DE69512760T2 - Verwendung von Melatonin zur Behandlung von Patienten die an Drogenabhängigkeit leiden - Google Patents
Verwendung von Melatonin zur Behandlung von Patienten die an Drogenabhängigkeit leidenInfo
- Publication number
- DE69512760T2 DE69512760T2 DE69512760T DE69512760T DE69512760T2 DE 69512760 T2 DE69512760 T2 DE 69512760T2 DE 69512760 T DE69512760 T DE 69512760T DE 69512760 T DE69512760 T DE 69512760T DE 69512760 T2 DE69512760 T2 DE 69512760T2
- Authority
- DE
- Germany
- Prior art keywords
- melatonin
- benzodiazepine
- benzodiazepine drug
- drug
- patient
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- DRLFMBDRBRZALE-UHFFFAOYSA-N melatonin Chemical compound COC1=CC=C2NC=C(CCNC(C)=O)C2=C1 DRLFMBDRBRZALE-UHFFFAOYSA-N 0.000 title claims description 120
- YJPIGAIKUZMOQA-UHFFFAOYSA-N Melatonin Natural products COC1=CC=C2N(C(C)=O)C=C(CCN)C2=C1 YJPIGAIKUZMOQA-UHFFFAOYSA-N 0.000 title claims description 117
- 229960003987 melatonin Drugs 0.000 title claims description 117
- 206010013663 drug dependence Diseases 0.000 title description 3
- 208000011117 substance-related disease Diseases 0.000 title description 2
- 229940049706 benzodiazepine Drugs 0.000 claims description 85
- SVUOLADPCWQTTE-UHFFFAOYSA-N 1h-1,2-benzodiazepine Chemical compound N1N=CC=CC2=CC=CC=C12 SVUOLADPCWQTTE-UHFFFAOYSA-N 0.000 claims description 45
- 239000003814 drug Substances 0.000 claims description 45
- 150000001557 benzodiazepines Chemical class 0.000 claims description 38
- 238000011282 treatment Methods 0.000 claims description 37
- 229940079593 drug Drugs 0.000 claims description 30
- 208000024891 symptom Diseases 0.000 claims description 21
- AAOVKJBEBIDNHE-UHFFFAOYSA-N diazepam Chemical compound N=1CC(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 AAOVKJBEBIDNHE-UHFFFAOYSA-N 0.000 claims description 14
- 229960003529 diazepam Drugs 0.000 claims description 14
- 239000000825 pharmaceutical preparation Substances 0.000 claims description 12
- 206010012335 Dependence Diseases 0.000 claims description 10
- 102000001419 Melatonin receptor Human genes 0.000 claims description 10
- 108050009605 Melatonin receptor Proteins 0.000 claims description 10
- 239000003607 modifier Substances 0.000 claims description 8
- 238000013270 controlled release Methods 0.000 claims description 7
- 238000004519 manufacturing process Methods 0.000 claims description 7
- 230000001419 dependent effect Effects 0.000 claims description 6
- 229960002200 flunitrazepam Drugs 0.000 claims description 6
- PPTYJKAXVCCBDU-UHFFFAOYSA-N Rohypnol Chemical compound N=1CC(=O)N(C)C2=CC=C([N+]([O-])=O)C=C2C=1C1=CC=CC=C1F PPTYJKAXVCCBDU-UHFFFAOYSA-N 0.000 claims description 5
- DIWRORZWFLOCLC-HNNXBMFYSA-N (3s)-7-chloro-5-(2-chlorophenyl)-3-hydroxy-1,3-dihydro-1,4-benzodiazepin-2-one Chemical compound N([C@H](C(NC1=CC=C(Cl)C=C11)=O)O)=C1C1=CC=CC=C1Cl DIWRORZWFLOCLC-HNNXBMFYSA-N 0.000 claims description 4
- 229960004391 lorazepam Drugs 0.000 claims description 4
- ADIMAYPTOBDMTL-UHFFFAOYSA-N oxazepam Chemical compound C12=CC(Cl)=CC=C2NC(=O)C(O)N=C1C1=CC=CC=C1 ADIMAYPTOBDMTL-UHFFFAOYSA-N 0.000 claims description 4
- 229960004535 oxazepam Drugs 0.000 claims description 4
- WYCLKVQLVUQKNZ-UHFFFAOYSA-N Halazepam Chemical compound N=1CC(=O)N(CC(F)(F)F)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 WYCLKVQLVUQKNZ-UHFFFAOYSA-N 0.000 claims description 3
- MWQCHHACWWAQLJ-UHFFFAOYSA-N Prazepam Chemical compound O=C1CN=C(C=2C=CC=CC=2)C2=CC(Cl)=CC=C2N1CC1CC1 MWQCHHACWWAQLJ-UHFFFAOYSA-N 0.000 claims description 3
- SEQDDYPDSLOBDC-UHFFFAOYSA-N Temazepam Chemical compound N=1C(O)C(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 SEQDDYPDSLOBDC-UHFFFAOYSA-N 0.000 claims description 3
- 239000002671 adjuvant Substances 0.000 claims description 3
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 claims description 3
- 229960004538 alprazolam Drugs 0.000 claims description 3
- 229960004782 chlordiazepoxide Drugs 0.000 claims description 3
- ANTSCNMPPGJYLG-UHFFFAOYSA-N chlordiazepoxide Chemical compound O=N=1CC(NC)=NC2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 ANTSCNMPPGJYLG-UHFFFAOYSA-N 0.000 claims description 3
- 229960004362 clorazepate Drugs 0.000 claims description 3
- XDDJGVMJFWAHJX-UHFFFAOYSA-N clorazepic acid Chemical compound C12=CC(Cl)=CC=C2NC(=O)C(C(=O)O)N=C1C1=CC=CC=C1 XDDJGVMJFWAHJX-UHFFFAOYSA-N 0.000 claims description 3
- 239000003085 diluting agent Substances 0.000 claims description 3
- 230000001747 exhibiting effect Effects 0.000 claims description 3
- 229960003528 flurazepam Drugs 0.000 claims description 3
- SAADBVWGJQAEFS-UHFFFAOYSA-N flurazepam Chemical compound N=1CC(=O)N(CCN(CC)CC)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1F SAADBVWGJQAEFS-UHFFFAOYSA-N 0.000 claims description 3
- 229960002158 halazepam Drugs 0.000 claims description 3
- 229960004856 prazepam Drugs 0.000 claims description 3
- 229960003188 temazepam Drugs 0.000 claims description 3
- JOFWLTCLBGQGBO-UHFFFAOYSA-N triazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1Cl JOFWLTCLBGQGBO-UHFFFAOYSA-N 0.000 claims description 3
- 229960003386 triazolam Drugs 0.000 claims description 3
- 239000003405 delayed action preparation Substances 0.000 claims description 2
- 239000002552 dosage form Substances 0.000 claims description 2
- UOACKFBJUYNSLK-XRKIENNPSA-N Estradiol Cypionate Chemical group O([C@H]1CC[C@H]2[C@H]3[C@@H](C4=CC=C(O)C=C4CC3)CC[C@@]21C)C(=O)CCC1CCCC1 UOACKFBJUYNSLK-XRKIENNPSA-N 0.000 claims 1
- 230000027455 binding Effects 0.000 description 23
- 230000007958 sleep Effects 0.000 description 18
- 238000002360 preparation method Methods 0.000 description 17
- 230000000694 effects Effects 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 11
- QQEILXDLZRLTME-UHFFFAOYSA-N 6-sulfatoxymelatonin Chemical compound C1=C(OS(O)(=O)=O)C(OC)=CC2=C1NC=C2CCNC(C)=O QQEILXDLZRLTME-UHFFFAOYSA-N 0.000 description 9
- 239000004480 active ingredient Substances 0.000 description 9
- 210000000278 spinal cord Anatomy 0.000 description 8
- 210000002700 urine Anatomy 0.000 description 8
- 241000700159 Rattus Species 0.000 description 7
- 230000028327 secretion Effects 0.000 description 7
- 210000004556 brain Anatomy 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 230000001684 chronic effect Effects 0.000 description 5
- 239000003651 drinking water Substances 0.000 description 5
- 235000020188 drinking water Nutrition 0.000 description 5
- 230000006872 improvement Effects 0.000 description 5
- 238000000034 method Methods 0.000 description 5
- 208000019116 sleep disease Diseases 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 239000003326 hypnotic agent Substances 0.000 description 4
- 230000000147 hypnotic effect Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000033764 rhythmic process Effects 0.000 description 4
- 230000003860 sleep quality Effects 0.000 description 4
- RSTKLPZEZYGQPY-UHFFFAOYSA-N 3-(indol-3-yl)pyruvic acid Chemical compound C1=CC=C2C(CC(=O)C(=O)O)=CNC2=C1 RSTKLPZEZYGQPY-UHFFFAOYSA-N 0.000 description 3
- 229920003134 Eudragit® polymer Polymers 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 208000013738 Sleep Initiation and Maintenance disease Diseases 0.000 description 3
- 206010022437 insomnia Diseases 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 238000002483 medication Methods 0.000 description 3
- 230000000422 nocturnal effect Effects 0.000 description 3
- 210000004560 pineal gland Anatomy 0.000 description 3
- 230000003449 preventive effect Effects 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 108090000623 proteins and genes Proteins 0.000 description 3
- 238000009256 replacement therapy Methods 0.000 description 3
- 208000019901 Anxiety disease Diseases 0.000 description 2
- 229920003159 Eudragit® RS 100 Polymers 0.000 description 2
- 102000004300 GABA-A Receptors Human genes 0.000 description 2
- 108090000839 GABA-A Receptors Proteins 0.000 description 2
- 206010019233 Headaches Diseases 0.000 description 2
- 241000282414 Homo sapiens Species 0.000 description 2
- SIKJAQJRHWYJAI-UHFFFAOYSA-N Indole Chemical compound C1=CC=C2NC=CC2=C1 SIKJAQJRHWYJAI-UHFFFAOYSA-N 0.000 description 2
- 208000019695 Migraine disease Diseases 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000036506 anxiety Effects 0.000 description 2
- 125000003310 benzodiazepinyl group Chemical group N1N=C(C=CC2=C1C=CC=C2)* 0.000 description 2
- 210000003710 cerebral cortex Anatomy 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 231100000869 headache Toxicity 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 206010027599 migraine Diseases 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000000902 placebo Substances 0.000 description 2
- 229940068196 placebo Drugs 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 230000004620 sleep latency Effects 0.000 description 2
- 230000004622 sleep time Effects 0.000 description 2
- 230000008454 sleep-wake cycle Effects 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 230000002485 urinary effect Effects 0.000 description 2
- LRANPJDWHYRCER-UHFFFAOYSA-N 1,2-diazepine Chemical compound N1C=CC=CC=N1 LRANPJDWHYRCER-UHFFFAOYSA-N 0.000 description 1
- 239000004925 Acrylic resin Substances 0.000 description 1
- 229920000178 Acrylic resin Polymers 0.000 description 1
- 241000272517 Anseriformes Species 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 206010013654 Drug abuse Diseases 0.000 description 1
- 241000919956 Guzmania lingulata Species 0.000 description 1
- 206010019133 Hangover Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 102000001490 Opioid Peptides Human genes 0.000 description 1
- 108010093625 Opioid Peptides Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 238000010161 Student-Newman-Keuls test Methods 0.000 description 1
- 208000007271 Substance Withdrawal Syndrome Diseases 0.000 description 1
- 208000034972 Sudden Infant Death Diseases 0.000 description 1
- 206010042440 Sudden infant death syndrome Diseases 0.000 description 1
- 229940123445 Tricyclic antidepressant Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 230000010455 autoregulation Effects 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 229940097320 beta blocking agent Drugs 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000004027 cell Anatomy 0.000 description 1
- 230000002060 circadian Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000007580 dry-mixing Methods 0.000 description 1
- 210000002745 epiphysis Anatomy 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- PZOUSPYUWWUPPK-UHFFFAOYSA-N indole Natural products CC1=CC=CC2=C1C=CN2 PZOUSPYUWWUPPK-UHFFFAOYSA-N 0.000 description 1
- RKJUIXBNRJVNHR-UHFFFAOYSA-N indolenine Natural products C1=CC=C2CC=NC2=C1 RKJUIXBNRJVNHR-UHFFFAOYSA-N 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 101150006061 neur gene Proteins 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 239000003176 neuroleptic agent Substances 0.000 description 1
- 238000010984 neurological examination Methods 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 239000003399 opiate peptide Substances 0.000 description 1
- -1 p. 352ff Chemical compound 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000012254 powdered material Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 208000022925 sleep disturbance Diseases 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 210000003568 synaptosome Anatomy 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 230000003867 tiredness Effects 0.000 description 1
- 208000016255 tiredness Diseases 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000003029 tricyclic antidepressant agent Substances 0.000 description 1
- 230000002618 waking effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 210000000707 wrist Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
- A61K31/404—Indoles, e.g. pindolol
- A61K31/4045—Indole-alkylamines; Amides thereof, e.g. serotonin, melatonin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/30—Drugs for disorders of the nervous system for treating abuse or dependence
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/02—Antidotes
Landscapes
- Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Addiction (AREA)
- Psychiatry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US08/381,535 US6469044B1 (en) | 1995-02-01 | 1995-02-01 | Method for treating patients suffering from drug dependencies which lead to plasma melationin deficiencies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE69512760D1 DE69512760D1 (de) | 1999-11-18 |
| DE69512760T2 true DE69512760T2 (de) | 2000-05-31 |
Family
ID=23505399
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE69512760T Expired - Lifetime DE69512760T2 (de) | 1995-02-01 | 1995-06-06 | Verwendung von Melatonin zur Behandlung von Patienten die an Drogenabhängigkeit leiden |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US6469044B1 (cg-RX-API-DMAC10.html) |
| EP (1) | EP0724878B1 (cg-RX-API-DMAC10.html) |
| KR (1) | KR100425045B1 (cg-RX-API-DMAC10.html) |
| AR (1) | AR003921A1 (cg-RX-API-DMAC10.html) |
| DE (1) | DE69512760T2 (cg-RX-API-DMAC10.html) |
| ES (1) | ES2139842T3 (cg-RX-API-DMAC10.html) |
| IL (1) | IL114296A (cg-RX-API-DMAC10.html) |
| LT (1) | LT4339B (cg-RX-API-DMAC10.html) |
| RO (1) | RO116771B1 (cg-RX-API-DMAC10.html) |
| RU (1) | RU2182001C2 (cg-RX-API-DMAC10.html) |
| UA (1) | UA63878C2 (cg-RX-API-DMAC10.html) |
| ZA (1) | ZA96548B (cg-RX-API-DMAC10.html) |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6469044B1 (en) * | 1995-02-01 | 2002-10-22 | Neurim Pharmaceuticals (1991) Ltd. | Method for treating patients suffering from drug dependencies which lead to plasma melationin deficiencies |
| IL130171A (en) * | 1999-05-27 | 2004-06-01 | Neurim Pharma 1991 | Melatonin for use in the prevention and treatment of tardive dyskinesia, pharmaceutical formulations comprising it and its use for the manufacture of medicaments |
| IL144900A (en) * | 2001-08-14 | 2013-12-31 | Neurim Pharma 1991 | Melatonin and drugs containing it for use in the treatment of primary insomnia, and the manufacture of those drugs |
| US6998112B2 (en) * | 2003-03-18 | 2006-02-14 | Arthur Zuckerman | Sleep inducing toothpaste made with natural herbs and a natural hormone |
| RU2361583C2 (ru) * | 2003-10-03 | 2009-07-20 | Вейлен Н.В. | Применение соединений, способных повышать уровень igf-1 в сыворотке крови, при приготовлении терапевтической композиции для лечения стадий различных заболеваний, ассоциированных со снижением уровня igf-1 в сыворотке людей и животных |
| MXPA06009377A (es) * | 2004-02-20 | 2007-03-07 | Lifescape Biosciences Inc | Composiciones y metodos para regulacion del sueno. |
| US9532952B2 (en) | 2011-01-28 | 2017-01-03 | Physician's Seal, LLC | Controlled-release compositions of melatonin combined with sedative and/or analgesic ingredients |
| WO2012103411A2 (en) | 2011-01-28 | 2012-08-02 | Zx Pharma, Llc | Controlled-release melatonin composition and related methods |
| RU2590979C2 (ru) | 2011-02-11 | 2016-07-10 | ЗедЭкс ФАРМА, ЭлЭлСи | Составы l-ментола, состоящие из множества частиц, и связанные с ними способы |
| US8911780B2 (en) | 2011-02-11 | 2014-12-16 | Zx Pharma, Llc | Multiparticulate L-menthol formulations and related methods |
| US8808736B2 (en) | 2011-02-11 | 2014-08-19 | Zx Pharma, Llc | Enteric coated multiparticulate controlled release peppermint oil composition and related methods |
| RU2488388C1 (ru) | 2012-05-24 | 2013-07-27 | Ооо "Валента Интеллект" | Фармацевтическая композиция для профилактики и лечения психических, поведенческих, когнитивных расстройств |
| UA107653U (uk) | 2012-10-01 | 2016-06-24 | Общєство С Огранічєнной Отвєтствєнностью "Валєнта-Інтєллєкт" | Композиція лікарських засобів для лікування та профілактики поведінкових, психічних та когнітивних розладів |
| HRP20190210T1 (hr) | 2013-04-23 | 2019-04-05 | Zx Pharma, Llc | Enterički premazani multipartikulatni pripravak s proteinskim podslojem |
| RS61024B1 (sr) | 2016-10-31 | 2020-12-31 | Neurim Pharma 1991 | Mini-tablete melatonina i postupak za njihovu proizvodnju |
| US10849856B2 (en) | 2016-10-31 | 2020-12-01 | Neurim Pharmaceuticals Ltd. | Melatonin mini-tablets and method of manufacturing the same |
| EP4601614A1 (en) | 2022-10-14 | 2025-08-20 | Société des Produits Nestlé S.A. | Sustained release melatonin compositions |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4600723A (en) | 1983-05-18 | 1986-07-15 | Monash University | Method for minimizing disturbances in circadian rhythms of bodily performance and function |
| AU601736B2 (en) | 1986-05-23 | 1990-09-20 | Sanofi Sante Nutrition Animale Sa | Coated veterinary implants |
| US4800087A (en) | 1986-11-24 | 1989-01-24 | Mehta Atul M | Taste-masked pharmaceutical compositions |
| US5242941A (en) | 1990-12-04 | 1993-09-07 | State Of Oregon | Methods of treating circadian rhythm disorders |
| ES2134789T3 (es) * | 1991-05-09 | 1999-10-16 | Neurim Pharma 1991 | Composiciones que contienen melatonina. |
| IT1251544B (it) * | 1991-05-13 | 1995-05-17 | Gabriele Biella | Composizioni farmaceutiche attive nella terapia dei disturbi del sonno comprendenti melatonina o un suo derivato in associazione con un derivato benzodiazepinico |
| US5449683A (en) | 1992-10-01 | 1995-09-12 | Massachussetts Institute Of Technology | Methods of inducing sleep using melatonin |
| US6469044B1 (en) * | 1995-02-01 | 2002-10-22 | Neurim Pharmaceuticals (1991) Ltd. | Method for treating patients suffering from drug dependencies which lead to plasma melationin deficiencies |
-
1995
- 1995-02-01 US US08/381,535 patent/US6469044B1/en not_active Expired - Lifetime
- 1995-06-06 EP EP95303853A patent/EP0724878B1/en not_active Expired - Lifetime
- 1995-06-06 ES ES95303853T patent/ES2139842T3/es not_active Expired - Lifetime
- 1995-06-06 DE DE69512760T patent/DE69512760T2/de not_active Expired - Lifetime
- 1995-06-23 IL IL11429695A patent/IL114296A/xx not_active IP Right Cessation
-
1996
- 1996-01-24 ZA ZA96548A patent/ZA96548B/xx unknown
- 1996-01-29 RO RO97-01338A patent/RO116771B1/ro unknown
- 1996-01-29 KR KR1019970705034A patent/KR100425045B1/ko not_active Expired - Lifetime
- 1996-01-29 RU RU97113435/14A patent/RU2182001C2/ru active
- 1996-01-29 UA UA97073940A patent/UA63878C2/uk unknown
- 1996-01-30 AR ARP960101224A patent/AR003921A1/es not_active Application Discontinuation
-
1997
- 1997-08-01 LT LT97-135A patent/LT4339B/lt not_active IP Right Cessation
-
2002
- 2002-04-08 US US10/117,054 patent/US20020156121A1/en not_active Abandoned
- 2002-05-14 US US10/144,037 patent/US6833383B2/en not_active Expired - Fee Related
Also Published As
| Publication number | Publication date |
|---|---|
| LT4339B (lt) | 1998-05-25 |
| UA63878C2 (en) | 2004-02-16 |
| KR19980701640A (ko) | 1998-06-25 |
| LT97135A (en) | 1997-12-29 |
| EP0724878B1 (en) | 1999-10-13 |
| HK1001218A1 (en) | 1998-06-05 |
| ES2139842T3 (es) | 2000-02-16 |
| EP0724878A2 (en) | 1996-08-07 |
| US6469044B1 (en) | 2002-10-22 |
| IL114296A0 (en) | 1995-10-31 |
| US6833383B2 (en) | 2004-12-21 |
| KR100425045B1 (ko) | 2004-09-01 |
| DE69512760D1 (de) | 1999-11-18 |
| IL114296A (en) | 1999-10-28 |
| EP0724878A3 (cg-RX-API-DMAC10.html) | 1996-08-21 |
| ZA96548B (en) | 1996-08-14 |
| RO116771B1 (ro) | 2001-06-29 |
| US20030040539A1 (en) | 2003-02-27 |
| RU2182001C2 (ru) | 2002-05-10 |
| US20020156121A1 (en) | 2002-10-24 |
| AR003921A1 (es) | 1998-09-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69512760T2 (de) | Verwendung von Melatonin zur Behandlung von Patienten die an Drogenabhängigkeit leiden | |
| Schulz et al. | The effect of valerian extract on sleep polygraphy in poor sleepers: a pilot study | |
| DE69929041T2 (de) | Verwendung von cabergolin zur behandlung von "restless legs syndrom" | |
| DE69229490T2 (de) | Melatonin enthaltende Arzneimittel | |
| DE69230046T2 (de) | 2-Bromomelatonin zur Behandlung von Schlafstörungen | |
| DE69931042T2 (de) | Stoffe mit serotoninartiger wirkung zur behandlung der schlafapnoe | |
| DE3855113T2 (de) | Verwendung von Buspiron zur Herstellung eines pharmazeutischen Präparats zur Behandlung der Alkoholsucht | |
| DE69514794T2 (de) | Sublinguale dosierungsformen enthaltend apomorphin zur verwendung bei der behandlung von erektiler dysfunktion | |
| DE69232016T2 (de) | Pharmazeutische zusammensetzung, die gamma-hydroxybuttersäure oder das entsprechende lakton enthält, zur behandlung von drogenabhängigkeit und ernährungsstörungen | |
| Dunbar et al. | A comparison of paroxetine and placebo in depressed outpatients | |
| DE69926804T2 (de) | Vorrichtungen zur behandlung und diagnose des restless leg syndroms | |
| DE19938825A1 (de) | Wirkstoffkombination mit Clonidin | |
| Georgitis et al. | Ipratropium bromide nasal spray in non‐allergic rhinitis: efficacy, nasal cytological response and patient evaluation on quality of life | |
| AT408188B (de) | Verwendung von melatonin zur behandlung von an medikamentensucht leidenden patienten | |
| DE69634662T2 (de) | Schmerzlindernde verwendung von n-l-alpha-aspartyl-l-phenylalanine-1-methylester | |
| DE2359128A1 (de) | Arzneimittel auf basis von lisurid und dessen physiologisch vertraeglichen salzen | |
| JPH10513177A5 (cg-RX-API-DMAC10.html) | ||
| DD242749A5 (de) | Verbesserte entzuendungshemmende zusammensetzungen und verfahren | |
| WO2003053445A1 (de) | Verwendung von desoxypeganin zur behandlung der klinischen depression | |
| DE60022033T2 (de) | Therapeutische verwendung von d-threo-methylphenidate zur behandlung von aufmerksamkeitsmangel-hyperaktivitätsstörungen | |
| DD297557A5 (de) | Verwendung von dopamin-autorezeptor-agonisten bei der behandlung von drogenabhaengigkeit | |
| DE69214979T2 (de) | Neue, dietätische Zubereitungen auf Basis von Phosphor-Lipidkomplexen sowie deren Verwendung bei Schlafstörungen | |
| EP1667769A2 (de) | Verwendung von galanthamin und seinen derivaten zum herstellen von arzneimitteln | |
| Hornyak et al. | Influence of low‐dose doxepin on periodic leg movements in sleep in primary insomnia patients | |
| EP1617831A1 (de) | Kombination aus desoxypeganin und mecamylamin zur behandlung des alkoholmissbrauches |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8364 | No opposition during term of opposition |