EP1171464A2 - Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12 - Google Patents

Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12

Info

Publication number
EP1171464A2
EP1171464A2 EP00938503A EP00938503A EP1171464A2 EP 1171464 A2 EP1171464 A2 EP 1171464A2 EP 00938503 A EP00938503 A EP 00938503A EP 00938503 A EP00938503 A EP 00938503A EP 1171464 A2 EP1171464 A2 EP 1171464A2
Authority
EP
European Patent Office
Prior art keywords
homodimer
monomer
heterodimer
monomers
interleukin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00938503A
Other languages
German (de)
English (en)
Inventor
Raimund J. Wieser
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of EP1171464A2 publication Critical patent/EP1171464A2/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/5434—IL-12
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to homodimers or heterodimers from peptide monomers which have the amino acid sequence KHYSCTAEDID (Monomer I), PPVGEADPYRVKMQ (Monomer II), AALQNHNHQQIILDK (Monomer III), IRDIIKPDPPKN (Monomer IV), SLTFCRQQDOMWLLT or RFTTCVQDWLGLT (RFTQVDQWWLL) or SLTFCRQQDQWLGT (RFTQVDQWL) Variants thereof, the homodimers or heterodimers binding to the interleukin 12 (IL12) receptor and possibly being able to trigger a cellular signal.
  • the present invention also relates to medicaments containing these homodimers or heterodimers.
  • the present invention further relates to diagnostic compositions or diagnostic methods in which the homodimers or heterodimers according to the invention or antibodies directed against them are used.
  • cytokines are endogenous messenger substances that are synthesized by different cells and then secreted.
  • the biological tasks of these cytokines are very diverse, but so far only partially understood. In any case, cytokines mainly have fundamental immunoregulatory effects.
  • IL12 interleukin 12
  • IL12 is mainly produced in vivo by B cells, less by T cells (D'Andrea et al., J.Exp.Med. 176 (1992), 1387-1398) and has a variety of biological effects. The following effects are particularly noteworthy, since they play an important role in the therapeutic effect: stimulation of the proliferation of human lymphoblasts (Gateley et al., J. Immunol. 147 (1991), 874), Akti- crossing of NK cells (Manetti et al., J.Exp.Med. 177 (1999), 1199) and induction of the synthesis of IFN-gamma, IL2 and TNF (Chan et al., J.Exp.Med. 173 ( 1991), 869).
  • the dose of IL2 in the presence of IL12 can be drastically reduced in the case of adoptive immunotherapy for the generation of lymphokine-activated killer cells, so that the serious side effects of IL2 can be significantly reduced.
  • IL12 is a heterodimer consisting of a p40 and p35 chain (Stern et al., Proc. Natl. Acad. Sci. USA 87 (1990), 6808).
  • p40 has certain homologies to the extracellular domain of the IL6 receptor (Gearing and Cosman, Cell ⁇ (1991), 9), while p35 appears to be a homologue of IL6 (Mersberg et al., Im unol. Today .13 (1992 ), 77).
  • the p35 chain is apparently responsible for signaling at the IL12 receptor, while the p40 subunit is likely to determine species specificity.
  • the IL12 subunits also have certain short domains that interact with the receptor.
  • the administration of a short IL12 domain that interacts with the receptor could possibly be sufficient to achieve the desired cellular effects (e.g. immunostimulatory effect).
  • IL12 for example with synthesized peptides, which could provide information about suitable IL12 domains.
  • cytokines are generally only present in extremely low concentrations in the serum, it is not possible to isolate therapeutically usable amounts from this medium. Therefore, the therapeutically used cytokines have been recombinantly used in Bacteria or yeast. However, this procedure has a number of serious disadvantages.
  • cytokines require a lot of effort in the "set-up". For example, it must be clarified whether the host cell expresses the protein exactly or in the exact native conformation, which is the best host cell or the best expression vector and under which conditions the protein is not proteolytically degraded. It should be noted here that generally recombinantly produced proteins are from the native protein. have a different tertiary structure and are therefore recognized as "foreign" by the human immune system. The antibodies induced thereby neutralize the protein, for example the cytokine, and thus lead to a loss of its effectiveness.
  • cytokines normally have to be administered in a regular sequence during therapy, it must be ensured that they are absolutely free of contamination, i.e. especially components of the host cell. As a result, complex procedures must be used that have an unfavorable effect on pricing.
  • messenger substances e.g. cytokines
  • cytokines messenger substances not only have a binding site for the receptor, but that other - currently. yet domains that are not fully understood may exist that may induce signaling pathways other than those that are intended.
  • this could explain the frequently occurring side effects of the cytokines used to date, which in some cases make treatment with these impossible.
  • the invention is essentially based on the technical problem of providing compounds with a biological activity of interleukin 12 (IL12) in such a way that the previous disadvantages of the prior art are avoided, i.e. when administered as a medicinal product, fewer side effects, a longer half-life and high biological activity are obtained.
  • IL12 interleukin 12
  • One embodiment of the present invention relates to a synthetic homodimer or heterodimer composed of peptide monomers which have the amino acid sequence KHYSCTAEDID (Monomer I), PPVGEADPYRVKMQ (Monomer II), AALQNHNHQQIILDK (Monomer III), IRDIIKPDPPKN (Monomer IV), VGTLKTQMDQTLKTQVQQWLTLKTQQQQQWLLKTQVQQQQWLLKTQVQQQQWLLKLQQQQWLQWLKVQQQQQWLQWLQWLQWLVLQVLQWLQWLQWLQWLQWLQWLKVLQLQLQLQQQQQQQQWLQKVQQQQVLQKVLQKVQQQQVLQKVLQKVQQQQVLQKVLQKVQQQQVLQKVLQKVLQKVLQK
  • peptides according to the invention represent the binding regions of the IL12 subunits p40 and p35 and take advantage of the knowledge that the peptides from p35 and p40 must be used in a dimerized form for a biological effect, since the receptors must also lie together twice in order to Triggering the intracellular signals to be able to.
  • Monomers I-III comprise 3 loops which are located at the point of contact of p35 with the interleukin 12 receptor, while analogously the monomers IV-VI represent the contact points for p40 with the receptor.
  • the dimers according to the invention have the following advantages: They are easy to use using standardized methods synthesize and purify them and they can be used immediately for the necessary tests (e.g.
  • peptides represent the minimal structures of the respective cytokine that are required for its biological effectiveness. This ensures the highest specificity and high biological activity combined with the least side effects. Due to the small size of the peptides, they can be microcapsulated, which results in depot forms with different duration of action - depending on the pore size of the capsules. The depot form can be applied locally, so that the highest concentration of the active ingredient is guaranteed over a long period of time at the desired location (eg cancer focus).
  • all combinations of the monomers I - VI with one another are capable of forming dimers, and the dimers formed achieve the object.
  • the peptides according to the invention are usually synthesized by known solid-phase synthesis processes, for example as described in Example 1 below.
  • the biological activity (binding to the receptor, triggering a cellular signal and proliferation-stimulating effect) is investigated by methods known to the person skilled in the art, e.g. according to Lewis, J. Immuno1. Methods 185 (1995), 9-17; Grander et al., Eur. J. Cancer 28A (1992), 815-818 or, for example, also according to the methods described in the examples below.
  • the peptides described above are homodimers or heterodimers in which the monomers are linked via their C-terminus or N-termini or the N-terminus of one monomer is linked to the C-terminus of the other monomer is linked.
  • the C-terminus of monomer I is linked to the N- or C-terminus of monomer II, or the N-terminus of monomer I is linked to the N- or C-terminus of monomer II.
  • the desired N-terminal peptide in a side-function-protected form is activated after removal of the protective group (preferably Fmoc) by treatment with, for example, piperidine with a crosslinker, and the product is purified by HPLC.
  • the protective group preferably Fmoc
  • Another previously synthesized monomer is also provided (either at the C- or N-terminus - depending on the desired dimer) in its enfunction-protected form with a group which only reacts with the N-terminal group of the bound peptide.
  • the dimers which differ significantly from the monomers in terms of elution behavior, are purified and isolated after removal of the side protecting groups by standard methods using reverse phase HPLC. If the amino acid addition permits, the activation groups and crosslinkers can also be selected in such a way that dimerization of free monomers can be carried out directly in solution after removal of the side chain protective groups.
  • the synthesis strategy can be carried out on the HYCHRON anchor as described in the example, so that the side chain protective groups are retained and dimerization can be carried out in aqueous solution.
  • This linkage can be carried out, for example, using the method described in the examples below or other standard methods, it being necessary to ensure that the dimerization takes place in such a way that binding to the receptor pair is still possible effectively.
  • the dimerization can be carried out on a lysine residue as a branch point (Wrighton et al., Nature Biotechnology 15 (1997), 1261-1265).
  • the homomers of the dimers according to the invention are preferably covalently linked to one another via linkers, such as polyethylene glycol, peptide (s), activated benzodiazepines, oxazolones, azalactones, amine imides, diketopiperazines, or (a) monosaccharide (s).
  • the present invention also relates to homodimers or heterodimers which are characterized in that the monomers have deletions, additions or substitutions of one or more amino acids and / or (a) modified amino acid (s) with respect to the corresponding starting monomers I to VI. Homo- or heterodimers are obtained, which (a) compared to the original. Can bind forms similar or better to the IL12 receptor and / or can trigger a cellular signal, or (b) can still bind to the IL12 receptor, but have an antagonistic effect, ie after administration, the biologically active form becomes this form, the no longer leads to the triggering of a cellular signal after binding to the receptor.
  • Natural amino acids are preferably introduced in the case of the amino acid substitutions or additions, with modified amino acids not being excluded.
  • the preferred modifications include glycosylations with mono- or disaccharides of serine, threonine and asparagine, farnesylation and palmitoylation of cysteine, phosphorylation of threonine, serine and tyrosine, the modifications which affect the central amino acids mostly leading to antagonistic forms.
  • the deletions, additions, substitutions and / or modifications relate to at most 10, preferably at most 7, more preferably at most 3 and most preferably at most 1 amino acid (s) per monomer.
  • the inventive, from modified monomers Existing homo- or heterodimers contain, in addition to the domain responsible for receptor binding, no other domains which are characteristic of the natural cytokine.
  • the dimer according to the invention or consisting of modified monomers is preferably the following homodimers: [AALQNHNHQQIILDK] 2 or [AALQNHNKQQIILDK] 2 , which even have a significantly higher specific activity than IL12. Both monomers are linked to both CC and CN.
  • the homodimers or heterodimers according to the invention can be present as such, but can also be linked to other further compounds, for example (poly) peptides.
  • These (poly) peptides include, for example, carrier proteins, e.g. Transferin or albumin, which the body does not recognize as foreign.
  • the homodimers or heterodimers according to the invention can also be fused with other (poly) peptides, for example a leader peptide which enables or supports the penetration of the peptide according to the invention into the cell.
  • a leader peptide is Penetrin from Drosophila.
  • the present invention relates to the above homodimers or heterodimers, which are further characterized in that one or more amino acids are covalently modified by fatty acids, mono- and / or oligosaccharides.
  • one or more amino acids are covalently modified by fatty acids, mono- and / or oligosaccharides.
  • This can be done by generally known methods, for example during the synthesis of the monomers through the use of amino acids which already carry the above modifications.
  • the modifications can also be made retrospectively. These modifications can, for example, achieve a higher resistance to proteolytic degradation and thus an even longer biological half-life.
  • the present invention further relates to an antibody or a fragment thereof against the dimers according to the invention described above.
  • These antibodies can also be used in diagnostic assays, for example.
  • These antibodies can be monoclonal, polyclonal or synthetic antibodies or fragments thereof.
  • fragment means all parts of the monoclonal antibody (for example Fab, Fv or "single chain Fv" fragments) which have the same epitope specificity as the complete antibody. The production of such fragments is known to the person skilled in the art.
  • the antibodies according to the invention are preferably monoclonal antibodies.
  • the antibodies according to the invention can be produced according to standard methods, the homodimers or heterodimers according to the invention serving as antigen. Methods for obtaining monoclonal antibodies are known to the person skilled in the art.
  • the monoclonal antibody according to the invention is an antibody derived from an animal (for example a mouse), a humanized antibody or a chimeric antibody or a fragment thereof.
  • Chimeric, human antibody-like or humanized antibodies have a reduced potential antigenicity, but their affinity for the target is not reduced.
  • the production of chimeras and humanized antibodies or of antibodies similar to human antibodies has been described in detail (see, for example, Queen et al., Proc. Natl. Acad. Sci. USA 86 (1989), 10029, and Verhoeyan et al., Science 239 (1988), 1534).
  • Humanized immunoglobulins have variable scaffold areas, which essentially come from a human immunoglobulin (called acceptor immunoglobulin) and the complementarity of the determining areas, which essentially come from a non-human immunoglobulin (e.g. from the mouse) (called donor) Immunoglobulin).
  • acceptor immunoglobulin human immunoglobulin
  • donor non-human immunoglobulin
  • humanized (as well as human) antibodies offer a number of advantages over antibodies from mice or other species: (a) the human immune system should not recognize the framework or constant region of the humanized antibody as foreign, and therefore should Antibody response against one injected antibodies are lower than against a completely foreign mouse antibody or a partially foreign chimeric antibody; (b) since the effector area of the humanized antibody is human, it interacts better with other parts of the human immune system, and (c) injected humanized antibodies have a half-life that is substantially equivalent to that of naturally occurring human antibodies, which allows to administer smaller and less frequent doses compared to antibodies from other species.
  • the present invention also relates to a hybridoma that produces the monoclonal antibody described above.
  • the present invention relates to the medicaments containing homodimers or heterodimers according to the invention and their use for the treatment of diseases of the immune system, of diseases which are associated with decreased cell proliferation, or of infectious or inflammatory processes (for example HIV, leishmaniasis): Mountford et al., J. Immuol. 156 (996), pp. 4739-4745). Certain modified forms of the dimers according to the invention can also have an antagonistic effect.
  • the present invention thus also relates to the medicaments containing the homodimers or heterodimers according to the invention and their use for the treatment of diseases which are associated with increased cell proliferation, e.g.
  • the present invention also relates to medicaments containing the dimers according to the invention and their use for reducing the IL2 side effects in the case of therapy with IL2, for example immunotherapy.
  • the medicament according to the invention is optionally in combination with a suitable pharmaceutical carrier.
  • suitable carriers and the formulation of such drugs are known to the person skilled in the art.
  • Suitable carriers include, for example, phosphate-buffered saline solutions, water, emulsions, for example oil / water emulsions, wetting agents, sterile solutions, etc.
  • the medicament according to the invention can be in the form of a solution for injection, tablet, ointment, suspension, emulsion, suppository, etc. It can also be administered in the form of depots (microcapsules, zinc salts, liposomes, etc.).
  • the mode of administration of the drug depends, among other things, on the form in which the active ingredient is present, and can be administered orally or parenterally.
  • Methods for parenteral administration include topical, intra-arterial (e.g. directly to a tumor), intramuscular, intramedullary, intrathecal, intraventricular, intravenous, intraperitoneal, transdermal or transmucosal (nasal, vaginal, rectal, sublingual) administration.
  • the appropriate dosage is determined by the attending physician and depends on various factors, for example the age, gender, weight of the patient, the type and stage of the disease, the type of administration, etc.
  • the present invention relates to a diagnostic composition which contains the homodimer or heterodimer according to the invention or the antibody according to the invention and can be used to diagnose diseases which are associated with an altered or too high or too low expressed IL12 receptor or with a too high or low concentration of IL12.
  • the homodimers or heterodimers according to the invention can be present in generally customary assay formats for diagnostic detection.
  • This detection includes, for example, (a) obtaining a cell sample from the patient, (b) contacting the cell sample thus obtained with the homo- or. Heterodimer or antibody as a probe under conditions that allow specific binding to the target and (c) detection of binding to the target. This detection can be performed using standard techniques known to those skilled in the art.
  • the compounds according to the invention can be bound, for example, in the liquid phase or to a solid support. They will be marked in different ways. Suitable markers and marking methods are known to the person skilled in the art. These are also known cell disruption methods which allow IL12 or the receptor to be brought into specific contact with the antibody or homo- or heterodimer according to the invention.
  • the present invention relates to a diagnostic kit for carrying out the diagnostic method described above, which contains a dimer according to the invention or the antibody according to the invention or the fragment thereof.
  • the dimer or the antibody or the fragment thereof can be immobilized.
  • PPVGEADPYRVKMQ (Monomer II), AALQNHNHQQIILDK (Monomer III), IRDIIKPDPPKN (Monomer IV).
  • SLTFCVOVOGKSKR (Monomer V) and RFTCWWLTTISTDLTF (Monomer VI)
  • the monomers I-VI were prepared according to a standard solid phase synthesis (Seitz et al., Angew. Chem. 107 (1995), 901). The synthesis was carried out on a HYCHRON anchor with an Fmoc-protected amino acid starting from the C-terminus.
  • the carboxyl groups of glutamic acid and aspartic acid were protected in the form of tert-butyl esters.
  • the protecting groups of the side chains of Tyr included tetrahydropyranyl, tert-butyl (Boc) and trityl groups.
  • the complete monomers were synthesized in this order.
  • the finished monomers were separated from the column by a palladium (0) catalyzed allyl transfer, the protecting groups on the side chains being retained.
  • the Fmoc group was then replaced by morpholine, the remaining protective groups were removed by treatment with TFA.
  • the dimerization of the monomers I was carried out by dissolving 25 mg of activated bifunctional polyethylene glycol (PEG-succinimidyl propionate, MW approx. 3400; Sigma, Taufkirchen) in 4 ml of PBS, pH 7.5, after which a triple molar excess of monomers was dissolved in 1 ml of 0.1% trifluoroacetic acid. After 3 hours of incubation on ice, lyophilized monomers were again added, so that at the end there was a ratio of 3.5 mol of monomer to 1 mol of PEG. The mixture was incubated on ice for an additional 17 hours. PEG was inactivated by adding 1 M Tris / HCl, pH 7.5 (final concentration: 50 mM Tris) (incubation: 1 hour on ice). The mixture was subjected to both analytical and preparative HPLC (see Example 5).
  • PEG-succinimidyl propionate activated bifunctional polyethylene glycol
  • PBS pH
  • the dimerization of the monomers II was carried out by dissolving 25 mg of activated bifunctional polyethylene glycol (PEG-succinimidyl propionate, MW approx. 3400; Sigma, Taufkirchen) in 4 ml of PBS, pH 7.5, after which a triple molar excess of monomers was dissolved in 1 ml of 0.1% trifluoroacetic acid. After 3 hours of incubation on ice, lyophilized monomers were again added, so that at the end there was a ratio of 3.5 mol of monomer to 1 mol of PEG. The mixture was incubated on ice for an additional 17 hours. PEG was inactivated by adding 1 M Tris / HCl, pH 7.5 (final concentration: 50 mM Tris) (incubation: 1 hour on ice). The mixture was subjected to both analytical and preparative HPLC (see Example 5).
  • PEG-succinimidyl propionate activated bifunctional polyethylene glycol
  • PBS pH
  • the monomers were dimerized by dissolving 25 mg of activated bifunctional polyethylene glycol (PEG-succinimidyl propionate, MW approx. 3400; Sigma, Taufkirchen) in 4 ml of PBS, pH 7.5, after which a triple molar excess of monomers, dissolved in 1 ml of 0.1% trifluoroacetic acid was added. After 3 hours of incubation on ice, lyophilized monomers were again added, so that at the end there was a ratio of 3.5 mol of monomer to 1 mol of PEG. The mixture was incubated on ice for an additional 17 hours. PEG was inactivated by adding 1 M Tris / HCl, pH 7.5 (final concentration: 50 mM Tris) (incubation: 1 hour on ice). The mixture was subjected to both analytical and preparative HPLC (see Example 5).
  • the monomers were used in a ratio of 1: 1, the separation was carried out using reverse phase HPLC, since the two dimers differ significantly in their elution behavior (depending on the composition, a difference in the elution peak of between 4 and 9 minutes) and can therefore be separated from one another.
  • the formation of the dimers described in the previous examples was checked by analytical reverse phase HPLC.
  • the analysis was performed using a Vydac-C18 protein peptide column (0.46 x 25 cm) (The Separation Group, USA), a BioRad HPLC system and a dual-wavelength detector from Perkin-Elmer.
  • the column was washed with 0.1% TFA in dist. Water equilibrated, and 10 min. after the sample was injected (usually 6 ml), a 45-minute linear gradient (0-100) of acetonitrile was run with 0.1% TFA. The flow rate became continuous at 1 ml / min. held. Under these conditions the cross-linker appeared in the flow.
  • the reaction product eluted after 37 min.
  • the dimer was further purified on a preparative reverse HPLC column (2.2 ⁇ 25 cm) on the same HPLC system. The column was run at a constant flow rate of 8 ml / min. with dist. Water: 80:20 acetonitrile (both contained 0.1% TFA) equilibrated. 20 min. after injection of the sample (6 ml), a 60-minute linear gradient was run on 100% acetonitrile / 0.1% TFA. The main peak was collected and lyophilized.
  • the dimers were iodinated as described below. 20 ul chloramine T (0.5 mg / ml) were added to 20 ul Na 1 5 I (2 mCi, Amersham Buchler, Braunschweig), the mixture was 2 min. later mixed to 50 ⁇ l dimer (5 ⁇ g in PBS) and 15 sec. incubated. To terminate the reaction, 30 ⁇ l sodium metabulfite (1 mg / ml in PBS) and after 30 sec. 50 ⁇ l KI (10 mg / ml in PBS) were added. Gelatin (50 ⁇ l, 1 mg / ml.
  • the stimulated cells (7.5 x 10 5 cells / ml RPMI medium) were incubated for 90 minutes with radiolabelled dimer in various concentrations (0.01 to 1 ng) and then washed by means of 3 centrifugation steps in PBS and the cell-bound radioactivity measured in the liquid scintillation counter. The extent of non-specific binding was determined in the presence of a 100-fold higher concentration of IL12, with labeled homodimer and IL12 being added to the cells at the same time. The results are shown in Table I.
  • Example 9 Production and detection of an antibody according to the invention
  • the heterodimer prepared in Example 4 was subjected to 18% SDS-polyacrylamide gel electrophoresis. After staining the gel with 4 M sodium acetate, an approximately 6.5 kB band was cut out of the gel and boiled in phosphate-buffered Incubated saline. The dimer is eluted from the gel using an electroeluctor (BioRad) and lyophilized overnight after kB dialysis. The peptide is taken up in a concentration of 5 mg / ml PBS and mixed with the carrier protein albumin in a ratio of 1 mol peptide / p. 02 mol carrier in a total of 2 ml PBS.
  • the rabbit's serum was tested in the immunoblot.
  • a heterodimer according to the invention from Example 4 was subjected to SDS-polyacrylamide gel electrophoresis and transferred to a nitrocellulose filter (cf. Khyse-Andersen, J., J. Biochem. Biophys. Meth. 10, (1984), 203-209).
  • Western blot analysis was performed as in Bock, C.-T. et al. , Virus Genes 8, (1994), 215-229.
  • the nitrocellulose filter was incubated for one hour at 37 ° C. with a first antibody. This antibody was the serum of the Rabbit (1: 10,000 in PBS).
  • the nitrocellulose filter was incubated with a second antibody.
  • This antibody was an alkaline phosphatase-coupled goat monoclonal anti-rabbit IgG antibody (Dianova) (1: 5000) in PBS. After 30 minutes of incubation at 37 ° C, several washing steps with PBS followed and then the alkaline phosphatase detection reaction with developer solution (36 ⁇ M 5 'Bronio-4-ch.loro--3-indolylphosph.at, 400 ⁇ M nitroblue tetrazolium, 100mm Tris HCl, pH 9.5, 100 mM NaCl, 5 mM MgCl 2 ) at room temperature until bands were visible.
  • Antibodies were extracted from egg yolk and tested in a Western blot. Polyclonal antibodies according to the invention have been detected.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

L'invention concerne des homodimères ou des hétérodimères issus de monomères peptidiques qui présentent la séquence d'aminoacide KHYSCTAEDID (monomère I), PPVGEADPYRVKMQ (monomère II), AALQNHNHQQIILDK (monomère III), IRDIIKPDPPKN (monomère IV), SLTFCVQVQGKSKR (monomère V) ou RFTCWWLTTISTDLTF (monomère VI) ou des variantes de ladite séquence. Les homodimères ou les hétérodimères se fixent sur le récepteur de l'interleukine 12 (IL12) et émettent éventuellement un signal cellulaire. Ces dimères s'utilisent d'une part pour traiter des affections du système immunitaire, des affections liées à une augmentation ou à une diminution de la prolifération cellulaire, des processus infectieux ou inflammatoires, et d'autre part pour mettre en évidence des pathologies liées par exemple à un récepteur IL12 modifié ou exprimé de manière excessive ou insuffisante.
EP00938503A 1999-04-27 2000-04-20 Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12 Withdrawn EP1171464A2 (fr)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19919148 1999-04-27
DE19919148A DE19919148A1 (de) 1999-04-27 1999-04-27 Von Interleukin 12 abgeleitete Peptid-Homodimere und Peptid-Heterodimere
PCT/DE2000/001260 WO2000064938A2 (fr) 1999-04-27 2000-04-20 Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12

Publications (1)

Publication Number Publication Date
EP1171464A2 true EP1171464A2 (fr) 2002-01-16

Family

ID=7906047

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00938503A Withdrawn EP1171464A2 (fr) 1999-04-27 2000-04-20 Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12

Country Status (6)

Country Link
EP (1) EP1171464A2 (fr)
JP (1) JP2002543091A (fr)
AU (1) AU5388600A (fr)
CA (1) CA2370298A1 (fr)
DE (1) DE19919148A1 (fr)
WO (1) WO2000064938A2 (fr)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2007347182A1 (en) * 2006-09-15 2008-08-21 The Burnham Institute High affinity EphB receptor binding compounds and methods of use thereof
CA2828504A1 (fr) * 2011-03-14 2012-09-20 Serodus Asa Antagonistes du recepteur de l'interleukine-1

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2125763C (fr) * 1993-07-02 2007-08-28 Maurice Kent Gately Homodimere p40 de l'interleukine-12
US5891680A (en) * 1995-02-08 1999-04-06 Whitehead Institute For Biomedical Research Bioactive fusion proteins comprising the p35 and p40 subunits of IL-12

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0064938A2 *

Also Published As

Publication number Publication date
WO2000064938A3 (fr) 2001-04-12
WO2000064938A2 (fr) 2000-11-02
AU5388600A (en) 2000-11-10
JP2002543091A (ja) 2002-12-17
CA2370298A1 (fr) 2000-11-02
DE19919148A1 (de) 2000-11-16

Similar Documents

Publication Publication Date Title
DE69028671T3 (de) Löslisches extrazellulares Fragment des menschlischen IFN-beta 2/IL-6-Rezeptors, seine Herstellung und diesen Fragment enthaltende pharmazeutische Mischung
DE69017753T3 (de) Tumor-Nekrosefaktor-Bindungsprotein II, seine Reinigung und spezifische Antikörper
DE69434217T2 (de) Conotoxine
DE3100974C2 (fr)
DE3346953C2 (fr)
DE102005029845B4 (de) Verfahren zur Diagnose von rheumatischen Erkrankungen
CH682152A5 (fr)
DE2921216C2 (fr)
DE69813204T2 (de) Materialen und verfahren im zusammenhang mit der inhibierung der wechselwirkung der p53 und mdm2
DE60103078T2 (de) Chemokin mutanten zur behandlung multipler sklerose
DE60124915T2 (de) Synthetische peptide gegen neurologische krankheiten
DE69637078T2 (de) Polypeptid-fragmente die fähig sind mit dem antigen i/ii von streptococcus mutans zu konkurrieren
DE69630583T2 (de) Peptide, bronchodilator und den blutstrom verbesserndes mittel
DE60318749T2 (de) Paralytisches peptid von der spitzmaus sowie dessen nutzung in der therapie von neuromuskulären krankheiten
DE102004051014A1 (de) Chemisch modifizierte Peptidanaloga
DE60222265T2 (de) Zelltod-induktoren für mastzellen
EP1277837A2 (fr) Séquences d'ADN spécifique d'épididymis et leur utilisation
EP1171464A2 (fr) Homodimeres polypeptidiques ou heterodimeres polypeptidiques derives de l'interleukine 12
DE2710455C2 (de) N-Acetylmuramyl-L-alanyl-D-glutaminsäure-alpha-methylamid, Verfahren zu seiner Herstellung und diese Verbindung enthaltende Arzneimittel
EP0338437A2 (fr) Vaccins synthétiques contre la fièvre aphteuse et leur procédé de préparation
EP1171463A2 (fr) Homodimeres peptidiques et heterodimeres peptidiques derives de l'interferon alpha 2
EP1023445B1 (fr) Facteur de croissance derive de la cadherine et son utilisation
EP0307553B1 (fr) Splénopentines modifiées, leur procédé de préparation et leur emploi
EP1466614A1 (fr) Polypeptide, son conjugue avec doxorubicine et composition pharmaceutique sur cette base
DE69814148T2 (de) Zielspezifische abgabe zum nukleus mittels protein h von streptococcus

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20011108

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20021101