CN108157678A - A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive - Google Patents
A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive Download PDFInfo
- Publication number
- CN108157678A CN108157678A CN201711481995.8A CN201711481995A CN108157678A CN 108157678 A CN108157678 A CN 108157678A CN 201711481995 A CN201711481995 A CN 201711481995A CN 108157678 A CN108157678 A CN 108157678A
- Authority
- CN
- China
- Prior art keywords
- parts
- grass carp
- auricularia polysaccharide
- preparation
- feed additive
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K50/00—Feeding-stuffs specially adapted for particular animals
- A23K50/80—Feeding-stuffs specially adapted for particular animals for aquatic animals, e.g. fish, crustaceans or molluscs
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/163—Sugars; Polysaccharides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/80—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in fisheries management
- Y02A40/81—Aquaculture, e.g. of fish
- Y02A40/818—Alternative feeds for fish, e.g. in aquacultures
Abstract
The invention discloses a kind of preparation methods containing Auricularia polysaccharide preparing grass carp feed additive, by formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic, it is just crushed after low temperature is continuous drying, it is uniformly mixed, then ultramicro grinding, Auricularia polysaccharide, vitamin E and mineral powder are added, is uniformly mixed to contain Auricularia polysaccharide preparing grass carp feed additive.Advantageous effect：The preparation method working efficiency of feed addictive of the present invention, reduce energy consumption, save energy consumption and cost, the bioavailability of drug can be improved, reduce the dosage of drug, and the uniformity of particle is improved to a certain extent, feed addictive is made to be easier to be dispersed in feed, obtained additive can enhance the ability of grass carp anti allergic reaction and immunity, improvement grass carp meat.
Description
Technical field
The present invention relates to polysaccharide technical field, more particularly, to a kind of preparation containing Auricularia polysaccharide preparing grass carp feed additive
Method.
Background technology
At present, China mainly uses antibiotic, but the long-term and a large amount of abuse of antibiotic in terms of animal feed additive,
Cause antibiotic residues in animal-derived food excessive, food-safe and human health causes very big potential hazard.And China exists
Mainly two kinds of major measures of medical treatment and vaccine immunization, but the use of protective agents are taken in terms of the prevention and control of animal epidemic
Usually cause the immunosupress of animal body, cause immune effect of vaccine bad or even the failure of prevention and control measure.As China is raiseeed
Herd the fast development of aquaculture and the pay attention to day by day that people are food-safe, exploitation is pollution-free, noresidue, it is without side-effects, can increase
Strong immunity of organisms, the novel green feed addictive for improving premunition and immunopotentiator are imperative.Agaric
（Auriculariaauriculajudae）The also known as ears or side handles of a utensil, brightness program belong to the edible and medical fungi of Eumycota Basidiomycetes, it is growth
A kind of saprophytic bacteria on rotten wood, is made of mycelium and fructification two parts.It is agaric delicious flavour, full of nutrition, not only
It is the very high edible mushroom of nutritive value, while is also the higher medicinal fungus of medical value, is universally acknowledged health products.From medicinal
Value sees that agaric, which has, to slow down aging, auxiliary reducing blood lipid, anticoagulation, anticancer, increases the work(such as immune, auxiliary hyperglycemic, anti-oxidant
Can, numerous studies show that the physiological function of edible mushroom and its polysaccharide component are closely related, therefore in recent years for the research of polysaccharide
Also it emerges in an endless stream.Natural polysaecharides substance is as a kind of important large biological molecule, in recent years, people are to its biological function
There are many new understanding and discovery, it has also become the research hotspot of life science, polysaccharide are led in feed addictive, food and medicine
The application in domain also shows tempting prospect.
The prior art such as Authorization Notice No. is the Chinese invention patent of CN101991026B, discloses a kind of raising black carp and resists
Stress composite immune reinforcing agent and preparation method thereof, a kind of immunopotentiator for improving black carp resisting stress, with mass percent
Meter is more including Codonopsis pilosula polysaccharide 10~20%, Radix Isatidis 10~15%, astragalus polyose 15~20%, mangiferin 5~10%, Rosa roxburghii Tratt
Sugar 5~10%, vitamin C 0.5~5%, vitamin E 1~6%, wheat-middlings 20~40%.The immunopotentiator can be used as feed
Additive makes up the deficiency that black carp is showed in stress situation, improves the ability of black carp resisting stress, improves efficiency of feed utilization, drop
Low feed coefficient, reduction caused stress injure, and enhancing black carp immunity of organisms improves survival rate.But the Immune-enhancing effect
Agent cannot be taken into account the effect of improving fish meat.
Invention content
The purpose of the present invention is to provide a kind of preparation method working efficiencies, save energy consumption and cost, what is obtained adds
Add agent that can enhance the ability of grass carp anti allergic reaction and immunity, improve grass carp meat and add containing Auricularia polysaccharide feed of grass carp
Add the preparation method of agent.
The problem of present invention in above-mentioned technology for mentioning, the technical solution taken is：
A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive, specific preparation process are：
By formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic low temperature it is continuous drying after be just crushed to 40-80 mesh, be uniformly mixed,
Then ultramicro grinding adds Auricularia polysaccharide, vitamin E and mineral powder, is uniformly mixed to contain wood to 500-700 mesh
Fungus polysaccharides preparing grass carp feed additive, the continuous drying technique of low temperature can reduce the volatility of active ingredient in Chinese herbal medicine, reduce not
Necessary loss can provide the raw material of certain fineness for ultramicro grinding by just crushing, ultramicro grinding is made to be more prone to carry out,
The working efficiency of ultramicro grinding is improved, reduces energy consumption, Chinese herbal medicine cell can be destroyed by saving energy consumption and cost, ultramicro grinding
Wall makes intracellular effective drug ingedient fully be exposed, and improves the bioavailability of drug, reduces the dosage of drug,
And the uniformity of particle is improved to a certain extent, feed addictive is made to be easier to be dispersed in feed.
Preferably, the ingredient and its parts by weight of preparing grass carp feed additive are：1-2 parts of Auricularia polysaccharide, 15-22 parts of polygonum flaccidum,
5-10 parts of Chinese gall, naphthalene 3-8 parts of mountain, Radix Ophiopogonis 3-5 part, 1-2 parts of vitamin E, 2-3 parts of garlic, 0.01-0.02 parts of mineral powder.
For above-mentioned additive respectively into renewable resource is belonged to, compatibility is reasonable, can enhance the ability of grass carp anti allergic reaction, reduction stress
The influence of factor pair grass carp, improves the health of grass carp, while has the function of antibacterial, antiviral, can significantly improve grass carp and exist
Grazing rate and survival rate in breeding process can enhance immunity of organisms, promote enterogastric peristalsis, protection beneficial bacterium is in enteron aisle
Field planting, plays an important role the improvement and reconstruction of grass carp intestinal flora, improves the Meat Tenderness and protein content of grass carp,
The trace element of grass carp can be improved simultaneously, improve grass carp meat.
Preferably, Auricularia polysaccharide extracting method is：It is 1 by solid-liquid ratio:25-35g/mL adds water into auricularia auriculajudae powder, then
The active peptides of auricularia auriculajudae powder weight 0.01-0.014% are added in, hot water extracts 1-2h under conditions of being 95-105 DEG C in Extracting temperature,
After extraction, 8-12min is centrifuged under 4000-6000rpm, supernatant concentration, spray drying, as Auricularia polysaccharide, this is carried
The principle for taking method is to cause cell that plasmolysis occurs by means of thermodynamic activity, and the polysaccharide material in vacuole is obtained through cell
Wall is simultaneously diffused into external solvent, extracting method simple possible, for equipment requirement is low, production cost is low, easy popularization, is obtained
To Auricularia polysaccharide on the one hand can enhance the ability of grass carp anti allergic reaction, reduce influence of the stress factor to grass carp, improve
On the other hand the health of grass carp can improve the immunity of grass carp, increase adaptability of the grass carp to poor environment, improve grass
The survival rate of fish intensive culture.
Further, the amino acid sequence of active peptides is：
TDHVCVNCFCAKCYNGKDATATMDTGGPLSHFYKLNSYGVAGFYTCIS, the addition of the active peptides can cooperate with hot water
So that plasmolysis occurs for agaric cell, so as to which the substance in vacuole be made to pass through cell wall, it is diffused into external solvent, and can drop
The resistance that low polysaccharide is spread into hot water makes the polysaccharide of dissolution be dissolved in hot water rapidly, improves the extraction rate of wood polysaccharose, significantly
Extraction time is saved, while thoroughly can separate Auricularia polysaccharide, does not need to repeat to extract, saves energy consumption.
Preferably, containing the left-handed tocopherols of 0.3-0.4% in vitamin E, which has protection body tissue knot
Structure is complete, maintains the functions such as the normal reproductive capability of body, enhancing grass carp immunity, vitamin E be in itself not only antioxidant and
And body can be induced to improve superoxide dismutase（SOD）Effect, and SOD is the main scavenger of oxygen radical, it can promote
Make the decomposition of oxygen radical, improve the anti-stress ability and immunity of grass carp, while containing for left-handed tocopherol can improve grass carp
The activity of pepsin and long protease, and then promote the protein synthesis of grass carp, the speed of growth of grass carp is speeded, improves grass carp
Meat and nutritive value.
Preferably, the ingredient and its parts by weight of mineral powder are：20-30 parts of zeolite, 25-40 parts of bentonite, medical stone
15-25 parts, 5-15 parts of tourmaline, 5-15 parts of dolomite, the mineral powder have it is unique rush enzyme effect and improve feed nutrition
The characteristics of conversion ratio, can promote to cultivate the metabolism of object body, also have prevent epidemic disease-resistant, raising yield, improving quality
Etc. functions, for the ease of dispersion of the mineral in feed and the absorption in animal intestinal tract, the fineness of mineral powder is 500-600
Mesh.
Compared with prior art, the advantage of the invention is that：1）The preparation method working efficiency of feed addictive of the present invention,
Energy consumption is reduced, saves energy consumption and cost, the bioavailability of drug can be improved, reduce the dosage of drug, and one
Determine to improve the uniformity of particle in degree, feed addictive is made to be easier to be dispersed in feed；2）The preparation method obtains
To additive can enhance the ability of grass carp anti allergic reaction, there is antibacterial, antiviral, grass carp can be significantly improved
Grazing rate and survival rate in the breeding process, can enhance immunity of organisms, and the improvement and reconstruction of grass carp intestinal flora are played
Important role, improves the Meat Tenderness and protein content of grass carp, while can improve the trace element of grass carp, improves grass carp
Meat；3）The Auricularia polysaccharide extracting method simple possible, for equipment requirement is low, production cost is low, extraction rate is fast, does not need to
It repeats to extract, saves energy consumption, easily promotes, obtained Auricularia polysaccharide can enhance the ability of grass carp anti allergic reaction and be immunized
Power improves the survival rate of grass carp intensive culture.
Specific embodiment
The present invention program is described further below by embodiment：
Embodiment 1：
A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive, specific preparation process are：
By formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic low temperature it is continuous drying after be just crushed to 80 mesh, be uniformly mixed, so
Ultramicro grinding adds Auricularia polysaccharide, vitamin E and mineral powder, is uniformly mixed to contain Auricularia polysaccharide to 600 mesh afterwards
Preparing grass carp feed additive, the continuous drying technique of low temperature can reduce the volatility of active ingredient in Chinese herbal medicine, reduce unnecessary
Loss, can provide the raw material of certain fineness for ultramicro grinding by just crushing, ultramicro grinding is made to be more prone to carry out, and improve super
Fine working efficiency reduces energy consumption, and Chinese herbal medicine cell wall can be destroyed, make by saving energy consumption and cost, ultramicro grinding
Intracellular effective drug ingedient is fully exposed, and improves the bioavailability of drug, reduces the dosage of drug, and
The uniformity of particle is improved to a certain extent, and feed addictive is made to be easier to be dispersed in feed.
The ingredient and its parts by weight of above-mentioned preparing grass carp feed additive be：1 part of Auricularia polysaccharide, 22 parts of polygonum flaccidum, 5 parts of Chinese gall,
8 parts of mountain naphthalene, 3 parts of Radix Ophiopogonis, 2 parts of vitamin E, 2 parts of garlic, 0.02 part of mineral powder.Above-mentioned additive is respectively renewable into belonging to
Resource, compatibility is reasonable, can enhance the ability of grass carp anti allergic reaction, reduces influence of the stress factor to grass carp, improves grass carp
Health, while there is antibacterial, antiviral, grass carp grazing rate in the breeding process and survival can be significantly improved
Rate can enhance immunity of organisms, promote enterogastric peristalsis, and field planting of the protection beneficial bacterium in enteron aisle changes grass carp intestinal flora
Kind and reconstruction plays an important role, and improves the Meat Tenderness and protein content of grass carp, while can improve the micro of grass carp
Element improves grass carp meat.
Above-mentioned Auricularia polysaccharide extracting method is：It is 1 by solid-liquid ratio:25g/mL adds water into auricularia auriculajudae powder, then adds in agaric
The active peptides of powder weight 0.014%, hot water extracts 2h under conditions of being 95 DEG C in Extracting temperature, after extraction,
12min, supernatant concentration, as spray drying, Auricularia polysaccharide, the amino acid sequence of above-mentioned active peptides are centrifuged under 4000rpm
For：TDHVCVNCFCAKCYNGKDATATMDTGGPLSHFYKLNSYGVAGFYTCIS, the addition of the active peptides can cooperate with
Hot water causes agaric cell that plasmolysis occurs, and so as to which the substance in vacuole be made to pass through cell wall, is diffused into external solvent, and
The resistance that polysaccharide is spread into hot water can be reduced, the polysaccharide of dissolution is made to be dissolved in hot water rapidly, improves the extraction rate of wood polysaccharose,
Extraction time is greatlyd save, while thoroughly can separate Auricularia polysaccharide, does not need to repeat to extract, saves energy consumption, this is carried
The principle for taking method is to cause cell that plasmolysis occurs by means of thermodynamic activity, and the polysaccharide material in vacuole is obtained through cell
Wall is simultaneously diffused into external solvent, extracting method simple possible, for equipment requirement is low, production cost is low, easy popularization, is obtained
To Auricularia polysaccharide on the one hand can enhance the ability of grass carp anti allergic reaction, reduce influence of the stress factor to grass carp, improve
On the other hand the health of grass carp can improve the immunity of grass carp, increase adaptability of the grass carp to poor environment, improve grass
The survival rate of fish intensive culture.
Containing 0.3% left-handed tocopherol in said vitamin E, which has protection body tissue structural integrity, dimension
Holding functions, the vitamin Es such as the normal reproductive capability of body, enhancing grass carp immunity is not only antioxidant in itself but also can induce
Body improves superoxide dismutase（SOD）Effect, and SOD is the main scavenger of oxygen radical, it can promote oxygen radical
Decomposition, improve the anti-stress ability and immunity of grass carp, at the same left-handed tocopherol containing can improve grass carp pepsin and
The activity of long protease, and then promote the protein synthesis of grass carp, the speed of growth of grass carp is speeded, improves grass carp meat and nutrition
Value.
The ingredient and its parts by weight of above-mentioned mineral powder be：30 parts of zeolite, 25 parts of bentonite, 25 parts of medical stone, tourmaline 5
Part, 15 parts of dolomite, which has the characteristics that unique rush enzyme effect and improves feed nutrition conversion ratio, can promote
The metabolism of object body is cultivated, also has the function of that epidemic prevention is disease-resistant, improves yield, improving quality etc., exists for the ease of mineral
Dispersion in feed and the absorption in animal intestinal tract, the fineness of mineral powder is 500 mesh.
Embodiment 2：
A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive, specific preparation process are：
By formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic low temperature it is continuous drying after be just crushed to 40 mesh, be uniformly mixed, so
Ultramicro grinding adds Auricularia polysaccharide, vitamin E and mineral powder, is uniformly mixed to contain Auricularia polysaccharide to 500 mesh afterwards
Preparing grass carp feed additive.
The ingredient and its parts by weight of preparing grass carp feed additive be：2 parts of Auricularia polysaccharide, 15 parts of polygonum flaccidum, 10 parts of Chinese gall, mountain naphthalene
3 parts, 5 parts of Radix Ophiopogonis, 1 part of vitamin E, 3 parts of garlic, 0.01 part of mineral powder.Contain 0.4% left-handed fertility in said vitamin E
Phenol, the ingredient and its parts by weight of above-mentioned mineral powder are：20 parts of zeolite, 40 parts of bentonite, 15 parts of medical stone, 15 parts of tourmaline,
5 parts of dolomite, the fineness of mineral powder is 600 mesh.
Above-mentioned Auricularia polysaccharide extracting method is：It is 1 by solid-liquid ratio:25g/mL adds water into auricularia auriculajudae powder, then adds in agaric
The active peptides of powder weight 0.014%, hot water extracts 2h under conditions of being 95 DEG C in Extracting temperature, after extraction,
12min, supernatant concentration, as spray drying, Auricularia polysaccharide, the amino acid sequence of above-mentioned active peptides are centrifuged under 4000rpm
For：TDHVCVNCFCAKCYNGKDATATMDTGGPLSHFYKLNSYGVAGFYTCIS.
Embodiment 3：
A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive, specific preparation process are：
By formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic low temperature it is continuous drying after be just crushed to 60 mesh, be uniformly mixed, so
Ultramicro grinding adds Auricularia polysaccharide, vitamin E and mineral powder, is uniformly mixed to contain Auricularia polysaccharide to 600 mesh afterwards
Preparing grass carp feed additive.
The ingredient and its parts by weight of preparing grass carp feed additive be：1.5 parts of Auricularia polysaccharide, 20 parts of polygonum flaccidum, 8 parts of Chinese gall, mountain
5 parts of naphthalene, 4 parts of Radix Ophiopogonis, 1.5 parts of vitamin E, 2.5 parts of garlic, 0.00015 part of mineral powder.Contain in said vitamin E
0.35% left-handed tocopherol, the ingredient and its parts by weight of above-mentioned mineral powder are：25 parts of zeolite, 33 parts of bentonite, medical stone 20
Part, 10 parts of tourmaline, 10 parts of dolomite, the fineness of mineral powder is 550 mesh.
Above-mentioned Auricularia polysaccharide extracting method is：It is 1 by solid-liquid ratio:30g/mL adds water into auricularia auriculajudae powder, then adds in agaric
The active peptides of powder weight 0.012%, hot water extracts 1.5h under conditions of being 100 DEG C in Extracting temperature, after extraction,
10min, supernatant concentration, as spray drying, Auricularia polysaccharide, the amino acid sequence of above-mentioned active peptides are centrifuged under 5000rpm
For：TDHVCVNCFCAKCYNGKDATATMDTGGPLSHFYKLNSYGVAGFYTCIS.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme of the present invention is described in detail in embodiment described above, it should be understood that the above is only
For specific embodiments of the present invention, it is not intended to restrict the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should all be included in the protection scope of the present invention.
Sequence table
<110>Send Pood bio tech ltd in Panan County
<120>A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 48
<212> PRT
<213>Trachyostracous mussel (Mytilus coruscus)
<400> 1
Thr Asp His Val Cys Val Asn Cys Phe Cys Ala Lys Cys Tyr Asn Gly
1 5 10 15
Lys Asp Ala Thr Ala Thr Met Asp Thr Gly Gly Pro Leu Ser His Phe
20 25 30
Tyr Lys Leu Asn Ser Tyr Gly Val Ala Gly Phe Tyr Thr Cys Ile Ser
35 40 45
Claims (8)
1. a kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive, it is characterised in that：The preparation method it is specific
Preparation process is：By formula ratio polygonum flaccidum, Chinese gall, mountain naphthalene, Radix Ophiopogonis, garlic low temperature it is continuous drying after be just crushed to 40-80 mesh, mix
Close uniform, then ultramicro grinding to 500-700 mesh, adds Auricularia polysaccharide, vitamin E and mineral powder, be uniformly mixed to get
Contain Auricularia polysaccharide preparing grass carp feed additive.
2. a kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive according to claim 1, feature exist
In：The ingredient and its parts by weight of the preparing grass carp feed additive be：1-2 parts of Auricularia polysaccharide, 15-22 parts of polygonum flaccidum, Chinese gall 5-10
Part, naphthalene 3-8 parts of mountain, Radix Ophiopogonis 3-5 part, 1-2 parts of vitamin E, 2-3 parts of garlic, 0.01-0.02 parts of mineral powder.
3. a kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive according to claim 1, it is characterised in that：
The Auricularia polysaccharide extracting method is：Into auricularia auriculajudae powder plus water, then add in active peptides, hot water extraction, after extraction from
The heart, supernatant concentration, as spray drying, Auricularia polysaccharide.
4. the extracting method of Auricularia polysaccharide according to claim 3, it is characterised in that：The solid-liquid ratio of the auricularia auriculajudae powder and water
It is 1:25-35g/mL, hot water Extracting temperature is 95-105 DEG C, extraction time 1-2h.
5. the extracting method of Auricularia polysaccharide according to claim 3, it is characterised in that：The additive amount of the active peptides is
Auricularia auriculajudae powder weight 0.01-0.014%.
6. the extracting method of Auricularia polysaccharide according to claim 3, it is characterised in that：The amino acid sequence of the active peptides
It is classified as：TDHVCVNCFCAKCYNGKDATATMDTGGPLSHFYKLNSYGVAGFYTCIS.
7. a kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive according to claim 1, it is characterised in that：
Contain the left-handed tocopherols of 0.3-0.4% in the vitamin E.
8. a kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive according to claim 1, it is characterised in that：
The ingredient and its parts by weight of the mineral powder be：20-30 parts of zeolite, 25-40 parts of bentonite, 15-25 parts of medical stone, tourmaline
5-15 parts, 5-15 parts of dolomite, the fineness of the mineral powder is 500-600 mesh.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711481995.8A CN108157678A (en) | 2017-12-29 | 2017-12-29 | A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711481995.8A CN108157678A (en) | 2017-12-29 | 2017-12-29 | A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN108157678A true CN108157678A (en) | 2018-06-15 |
Family
ID=62516721
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711481995.8A Withdrawn CN108157678A (en) | 2017-12-29 | 2017-12-29 | A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN108157678A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110754588A (en) * | 2019-12-13 | 2020-02-07 | 海南晨海水产有限公司 | Seaweed functional feed suitable for grouper fries and preparation method thereof |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101695516A (en) * | 2009-09-17 | 2010-04-21 | 天津生机集团股份有限公司 | Immunostimulant for aquatic animals and preparation method thereof |
| CN103340309A (en) * | 2013-06-28 | 2013-10-09 | 句容市郭庄镇南河农庄 | Pseudobagrus fulvidraco feed additive capable of improving immune function and application thereof |
| CN107307233A (en) * | 2017-07-20 | 2017-11-03 | 通化师范学院 | It is a kind of to promote Chinese herbal feed additive of fresh water salmon growth and application thereof |
| CN107348138A (en) * | 2017-07-20 | 2017-11-17 | 通化师范学院 | A kind of Chinese herbal feed additive for improving fresh-water fishes function of intestinal canal and application thereof |
| CN107361243A (en) * | 2017-07-20 | 2017-11-21 | 通化师范学院 | A kind of feed addictive for promoting cold water fish growth and application thereof |
-
2017
- 2017-12-29 CN CN201711481995.8A patent/CN108157678A/en not_active Withdrawn
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101695516A (en) * | 2009-09-17 | 2010-04-21 | 天津生机集团股份有限公司 | Immunostimulant for aquatic animals and preparation method thereof |
| CN103340309A (en) * | 2013-06-28 | 2013-10-09 | 句容市郭庄镇南河农庄 | Pseudobagrus fulvidraco feed additive capable of improving immune function and application thereof |
| CN107307233A (en) * | 2017-07-20 | 2017-11-03 | 通化师范学院 | It is a kind of to promote Chinese herbal feed additive of fresh water salmon growth and application thereof |
| CN107348138A (en) * | 2017-07-20 | 2017-11-17 | 通化师范学院 | A kind of Chinese herbal feed additive for improving fresh-water fishes function of intestinal canal and application thereof |
| CN107361243A (en) * | 2017-07-20 | 2017-11-21 | 通化师范学院 | A kind of feed addictive for promoting cold water fish growth and application thereof |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110754588A (en) * | 2019-12-13 | 2020-02-07 | 海南晨海水产有限公司 | Seaweed functional feed suitable for grouper fries and preparation method thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR101279959B1 (en) | Manufacturing Method of Fermented Materials using Wax Gourd and Functional food of Thereof Manufacturing | |
| CN104304749A (en) | Chinese herbal medicine feed additive for improving milk yield of dairy cattle and improving dairy quality | |
| CN106578801A (en) | Comprehensive enzyme powder with hypoglycemic effect and preparation method thereof | |
| CN105410346A (en) | Cultured penaeus vannamei survival rate improving traditional Chinese medicine preparation and preparation method thereof | |
| CN105285430A (en) | Meat duck feed | |
| CN104547521A (en) | Compound fermentation traditional Chinese medicine for enhancing immunity of livestock and poultry and preparation method of compound fermentation traditional Chinese medicine | |
| CN104855705B (en) | A kind of broiler chicken biological fermentation feed and preparation method thereof | |
| CN108902451A (en) | The preparation method of the fresh water fish feed additive of strengthen immunity | |
| CN106213005A (en) | A kind of cultivation feedstuff of Gallus Domesticus and preparation method thereof | |
| CN105707488A (en) | Traditional Chinese medicine microecologics for enhancing piglet immunity and preparing method of traditional Chinese medicine microecologics | |
| CN108157678A (en) | A kind of preparation method containing Auricularia polysaccharide preparing grass carp feed additive | |
| CN107361243A (en) | A kind of feed addictive for promoting cold water fish growth and application thereof | |
| CN104435907A (en) | Compound fermented Chinese medicine for livestock fattening and preparation method of compound fermented Chinese medicine | |
| CN106721005A (en) | Tilapia mossambica prevention streptococcosis feed addictive | |
| CN106107070A (en) | A kind of Chinese herbal medicine feed for goat and preparation method thereof | |
| CN106540157A (en) | A kind of cabrilla composite Chinese herbal immunostimulant | |
| CN104012848B (en) | A kind of mantis shrimp health-care fresh-preservation rice cake and preparation method thereof | |
| CN105941879A (en) | Feed for mutton sheep | |
| CN103844026A (en) | Tarragon-flavor concentrated feed for live pigs | |
| CN113975310B (en) | Traditional Chinese medicine micro powder composition and application thereof in chicken ecological breeding mode | |
| CN105053737A (en) | High-efficiency pig feed additive | |
| KR101000819B1 (en) | Salt | |
| CN102273549A (en) | Chinese medicinal herb feed improver for livestock and poultry breeding | |
| CN106889181A (en) | A kind of Chinese herbal medicinal bactericide fresh-keeping suitable for Pachyrhizua angulatus | |
| CN106260497A (en) | A kind of giant salamander nourishing egg albumen powder production technology |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180615 |