | Methods for treating diabetes and reducing body weight |
US16/752,386 Abandoned US20200222509A1 (en) | 2005-08-19 | 2020-01-24 | Methods for treating diabetes and reducing body weight |
Country Status (25)
Country | Link |
---|---|
US (7) | US20090239796A1 (pl) |
EP (3) | EP2347762B1 (pl) |
JP (2) | JP5693817B2 (pl) |
KR (1) | KR101059279B1 (pl) |
CN (1) | CN105056211A (pl) |
AU (2) | AU2006283517B2 (pl) |
BR (1) | BRPI0615358B8 (pl) |
CA (1) | CA2619426C (pl) |
CY (1) | CY1122010T1 (pl) |
DK (3) | DK2347762T3 (pl) |
ES (3) | ES2968190T3 (pl) |
FI (1) | FI3524261T3 (pl) |
HR (1) | HRP20150186T1 (pl) |
HU (2) | HUE064811T2 (pl) |
IL (2) | IL189607A (pl) |
LT (2) | LT2347762T (pl) |
MX (1) | MX2008002370A (pl) |
NZ (2) | NZ593461A (pl) |
PL (3) | PL1971362T3 (pl) |
PT (3) | PT3524261T (pl) |
RS (1) | RS53814B1 (pl) |
RU (1) | RU2421237C2 (pl) |
SG (1) | SG184730A1 (pl) |
SI (3) | SI1971362T1 (pl) |
WO (1) | WO2007024700A2 (pl) |
Cited By (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2012054817A1 (en) * | 2010-10-22 | 2012-04-26 | Mitokine Bioscience, Llc | Delaying and/ or treating hyperglycemia, including diabetes, with poly(alkyl carboxylic acids) |
US20140257238A1 (en) * | 2009-12-24 | 2014-09-11 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US20150030575A1 (en) * | 2011-10-24 | 2015-01-29 | University Of Central Florida Research Foundation, Inc. | Orally administered plastid expressed cholera toxin b subunit-exendin 4 as treatment for type 2 diabetes |
US9034819B2 (en) | 2008-05-21 | 2015-05-19 | Amylin Pharmaceuticals, Llc | Method of lowering cholesterol and triglycerides by administering exendins |
US9402806B2 (en) | 2010-12-23 | 2016-08-02 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9403002B2 (en) | 2009-08-03 | 2016-08-02 | Rani Therapeutics, Llc | Swallowable capsule and method for stimulating incretin production within the intestinal tract |
US9457065B2 (en) | 2010-12-23 | 2016-10-04 | Rani Therapeutics, Llc | Methods for delivering insulin preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9486414B2 (en) | 2010-12-23 | 2016-11-08 | Rani Therapeutics, Llc | Method for delivering liraglutide preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9492378B2 (en) | 2010-12-23 | 2016-11-15 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9511121B2 (en) | 2010-12-23 | 2016-12-06 | Rani Therapeutics, Llc | Method for delivering exenatide to a patient in need thereof |
US9539207B2 (en) | 2010-12-23 | 2017-01-10 | Rani Therapeutics, Llc | Method for delivering pramlintide into a lumen of the intestinal tract using a swallowable drug delivery |
US9629799B2 (en) | 2010-12-23 | 2017-04-25 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
US20170240610A1 (en) * | 2014-08-21 | 2017-08-24 | Daphot Enterprises Limited | Peptide for treatment of type 2 diabetes mellitus and its complications |
US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9757514B2 (en) | 2010-12-23 | 2017-09-12 | Rani Therapeutics, Llc | Device, system and methods for the oral delivery of therapeutic compounds |
US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
US9808510B2 (en) | 2011-06-29 | 2017-11-07 | Rani Therapeutics, Llc | Method for delivering gonadotropin releasing hormone into a lumen of the intestinal tract |
US9814763B2 (en) | 2010-12-23 | 2017-11-14 | Incube Labs, Llc | Method for delivery of somatostatin into a lumen of the intestinal tract |
US9844655B2 (en) | 2010-12-23 | 2017-12-19 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9861683B2 (en) | 2010-12-23 | 2018-01-09 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
WO2018191599A1 (en) * | 2017-04-14 | 2018-10-18 | University Of Massachusetts | Brown fat-selective adipokines |
US10487145B2 (en) | 2010-12-23 | 2019-11-26 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10639272B2 (en) | 2010-12-23 | 2020-05-05 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10752681B2 (en) | 2010-12-23 | 2020-08-25 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
US20210322084A1 (en) * | 2018-10-12 | 2021-10-21 | Miraki Innovation Think Tank Llc | Cold solution for fat reduction |
Families Citing this family (62)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7731947B2 (en) | 2003-11-17 | 2010-06-08 | Intarcia Therapeutics, Inc. | Composition and dosage form comprising an interferon particle formulation and suspending vehicle |
ATE388698T1 (de) | 2003-04-29 | 2008-03-15 | Orexigen Therapeutics Inc | Zusammensetzungen zur beeinflussung des gewichtsverlusts |
WO2006083761A2 (en) | 2005-02-03 | 2006-08-10 | Alza Corporation | Solvent/polymer solutions as suspension vehicles |
US11246913B2 (en) | 2005-02-03 | 2022-02-15 | Intarcia Therapeutics, Inc. | Suspension formulation comprising an insulinotropic peptide |
CN105056211A (zh) | 2005-08-19 | 2015-11-18 | 安米林药品有限责任公司 | 治疗糖尿病和降低体重的毒蜥外泌肽 |
AU2007266475B2 (en) | 2006-05-30 | 2009-12-03 | Intarcia Therapeutics, Inc. | Two-piece, internal-channel osmotic delivery system flow modulator |
NZ574524A (en) | 2006-08-09 | 2011-07-29 | Intarcia Therapeutics Inc | Piston assembly for positioning lumen of a reservoir for an osmotic delivery having a columnar body and a spring |
AU2008244523B2 (en) | 2007-04-23 | 2012-02-16 | Intarcia Therapeutics, Inc. | Suspension formulations of insulinotropic peptides and uses thereof |
JP2009019027A (ja) * | 2007-07-16 | 2009-01-29 | Hanmi Pharmaceutical Co Ltd | アミノ末端のアミノ酸が変異したインスリン分泌ペプチド誘導体 |
CA2726861C (en) | 2008-02-13 | 2014-05-27 | Intarcia Therapeutics, Inc. | Devices, formulations, and methods for delivery of multiple beneficial agents |
JP2011521973A (ja) | 2008-05-30 | 2011-07-28 | オレキシジェン・セラピューティクス・インコーポレーテッド | 内臓脂肪の状態を処置するための方法 |
BRPI0918904B8 (pt) | 2008-09-04 | 2021-05-25 | Amylin Pharmaceuticals Inc | formulação pré-misturada fabricada para injeção, seu uso e kit compreendendo a mesma |
PT2349324T (pt) | 2008-10-17 | 2017-12-06 | Sanofi Aventis Deutschland | Combinação de uma insulina e de um agonista do glp-1 |
EP2435061A4 (en) | 2009-05-28 | 2013-03-27 | Amylin Pharmaceuticals Inc | DAMPING GLP-1 RECEPTOR AGONIST COMPOUNDS |
WO2011037623A1 (en) | 2009-09-28 | 2011-03-31 | Intarcia Therapeutics, Inc. | Rapid establishment and/or termination of substantial steady-state drug delivery |
US20120294855A1 (en) | 2009-11-03 | 2012-11-22 | Eli Lilly & Company | Glp-1 receptor agonist compounds for obstructive sleep apnea |
EP2498801B1 (de) | 2009-11-13 | 2018-01-24 | Sanofi-Aventis Deutschland GmbH | HARMAZEUTISCHE ZUSAMMENSETZUNG UMFASSEND desPro36Exendin-4(1-39)-Lys6-NH2 UND METHIONIN |
PL2498802T3 (pl) | 2009-11-13 | 2015-06-30 | Sanofi Aventis Deutschland | Kompozycja farmaceutyczna zawierająca agonistę GLP-1, insulinę i metioninę |
KR20120124423A (ko) | 2010-01-11 | 2012-11-13 | 오렉시젠 세러퓨틱스 인크. | 주우울증 환자들에 있어서 체중 감량 치료를 제공하는 방법 |
EP2389945A1 (en) * | 2010-05-28 | 2011-11-30 | Sanofi-Aventis Deutschland GmbH | Pharmaceutical composition comprising AVE0010 and insulin glargine |
EP2611458B1 (en) | 2010-08-30 | 2016-09-21 | Sanofi-Aventis Deutschland GmbH | Use of ave0010 for the manufacture of a medicament for the treatment of diabetes mellitus type 2 |
EP3326620B1 (en) | 2010-12-16 | 2020-03-04 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2- hydroxybenzoyl)amino)caprylic acid |
US9050347B2 (en) | 2011-01-25 | 2015-06-09 | Viviabiotech, S.L. | 1,2,4-oxadiazole derivatives as drugs modulating the GLP-1 peptide receptor |
US20120208755A1 (en) | 2011-02-16 | 2012-08-16 | Intarcia Therapeutics, Inc. | Compositions, Devices and Methods of Use Thereof for the Treatment of Cancers |
CA2832811A1 (en) | 2011-04-12 | 2012-10-18 | Novo Nordisk A/S | Double-acylated glp-1 derivatives |
US9821032B2 (en) | 2011-05-13 | 2017-11-21 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin |
WO2013004983A1 (en) | 2011-07-04 | 2013-01-10 | Imperial Innovations Limited | Novel compounds and their effects on feeding behaviour |
BR112014004726A2 (pt) | 2011-08-29 | 2017-04-04 | Sanofi Aventis Deutschland | combinação farmacêutica para uso no controle glicêmico em pacientes de diabetes tipo 2 |
AR087744A1 (es) | 2011-09-01 | 2014-04-16 | Sanofi Aventis Deutschland | Composicion farmaceutica para uso en el tratamiento de una enfermedad neurodegenerativa |
DK2827845T3 (en) | 2012-03-22 | 2019-04-01 | Novo Nordisk As | COMPOSITIONS INCLUDING A PROCEDURE AND PREPARING THEREOF |
EP4324475A1 (en) | 2012-03-22 | 2024-02-21 | Novo Nordisk A/S | Compositions of glp-1 peptides and preparation thereof |
PT3730132T (pt) | 2012-06-06 | 2022-08-16 | Nalpropion Pharmaceuticals Llc | Composição para utilização num método de tratamento de excesso de peso e obesidade em doentes com alto risco cardiovascular |
US9993430B2 (en) | 2012-06-20 | 2018-06-12 | Novo Nordisk A/S | Tablet formulation comprising semaglutide and a delivery agent |
US20160039877A1 (en) | 2013-03-15 | 2016-02-11 | Shenzhen Hightide Biopharmaceutical, Ltd. | Compositions and methods of using islet neogenesis peptides and analogs thereof |
EP3485900A1 (en) | 2013-05-02 | 2019-05-22 | Novo Nordisk A/S | Oral dosing of glp-1 compounds |
JP6672175B2 (ja) | 2014-05-07 | 2020-03-25 | ノヴォ ノルディスク アー/エス | Glp−1及び抗il−21を使用した1型糖尿病の治療 |
US9889085B1 (en) | 2014-09-30 | 2018-02-13 | Intarcia Therapeutics, Inc. | Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c |
CN107106499B (zh) * | 2014-11-02 | 2021-09-17 | 纳诺精密医疗有限公司 | 用于延长释放治疗剂的可植入医药装置 |
EP3229828B1 (en) | 2014-12-12 | 2023-04-05 | Sanofi-Aventis Deutschland GmbH | Insulin glargine/lixisenatide fixed ratio formulation |
TWI748945B (zh) | 2015-03-13 | 2021-12-11 | 德商賽諾菲阿凡提斯德意志有限公司 | 第2型糖尿病病患治療 |
TW201705975A (zh) | 2015-03-18 | 2017-02-16 | 賽諾菲阿凡提斯德意志有限公司 | 第2型糖尿病病患之治療 |
PE20180034A1 (es) | 2015-04-07 | 2018-01-09 | Intercept Pharmaceuticals Inc | Composiciones farmaceuticas para terapias combinadas |
EP3297653B1 (en) | 2015-05-22 | 2021-09-15 | The Board of Trustees of the Leland Stanford Junior University | Treatment of post-bariatric hypoglycemia with glp-1 antagonists |
KR101661332B1 (ko) * | 2015-05-28 | 2016-09-29 | (의료)길의료재단 | 글루카곤 유사 펩타이드-1 수용체 항진제를 포함하는 근감소증 치료용 약학 조성물 |
EP3302354B1 (en) | 2015-06-03 | 2023-10-04 | i2o Therapeutics, Inc. | Implant placement systems |
US20170098040A1 (en) * | 2015-10-06 | 2017-04-06 | Scale Down | Weight management system and method |
US10653753B2 (en) | 2016-03-04 | 2020-05-19 | Eiger Biopharmaceuticals, Inc. | Treatment of hyperinsulinemic hypoglycemia with exendin-4 derivatives |
EP3468576B1 (en) | 2016-04-15 | 2023-06-07 | Syracuse University | Peptide drug improvement using vitamin b12 and haptocorrin binding substrate conjugates |
AU2017268161B2 (en) | 2016-05-16 | 2020-03-12 | Intarcia Therapeutics, Inc. | Glucagon-receptor selective polypeptides and methods of use thereof |
USD840030S1 (en) | 2016-06-02 | 2019-02-05 | Intarcia Therapeutics, Inc. | Implant placement guide |
USD860451S1 (en) | 2016-06-02 | 2019-09-17 | Intarcia Therapeutics, Inc. | Implant removal tool |
EP3515408A1 (en) | 2016-09-23 | 2019-07-31 | Delpor, Inc. | Stable compositions for incretin mimetic compounds |
JP2019535734A (ja) | 2016-11-21 | 2019-12-12 | アイガー・バイオファーマシューティカルズ・インコーポレイテッドEiger Biopharmaceuticals, Inc. | エキセンディン(9−39)の緩衝製剤 |
CA3049034A1 (en) | 2017-01-03 | 2018-07-12 | Intarcia Therapeutics, Inc. | Methods comprising continuous administration of a glp-1 receptor agonist and co-adminstration of a drug |
DK3570874T3 (da) * | 2017-01-17 | 2023-04-11 | Univ Wayne State | Zwitterionisk polymer-insulin-sammensætninger og dertil relaterede fremgangsmåder |
KR20190126335A (ko) | 2017-03-08 | 2019-11-11 | 인타르시아 세라퓨틱스 인코포레이티드 | 약물 전달 장치로부터 메스꺼움 유발 화합물을 투여하기 위한 장치 및 방법 |
BR112019023511A2 (pt) | 2017-05-11 | 2020-05-19 | Shenzhen Hightide Biopharmaceutical Ltd | uso de compostos peptídeos no tratamento de pancreatite aguda |
PL3746111T3 (pl) | 2018-02-02 | 2024-01-15 | Novo Nordisk A/S | Stałe kompozycje zawierające agonistę glp-1 i sól kwasu n-(8-(2- hydroksybenzoilo)amino kaprylowego i substancję poślizgową |
WO2019240755A1 (en) * | 2018-06-11 | 2019-12-19 | Wellesley Pharmaceuticals, Llc | Pharmaceutical compositions and methods for weight loss |
KR20210081376A (ko) * | 2018-10-30 | 2021-07-01 | 지아닝 리우 | Glp-1 수용체 작용제 활성을 갖는 glp-1 폴리펩티드 및 그의 용도 |
US20230201174A1 (en) | 2020-04-22 | 2023-06-29 | Bayer Aktiengesellschaft | Combination of finerenone and a sglt2 inhibitor for the treatment and/or prevention of cardiovascular and/or renal diseases |
KR102556528B1 (ko) * | 2020-12-08 | 2023-07-17 | 경희대학교 산학협력단 | 대사성 질환 예방, 개선 또는 치료용 조성물 |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030087820A1 (en) * | 1999-01-14 | 2003-05-08 | Young Andrew A. | Novel exendin agonist formulations and methods of administration thereof |
US20040121009A1 (en) * | 2002-10-17 | 2004-06-24 | Alkermes Controlled Therapeutics, Inc. | Method of modifying the release profile of sustained release compositions |
US6924264B1 (en) * | 1999-04-30 | 2005-08-02 | Amylin Pharmaceuticals, Inc. | Modified exendins and exendin agonists |
US7259233B2 (en) * | 2000-12-13 | 2007-08-21 | Eli Lilly And Company | Chronic treatment regimen using glucagon-like insulinotropic peptides |
US7563871B2 (en) * | 2004-04-15 | 2009-07-21 | Alkermes, Inc. | Polymer-based sustained release device |
Family Cites Families (48)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US386998A (en) | 1888-07-31 | Boiler | ||
US3490597A (en) | 1966-07-22 | 1970-01-20 | Purolator Products Inc | Cover plate for spin-on-filter |
DE68925966T2 (de) | 1988-12-22 | 1996-08-29 | Kirin Amgen Inc | Chemisch modifizierte granulocytenkolonie erregender faktor |
US5445781A (en) | 1991-08-28 | 1995-08-29 | Centro Sviluppo Settori Impiego S.R.L. | Process for the injection molding of non-precatalyzed polymerizable resins at high-pressure and flow |
US5509305A (en) | 1992-02-12 | 1996-04-23 | Daniel Industries, Inc. | Closely coupled, dual turbine volumetric flow meter |
US5656297A (en) | 1992-03-12 | 1997-08-12 | Alkermes Controlled Therapeutics, Incorporated | Modulated release from biocompatible polymers |
US6284727B1 (en) | 1993-04-07 | 2001-09-04 | Scios, Inc. | Prolonged delivery of peptides |
US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
GB2282891B (en) | 1993-10-13 | 1997-09-03 | Tokai Rika Co Ltd | Acceleration detecting apparatus |
US5650173A (en) | 1993-11-19 | 1997-07-22 | Alkermes Controlled Therapeutics Inc. Ii | Preparation of biodegradable microparticles containing a biologically active agent |
AU684324B2 (en) | 1993-11-19 | 1997-12-11 | Alkermes Controlled Therapeutics Inc. Ii | Preparation of biodegradable microparticles containing a biologically active agent |
US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
DE69739172D1 (de) | 1996-08-08 | 2009-01-29 | Amylin Pharmaceuticals Inc | Regulation gastrointestinaler beweglichkeit |
PT1629849E (pt) | 1997-01-07 | 2013-07-09 | Amylin Pharmaceuticals Llc | Composições farmacêuticas que compreendem exendinas e seus agonistas |
EP1512395A1 (en) | 1997-07-18 | 2005-03-09 | Azopax Therapeutics LLC | Biodegradable macromers for the controlled release of biologically active substances |
US6872700B1 (en) | 1999-01-14 | 2005-03-29 | Amylin Pharmaceuticals, Inc. | Methods for glucagon suppression |
EP1140145B2 (en) * | 1999-01-14 | 2019-05-15 | Amylin Pharmaceuticals, LLC | Novel exendin agonist formulations and methods of administration thereof |
CA2372214A1 (en) * | 1999-04-30 | 2000-11-09 | Amylin Pharmaceuticals, Inc. | Modified exendins and exendin agonists |
US6162260A (en) | 1999-05-24 | 2000-12-19 | Novo Nordisk Biochem North America, Inc. | Single-bath biopreparation and dyeing of textiles |
DE60105547T3 (de) | 2000-01-10 | 2014-12-31 | Amylin Pharmaceuticals, Llc | Verwendung von exendinen und deren agonisten zur behandlung von hypertriglyceridämie |
US6602997B2 (en) | 2000-04-27 | 2003-08-05 | Shin-Etsu Bio, Inc. | Whole cell and cell-debris polysaccharide |
US6495164B1 (en) | 2000-05-25 | 2002-12-17 | Alkermes Controlled Therapeutics, Inc. I | Preparation of injectable suspensions having improved injectability |
US6479065B2 (en) | 2000-08-10 | 2002-11-12 | Alkermes Controlled Therapeutics, Inc. | Process for the preparation of polymer-based sustained release compositions |
US6824822B2 (en) | 2001-08-31 | 2004-11-30 | Alkermes Controlled Therapeutics Inc. Ii | Residual solvent extraction method and microparticles produced thereby |
US6819912B2 (en) | 2001-11-05 | 2004-11-16 | Freescale Semiconductor, Inc. | Variable frequency switching amplifier and method therefor |
US7092459B2 (en) | 2001-11-08 | 2006-08-15 | Qualcomm, Incorporated | Frequency tracking using pilot and non-pilot symbols |
GB0206792D0 (en) | 2002-03-22 | 2002-05-01 | Leuven K U Res & Dev | Normoglycemia |
US7462365B2 (en) | 2002-10-17 | 2008-12-09 | Costantino Henry R | Microencapsulation and sustained release of biologically active polypeptides |
US7790681B2 (en) | 2002-12-17 | 2010-09-07 | Amylin Pharmaceuticals, Inc. | Treatment of cardiac arrhythmias with GLP-1 receptor ligands |
WO2005040195A2 (en) | 2003-10-24 | 2005-05-06 | Azopax Therapeutics Llc | Formulation of exendins |
WO2005041873A2 (en) | 2003-10-24 | 2005-05-12 | Azopax Therapeutics Llc | Formulation of exendin-4 |
EP1694278A4 (en) | 2003-12-16 | 2009-08-12 | Ipsen Pharma | GLP-1 PHARMACEUTICAL COMPOSITIONS |
US7456254B2 (en) * | 2004-04-15 | 2008-11-25 | Alkermes, Inc. | Polymer-based sustained release device |
JP5254610B2 (ja) | 2004-05-14 | 2013-08-07 | エミスフェアー・テクノロジーズ・インク | 活性薬剤を送達するための化合物および組成物 |
PL1765310T3 (pl) | 2004-05-28 | 2016-04-29 | Oryxe | Mieszanina do podawania przezskórnego nisko- i wysokocząsteczkowych związków |
CA2576689C (en) | 2004-08-12 | 2012-10-09 | Quest Pharmaceutical Services (Qps) | Pharmaceutical compositions for controlled release delivery of biologically active compounds |
US20060034889A1 (en) | 2004-08-16 | 2006-02-16 | Macromed, Inc. | Biodegradable diblock copolymers having reverse thermal gelation properties and methods of use thereof |
US7442682B2 (en) | 2004-10-19 | 2008-10-28 | Nitto Denko Corporation | Transepithelial delivery of peptides with incretin hormone activities |
US8389472B2 (en) | 2005-08-19 | 2013-03-05 | Amylin Pharmaceuticals, Llc | Exendin-4 to treat nonalcoholic steatohepatitis and nonalcoholic fatty liver disease |
CN105056211A (zh) | 2005-08-19 | 2015-11-18 | 安米林药品有限责任公司 | 治疗糖尿病和降低体重的毒蜥外泌肽 |
US7512298B2 (en) | 2006-12-01 | 2009-03-31 | 3M Innovative Properties Company | Optical sensing methods |
IT1402944B1 (it) | 2010-12-15 | 2013-09-27 | Sarong Spa | Capsula per bevande e relativa macchina per utilizzare detta capsula |
US11638099B2 (en) | 2011-12-23 | 2023-04-25 | Shenzhen Shokz Co., Ltd. | Bone conduction speaker and compound vibration device thereof |
JP6226510B2 (ja) | 2012-01-27 | 2017-11-08 | キヤノン株式会社 | 画像処理システム、処理方法及びプログラム |
ITMI20130325A1 (it) | 2013-03-05 | 2014-09-06 | Telecom Italia Spa | Metodo per misurare e monitorare il livello di accesso a dati personali generati da risorse di un dispositivo d'utente |
US9816387B2 (en) | 2014-09-09 | 2017-11-14 | United Technologies Corporation | Attachment faces for clamped turbine stator of a gas turbine engine |
CA2914090C (en) | 2015-03-31 | 2023-08-01 | Allen-Vanguard Corporation | Frequency and time domain streaming receiver |
US9714199B2 (en) | 2015-09-17 | 2017-07-25 | I P Creations Limited | Concealed amalgamated explosive neutralizer and method of manufacture |
-
2006
- 2006-08-18 CN CN201510543460.3A patent/CN105056211A/zh active Pending
- 2006-08-18 JP JP2008527170A patent/JP5693817B2/ja active Active
- 2006-08-18 SI SI200631895T patent/SI1971362T1/sl unknown
- 2006-08-18 MX MX2008002370A patent/MX2008002370A/es active IP Right Grant
- 2006-08-18 ES ES19163698T patent/ES2968190T3/es active Active
- 2006-08-18 US US12/064,216 patent/US20090239796A1/en not_active Abandoned
- 2006-08-18 WO PCT/US2006/032354 patent/WO2007024700A2/en active Application Filing
- 2006-08-18 NZ NZ593461A patent/NZ593461A/xx unknown
- 2006-08-18 LT LTEP10016112.4T patent/LT2347762T/lt unknown
- 2006-08-18 HU HUE19163698A patent/HUE064811T2/hu unknown
- 2006-08-18 DK DK10016112.4T patent/DK2347762T3/da active
- 2006-08-18 AU AU2006283517A patent/AU2006283517B2/en active Active
- 2006-08-18 PT PT191636984T patent/PT3524261T/pt unknown
- 2006-08-18 PT PT68018670T patent/PT1971362E/pt unknown
- 2006-08-18 ES ES10016112T patent/ES2736184T3/es active Active
- 2006-08-18 BR BRPI0615358A patent/BRPI0615358B8/pt active IP Right Grant
- 2006-08-18 CA CA2619426A patent/CA2619426C/en active Active
- 2006-08-18 PL PL06801867T patent/PL1971362T3/pl unknown
- 2006-08-18 EP EP10016112.4A patent/EP2347762B1/en not_active Revoked
- 2006-08-18 DK DK19163698.4T patent/DK3524261T3/da active
- 2006-08-18 PL PL19163698.4T patent/PL3524261T3/pl unknown
- 2006-08-18 KR KR1020087006560A patent/KR101059279B1/ko active IP Right Grant
- 2006-08-18 EP EP06801867.0A patent/EP1971362B1/en not_active Revoked
- 2006-08-18 EP EP19163698.4A patent/EP3524261B1/en active Active
- 2006-08-18 DK DK06801867.0T patent/DK1971362T3/en active
- 2006-08-18 ES ES06801867.0T patent/ES2526463T3/es active Active
- 2006-08-18 RS RS20150068A patent/RS53814B1/en unknown
- 2006-08-18 FI FIEP19163698.4T patent/FI3524261T3/fi active
- 2006-08-18 PL PL10016112T patent/PL2347762T3/pl unknown
- 2006-08-18 LT LTEP19163698.4T patent/LT3524261T/lt unknown
- 2006-08-18 SI SI200632434T patent/SI3524261T1/sl unknown
- 2006-08-18 PT PT10016112T patent/PT2347762T/pt unknown
- 2006-08-18 HU HUE10016112A patent/HUE045165T2/hu unknown
- 2006-08-18 SI SI200632332T patent/SI2347762T1/sl unknown
- 2006-08-18 SG SG2012066304A patent/SG184730A1/en unknown
- 2006-08-18 NZ NZ566763A patent/NZ566763A/en unknown
- 2006-08-18 RU RU2008110504/15A patent/RU2421237C2/ru active
-
2008
- 2008-02-19 IL IL189607A patent/IL189607A/en active IP Right Grant
-
2011
- 2011-02-16 AU AU2011200663A patent/AU2011200663B2/en active Active
- 2011-04-12 US US13/084,757 patent/US8329648B2/en active Active
-
2012
- 2012-12-07 US US13/708,474 patent/US8906851B2/en active Active
-
2014
- 2014-10-15 JP JP2014210957A patent/JP5980872B2/ja active Active
- 2014-11-25 US US14/553,549 patent/US20150150948A1/en not_active Abandoned
-
2015
- 2015-02-17 HR HRP20150186TT patent/HRP20150186T1/hr unknown
- 2015-12-27 IL IL243317A patent/IL243317A0/en unknown
-
2016
- 2016-05-31 US US15/168,350 patent/US9884092B2/en active Active
-
2018
- 2018-02-05 US US15/888,519 patent/US20180333468A1/en not_active Abandoned
-
2019
- 2019-06-04 CY CY20191100588T patent/CY1122010T1/el unknown
-
2020
- 2020-01-24 US US16/752,386 patent/US20200222509A1/en not_active Abandoned
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030087820A1 (en) * | 1999-01-14 | 2003-05-08 | Young Andrew A. | Novel exendin agonist formulations and methods of administration thereof |
US6924264B1 (en) * | 1999-04-30 | 2005-08-02 | Amylin Pharmaceuticals, Inc. | Modified exendins and exendin agonists |
US7259233B2 (en) * | 2000-12-13 | 2007-08-21 | Eli Lilly And Company | Chronic treatment regimen using glucagon-like insulinotropic peptides |
US20040121009A1 (en) * | 2002-10-17 | 2004-06-24 | Alkermes Controlled Therapeutics, Inc. | Method of modifying the release profile of sustained release compositions |
US7563871B2 (en) * | 2004-04-15 | 2009-07-21 | Alkermes, Inc. | Polymer-based sustained release device |
Cited By (89)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9034819B2 (en) | 2008-05-21 | 2015-05-19 | Amylin Pharmaceuticals, Llc | Method of lowering cholesterol and triglycerides by administering exendins |
US9403002B2 (en) | 2009-08-03 | 2016-08-02 | Rani Therapeutics, Llc | Swallowable capsule and method for stimulating incretin production within the intestinal tract |
US9987487B2 (en) | 2009-08-03 | 2018-06-05 | Incube Labs, Llc | Swallowable capsule and method for stimulating incretin production within the intestinal tract |
US11872396B2 (en) | 2009-08-03 | 2024-01-16 | Incube Labs, Llc | Swallowable capsule and method for stimulating incretin production within the intestinal tract |
US11439817B2 (en) | 2009-08-03 | 2022-09-13 | Incube Labs, Llc | Swallowable capsule and method for stimulating incretin production within the intestinal tract |
US11338118B2 (en) | 2009-12-24 | 2022-05-24 | Rani Therapeutics, Llc | Swallowable drug delivery device and methods of drug delivery |
US10603475B2 (en) | 2009-12-24 | 2020-03-31 | Rani Therapeutics, Llc | Swallowable drug delivery device and methods of drug delivery |
US11376405B2 (en) | 2009-12-24 | 2022-07-05 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9757548B2 (en) * | 2009-12-24 | 2017-09-12 | Rani Therapeutics, Llc | Method for delivering a therapeutic agent into the wall of the small intestine |
US11253686B2 (en) | 2009-12-24 | 2022-02-22 | Rani Therapeutics, Llc | Swallowable drug delivery device and methods of drug delivery |
US10987499B2 (en) | 2009-12-24 | 2021-04-27 | Rani Therapeutics, Llc | Swallowable drug delivery device and method of delivery |
US20140257238A1 (en) * | 2009-12-24 | 2014-09-11 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9456988B2 (en) | 2009-12-24 | 2016-10-04 | Rani Therapeutics, Llc | Swallowable drug delivery device and methods of drug delivery |
US10596359B2 (en) | 2009-12-24 | 2020-03-24 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10493253B2 (en) | 2009-12-24 | 2019-12-03 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10252039B2 (en) | 2009-12-24 | 2019-04-09 | Rani Therapeutics, Llc | Therapeutic agent preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10179228B2 (en) | 2009-12-24 | 2019-01-15 | Rani Therapeutics, Llc | Swallowable drug delivery device and methods of drug delivery |
US10039908B2 (en) | 2009-12-24 | 2018-08-07 | Rani Therapeutics, Llc | Swallowable drug delivery device and method of delivery |
WO2012054817A1 (en) * | 2010-10-22 | 2012-04-26 | Mitokine Bioscience, Llc | Delaying and/ or treating hyperglycemia, including diabetes, with poly(alkyl carboxylic acids) |
US10953077B2 (en) | 2010-12-23 | 2021-03-23 | Rani Therapeutics, Llc | Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device |
US9629799B2 (en) | 2010-12-23 | 2017-04-25 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9757514B2 (en) | 2010-12-23 | 2017-09-12 | Rani Therapeutics, Llc | Device, system and methods for the oral delivery of therapeutic compounds |
US11844867B2 (en) | 2010-12-23 | 2023-12-19 | Rani Therapeutics, Llc | Method of delivering insulin into a lumen of the intestinal tract using a swallowable drug delivery device |
US11813314B2 (en) | 2010-12-23 | 2023-11-14 | Rani Therapeutics, Llc | Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device |
US11814427B2 (en) | 2010-12-23 | 2023-11-14 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US11806504B2 (en) | 2010-12-23 | 2023-11-07 | Rani Therapeutics, Llc | Device, system and methods for the oral delivery of therapeutic compounds |
US9814763B2 (en) | 2010-12-23 | 2017-11-14 | Incube Labs, Llc | Method for delivery of somatostatin into a lumen of the intestinal tract |
US9844655B2 (en) | 2010-12-23 | 2017-12-19 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9844505B2 (en) | 2010-12-23 | 2017-12-19 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9861683B2 (en) | 2010-12-23 | 2018-01-09 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US11771879B2 (en) | 2010-12-23 | 2023-10-03 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9907747B2 (en) | 2010-12-23 | 2018-03-06 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US11684761B2 (en) | 2010-12-23 | 2023-06-27 | Rani Therapeutics, Llc | Preparation comprising exanatide for delivery into a lumen of the intestinal tract |
US9956178B2 (en) | 2010-12-23 | 2018-05-01 | Rani Therapeutics, Llc | Methods for delivering insulin preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US11654182B2 (en) | 2010-12-23 | 2023-05-23 | Rani Therapeutics, Llc | Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device |
US11638690B2 (en) | 2010-12-23 | 2023-05-02 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10004783B2 (en) | 2010-12-23 | 2018-06-26 | Rani Therapeutics, Llc | Method for delivering pramlintide into a lumen of the intestinal tract using a swallowable drug delivery device |
US10029080B2 (en) | 2010-12-23 | 2018-07-24 | Rani Therapeutics, Llc | Method for delivering exenatide into a lumen of the intestinal tract using a swallowable drug delivery device |
US11555068B2 (en) | 2010-12-23 | 2023-01-17 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9402806B2 (en) | 2010-12-23 | 2016-08-02 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US11419812B2 (en) | 2010-12-23 | 2022-08-23 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9457065B2 (en) | 2010-12-23 | 2016-10-04 | Rani Therapeutics, Llc | Methods for delivering insulin preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US9486414B2 (en) | 2010-12-23 | 2016-11-08 | Rani Therapeutics, Llc | Method for delivering liraglutide preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10300010B2 (en) | 2010-12-23 | 2019-05-28 | Rani Therapeutics, Llc | Methods for delivering entanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10307579B2 (en) | 2010-12-23 | 2019-06-04 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10314892B2 (en) | 2010-12-23 | 2019-06-11 | Rani Therapeutics, Llc | Method of delivering a somatostatin compound into a lumen of the intestinal tract using a swallowable drug delivery device |
US10314891B2 (en) | 2010-12-23 | 2019-06-11 | Rani Therapeutics, Llc | Method for delivering pramlintide into a lumen of the intestinal tract using a swallowable drug delivery device |
US10322167B2 (en) | 2010-12-23 | 2019-06-18 | Rani Therapeutics, Llc | Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device |
US10335463B2 (en) | 2010-12-23 | 2019-07-02 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10350163B2 (en) | 2010-12-23 | 2019-07-16 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10478396B2 (en) | 2010-12-23 | 2019-11-19 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10487145B2 (en) | 2010-12-23 | 2019-11-26 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US11304895B2 (en) | 2010-12-23 | 2022-04-19 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10548850B2 (en) | 2010-12-23 | 2020-02-04 | Rani Therapeutics, Llc | Therapeutic composition comprising insulin prepared for delivery into an intestinal tract |
US9492378B2 (en) | 2010-12-23 | 2016-11-15 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US11229684B2 (en) | 2010-12-23 | 2022-01-25 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10632251B2 (en) | 2010-12-23 | 2020-04-28 | Rani Therapeutics, Llc | Device, system and methods for the oral delivery of therapeutic compounds |
US10639272B2 (en) | 2010-12-23 | 2020-05-05 | Rani Therapeutics, Llc | Methods for delivering etanercept preparations into a lumen of the intestinal tract using a swallowable drug delivery device |
US10752681B2 (en) | 2010-12-23 | 2020-08-25 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9511121B2 (en) | 2010-12-23 | 2016-12-06 | Rani Therapeutics, Llc | Method for delivering exenatide to a patient in need thereof |
US10980749B2 (en) | 2010-12-23 | 2021-04-20 | Rani Therapeutics, Llc | Therapeutic preparation comprising insulin for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10864254B2 (en) | 2010-12-23 | 2020-12-15 | Rani Therapeutics, Llc | Method of delivering gonadotropin releasing hormone or an analogue thereof into a lumen of the intestinal tract using a swallowable drug delivery device |
US10967050B2 (en) | 2010-12-23 | 2021-04-06 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10874840B2 (en) | 2010-12-23 | 2020-12-29 | Rani Therapeutics, Llc | Preparation comprising exanatide for delivery into a lumen of the intestinal tract |
US10888517B2 (en) | 2010-12-23 | 2021-01-12 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US10926073B2 (en) | 2010-12-23 | 2021-02-23 | Rani Therapeutics, Llc | Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device |
US9539207B2 (en) | 2010-12-23 | 2017-01-10 | Rani Therapeutics, Llc | Method for delivering pramlintide into a lumen of the intestinal tract using a swallowable drug delivery |
US9808510B2 (en) | 2011-06-29 | 2017-11-07 | Rani Therapeutics, Llc | Method for delivering gonadotropin releasing hormone into a lumen of the intestinal tract |
US20150030575A1 (en) * | 2011-10-24 | 2015-01-29 | University Of Central Florida Research Foundation, Inc. | Orally administered plastid expressed cholera toxin b subunit-exendin 4 as treatment for type 2 diabetes |
US10865419B2 (en) * | 2011-10-24 | 2020-12-15 | The Trustees Of The University Of Pennsylvania | Orally administered plastid expressed cholera toxin B subunit-exendin 4 as treatment for type 2 diabetes |
US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
US10253079B2 (en) | 2012-12-21 | 2019-04-09 | Sanofi | Functionalized Exendin-4 derivatives |
US9745360B2 (en) | 2012-12-21 | 2017-08-29 | Sanofi | Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists |
US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
US9868773B2 (en) * | 2014-08-21 | 2018-01-16 | Daphot Enterprises Limited | Peptide for treatment of type 2 diabetes mellitus and its complications |
US20170240610A1 (en) * | 2014-08-21 | 2017-08-24 | Daphot Enterprises Limited | Peptide for treatment of type 2 diabetes mellitus and its complications |
US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
US11795201B2 (en) | 2017-04-14 | 2023-10-24 | University Of Massachusetts | Brown fat-selective adipokines |
WO2018191599A1 (en) * | 2017-04-14 | 2018-10-18 | University Of Massachusetts | Brown fat-selective adipokines |
US20210322084A1 (en) * | 2018-10-12 | 2021-10-21 | Miraki Innovation Think Tank Llc | Cold solution for fat reduction |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200222509A1 (en) | Methods for treating diabetes and reducing body weight | |
US9034819B2 (en) | Method of lowering cholesterol and triglycerides by administering exendins | |
US8299024B2 (en) | Methods to restore glycemic control | |
US20030087820A1 (en) | Novel exendin agonist formulations and methods of administration thereof | |
KR20010086165A (ko) | 신규 엑센딘 아고니스트 제제 및 이의 투여 방법 | |
AU2013205769A1 (en) | Exendin for treating diabetes and reducing body weight |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KIM, DENNIS D.;MAGGS, DAVID A.;WINTLE, MATTHEW EDWARD;REEL/FRAME:020771/0481;SIGNING DATES FROM 20060227 TO 20060327 Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FINEMAN, MARK;MACCONELL, LEIGH;TAYLOR, KRISTIN;REEL/FRAME:020771/0543;SIGNING DATES FROM 20060626 TO 20060712 Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FINEMAN, MARK;MACCONELL, LEIGH;TAYLOR, KRISTIN;REEL/FRAME:020771/0651;SIGNING DATES FROM 20060626 TO 20060712 Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KIM, DENNIS D.;MAGGS, DAVID A.;WINTLE, MATTHEW EDWARD;SIGNING DATES FROM 20060227 TO 20060327;REEL/FRAME:020771/0481 Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FINEMAN, MARK;MACCONELL, LEIGH;TAYLOR, KRISTIN;SIGNING DATES FROM 20060626 TO 20060712;REEL/FRAME:020771/0543 Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FINEMAN, MARK;MACCONELL, LEIGH;TAYLOR, KRISTIN;SIGNING DATES FROM 20060626 TO 20060712;REEL/FRAME:020771/0651 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
AS | Assignment |
Owner name: AMYLIN PHARMACEUTICALS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FINEMAN, MARK;MACCONELL, LEIGH;TAYLOR, KRISTIN;SIGNING DATES FROM 20110426 TO 20110706;REEL/FRAME:026557/0954 |