CN107824498A - A kind of solar energy electroplax cleaning device - Google Patents
A kind of solar energy electroplax cleaning device Download PDFInfo
- Publication number
- CN107824498A CN107824498A CN201710957584.5A CN201710957584A CN107824498A CN 107824498 A CN107824498 A CN 107824498A CN 201710957584 A CN201710957584 A CN 201710957584A CN 107824498 A CN107824498 A CN 107824498A
- Authority
- CN
- China
- Prior art keywords
- solar energy
- cleaning
- energy electroplax
- flat board
- cleaning device
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 238000004140 cleaning Methods 0.000 title claims abstract description 137
- 230000007246 mechanism Effects 0.000 claims abstract description 19
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 26
- 229920001971 elastomer Polymers 0.000 claims description 20
- 235000002505 Centaurea nigra Nutrition 0.000 claims description 15
- 241001073742 Mylopharodon conocephalus Species 0.000 claims description 13
- 239000000463 material Substances 0.000 claims description 8
- 238000005452 bending Methods 0.000 claims description 4
- 238000007789 sealing Methods 0.000 claims description 4
- 238000000034 method Methods 0.000 abstract description 9
- 238000010276 construction Methods 0.000 abstract description 6
- 230000002000 scavenging effect Effects 0.000 abstract description 2
- 238000010521 absorption reaction Methods 0.000 description 10
- 238000009434 installation Methods 0.000 description 8
- 230000006378 damage Effects 0.000 description 7
- 238000010586 diagram Methods 0.000 description 6
- 239000007921 spray Substances 0.000 description 6
- 230000001360 synchronised effect Effects 0.000 description 6
- 230000009471 action Effects 0.000 description 5
- 238000012423 maintenance Methods 0.000 description 4
- 238000001179 sorption measurement Methods 0.000 description 4
- 239000006057 Non-nutritive feed additive Substances 0.000 description 3
- 230000005540 biological transmission Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 240000003323 Centaurea nigra Species 0.000 description 2
- 239000004971 Cross linker Substances 0.000 description 2
- 244000043261 Hevea brasiliensis Species 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- OCKPCBLVNKHBMX-UHFFFAOYSA-N butylbenzene Chemical compound CCCCC1=CC=CC=C1 OCKPCBLVNKHBMX-UHFFFAOYSA-N 0.000 description 2
- 239000006229 carbon black Substances 0.000 description 2
- 239000004927 clay Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003292 glue Substances 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- 229920003052 natural elastomer Polymers 0.000 description 2
- 229920001194 natural rubber Polymers 0.000 description 2
- 238000010248 power generation Methods 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000005096 rolling process Methods 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 235000002639 sodium chloride Nutrition 0.000 description 2
- 239000007779 soft material Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 1
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 1
- ISCYZXFOCXWUJU-KZVJFYERSA-N Ala-Thr-Met Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(O)=O ISCYZXFOCXWUJU-KZVJFYERSA-N 0.000 description 1
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 1
- RWDVGVPHEWOZMO-GUBZILKMSA-N Arg-Cys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCNC(N)=N)C(O)=O RWDVGVPHEWOZMO-GUBZILKMSA-N 0.000 description 1
- QQEWINYJRFBLNN-DLOVCJGASA-N Asn-Ala-Phe Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 QQEWINYJRFBLNN-DLOVCJGASA-N 0.000 description 1
- AKEBUSZTMQLNIX-UWJYBYFXSA-N Asn-Ala-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N AKEBUSZTMQLNIX-UWJYBYFXSA-N 0.000 description 1
- KVMPVNGOKHTUHZ-GCJQMDKQSA-N Asp-Ala-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KVMPVNGOKHTUHZ-GCJQMDKQSA-N 0.000 description 1
- ILJQISGMGXRZQQ-IHRRRGAJSA-N Asp-Arg-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ILJQISGMGXRZQQ-IHRRRGAJSA-N 0.000 description 1
- IAMNNSSEBXDJMN-CIUDSAMLSA-N Asp-Cys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)N IAMNNSSEBXDJMN-CIUDSAMLSA-N 0.000 description 1
- JJQGZGOEDSSHTE-FOHZUACHSA-N Asp-Thr-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JJQGZGOEDSSHTE-FOHZUACHSA-N 0.000 description 1
- UXUSHQYYQCZWET-WDSKDSINSA-N Cys-Glu-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O UXUSHQYYQCZWET-WDSKDSINSA-N 0.000 description 1
- ZMWOJVAXTOUHAP-ZKWXMUAHSA-N Cys-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N ZMWOJVAXTOUHAP-ZKWXMUAHSA-N 0.000 description 1
- VFGADOJXRLWTBU-JBDRJPRFSA-N Cys-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N VFGADOJXRLWTBU-JBDRJPRFSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- KLKYKPXITJBSNI-CIUDSAMLSA-N Gln-Met-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O KLKYKPXITJBSNI-CIUDSAMLSA-N 0.000 description 1
- KUBFPYIMAGXGBT-ACZMJKKPSA-N Gln-Ser-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KUBFPYIMAGXGBT-ACZMJKKPSA-N 0.000 description 1
- QQLBPVKLJBAXBS-FXQIFTODSA-N Glu-Glu-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O QQLBPVKLJBAXBS-FXQIFTODSA-N 0.000 description 1
- SABZDFAAOJATBR-QWRGUYRKSA-N Gly-Cys-Phe Chemical compound [H]NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SABZDFAAOJATBR-QWRGUYRKSA-N 0.000 description 1
- QITBQGJOXQYMOA-ZETCQYMHSA-N Gly-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QITBQGJOXQYMOA-ZETCQYMHSA-N 0.000 description 1
- SCJJPCQUJYPHRZ-BQBZGAKWSA-N Gly-Pro-Asn Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O SCJJPCQUJYPHRZ-BQBZGAKWSA-N 0.000 description 1
- HFPVRZWORNJRRC-UWVGGRQHSA-N Gly-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN HFPVRZWORNJRRC-UWVGGRQHSA-N 0.000 description 1
- GWCJMBNBFYBQCV-XPUUQOCRSA-N Gly-Val-Ala Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O GWCJMBNBFYBQCV-XPUUQOCRSA-N 0.000 description 1
- LOXMWQOKYBGCHF-JBDRJPRFSA-N Ile-Cys-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O LOXMWQOKYBGCHF-JBDRJPRFSA-N 0.000 description 1
- SVZFKLBRCYCIIY-CYDGBPFRSA-N Ile-Pro-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SVZFKLBRCYCIIY-CYDGBPFRSA-N 0.000 description 1
- LECIJRIRMVOFMH-ULQDDVLXSA-N Lys-Pro-Phe Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 LECIJRIRMVOFMH-ULQDDVLXSA-N 0.000 description 1
- 241000143233 Mytilus coruscus Species 0.000 description 1
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- AEEQKUDWJGOFQI-SRVKXCTJSA-N Phe-Cys-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N AEEQKUDWJGOFQI-SRVKXCTJSA-N 0.000 description 1
- DBNGDEAQXGFGRA-ACRUOGEOSA-N Phe-Tyr-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CCCCN)C(=O)O)N DBNGDEAQXGFGRA-ACRUOGEOSA-N 0.000 description 1
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- NOWXWJLVGTVJKM-PBCZWWQYSA-N Thr-Asp-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O NOWXWJLVGTVJKM-PBCZWWQYSA-N 0.000 description 1
- KWTRGSQOQHZKIA-PMVMPFDFSA-N Trp-Lys-Tyr Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)CCCCN)C(O)=O)C1=CC=C(O)C=C1 KWTRGSQOQHZKIA-PMVMPFDFSA-N 0.000 description 1
- VSYROIRKNBCULO-BWAGICSOSA-N Tyr-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)O VSYROIRKNBCULO-BWAGICSOSA-N 0.000 description 1
- RYHUIHUOYRNNIE-NRPADANISA-N Val-Ser-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RYHUIHUOYRNNIE-NRPADANISA-N 0.000 description 1
- KRAHMIJVUPUOTQ-DCAQKATOSA-N Val-Ser-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KRAHMIJVUPUOTQ-DCAQKATOSA-N 0.000 description 1
- HWNYVQMOLCYHEA-IHRRRGAJSA-N Val-Ser-Tyr Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N HWNYVQMOLCYHEA-IHRRRGAJSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 108010045350 alanyl-tyrosyl-alanine Proteins 0.000 description 1
- 108010041407 alanylaspartic acid Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 108010047495 alanylglycine Proteins 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000003712 anti-aging effect Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 235000019994 cava Nutrition 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229920006235 chlorinated polyethylene elastomer Polymers 0.000 description 1
- 238000013016 damping Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000002803 fossil fuel Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 108010036413 histidylglycine Proteins 0.000 description 1
- 108010092114 histidylphenylalanine Proteins 0.000 description 1
- 238000011900 installation process Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000005693 optoelectronics Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/30—Cleaning by methods involving the use of tools by movement of cleaning members over a surface
- B08B1/32—Cleaning by methods involving the use of tools by movement of cleaning members over a surface using rotary cleaning members
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/10—Cleaning by methods involving the use of tools characterised by the type of cleaning tool
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/02—Cleaning by the force of jets or sprays
Landscapes
- Cleaning In General (AREA)
- Photovoltaic Devices (AREA)
- Cleaning By Liquid Or Steam (AREA)
Abstract
The present invention provides a kind of solar energy electroplax cleaning device, belong to solar energy cleaning technique field, device includes upper flat plate and the lower flat board being connected by support frame with upper flat plate, upper flat plate surrounding is connected with driven pulley, support frame is two arranged in a crossed manner, lower flat board surrounding is connected with driving wheel, and lower flat board bottom surface is provided centrally with motor, and lower flat board bottom surface surrounding is connected with wiper mechanism.Support frame arranged in a crossed manner can be rotated by motor driven, therefore can realize the cleaning of continuity solar energy electroplax；Wiper mechanism can up and down, move left and right, comprehensively cleaned, its operation is controlled by control cabinet, and cleaning is accurate quick, saves significantly on scavenging period, reduces the cleaning loss of solar energy.This cleaning device is simple in construction, can be achieved to clean the continuity of solar energy electroplax, cleaning cost is low.
Description
Technical field
The invention belongs to solar energy cleaning technique field, and in particular to a kind of solar energy electroplax cleaning device.
Background technology
Biology is formed from the earth just mainly to survive with the light and heat of sun offer, and is also understood from ancient human and dried with sunlight
Object, and as the method for preserving food, such as salt manufacturing and solarization cured fish.But under fossil fuel reduction, just intentionally solar energy
Further development.The utilization of solar energy has Passive use（Photothermal deformation）With opto-electronic conversion two ways.Solar power generation one
The emerging regenerative resource of kind.Sensu lato solar energy is the source of many energy on the earth, such as wind energy, chemical energy, the gesture of water
Can etc..Solar cell refers to the electromagnetism species to be generated electricity using the energy of sunshine.Filled relative to common batteries with recyclable
For battery, solar cell belongs to more energy efficient environmentally friendly green product.
And exposed solar cell module out of doors, be easy to accumulation dust, so not only influence daylighting effect so as to
Transformation efficiency is reduced, so must be cleaned in time to solar energy electroplax.Traditional photovoltaic plant solar panel it is clear
It is clean mainly to be cleaned by artificial.The cleaning process of the method is relatively cumbersome, and efficiency is low.
And it is also basic using the cleaning for manually carrying out installing early stage in solar energy electroplax installation process, this cleaning way is not
Hand labor intensity is only increased, also easily because manual operation causes the damage of solar energy electroplax when also reducing operating efficiency, and cleaning
It is bad, therefore how the simple and effective solar panel that carries out installs the cleaning of early stage, and easily carry out later maintenance
Cleaning, becomes particularly important to solar energy career development.
The content of the invention
An object of the present invention is to clean before providing a kind of suitable solar energy electroplax installation, and cleaning quality is high, can
It is high by property, greatly reduce hand labor intensity, efficiency high and the solar energy electroplax cleaning device that continuous wash can be realized.
The second object of the present invention is in the solar energy electroplax in a kind of suitable cleaning use is provided, the letter of its apparatus structure
It is single, can roll on themselves cleaning, cleaning efficiency is high, and reliability is high, the solar energy electroplax cleaning device small to solar-electricity dash-board injury.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of solar energy electroplax cleaning device, including it is upper
Flat board and the lower flat board being connected by support frame with upper flat plate, upper flat plate surrounding are connected with driven pulley, and support frame is two intersections
Set, lower flat board surrounding is connected with driving wheel, and lower flat board bottom surface is provided centrally with motor, and lower flat board bottom surface surrounding is connected with
Wiper mechanism.Support frame arranged in a crossed manner can be rotated by motor driven, therefore can realize the cleaning of continuity solar energy electroplax；Cleaning
Mechanism can up and down, move left and right, comprehensively cleaned, its operation is controlled by control cabinet, and cleaning is accurate quick, is saved significantly on clear
The time is washed, reduces the cleaning loss of solar energy.This cleaning device is simple in construction, can be achieved clear to the continuity of solar energy electroplax
Wash, cleaning cost is low.
To optimize above-mentioned technical proposal, the measure taken also includes：Support frame upper end is fixedly connected on upper flat plate bottom
The fixed block in face, support frame lower end are connected to the sliding block of lower flat board upper bottom surface.The rotating shaft of motor passes through lower flat board, and rotating shaft passes through company
Extension bar connection sliding block, sliding block can move in circular chute.Motor rotates, and drives sliding block to rotate by rotating shaft, the rotation of sliding block
Drive support frame to rotate, so that the upper flat plate affixed with support frame upper end rotates, be adsorbed in upper flat plate surrounding
Solar energy electroplax also concomitant rotation, therefore the continuity cleaning of solar energy electroplax can be realized.
Preferably, upper flat plate upper bottom surface surrounding is connected with cleaning sponge by rotating shaft, cleaning sponge upper end is hardhead sponge
Material, cleaning sponge lower end are soft sponge material, and main water inlet tube is embedded with inside hardhead sponge, outlet pipe is embedded with inside soft sponge, main
It is tightly connected between water inlet pipe and outlet pipe by flexible pipe.It is suitable to the cleaning dynamics of solar energy electroplax to clean sponge, is not easy to make
Into the damage of solar energy electroplax, and it can realize that water spray is synchronous with wiping and carry out, and significantly improve cleaning performance.Hardhead sponge is to cleaning
Sponge has supporting role, the pressure between increase cleaning sponge and solar energy electroplax, improves cleaning performance, soft sponge and the sun
Energy electroplax directly contacts, and soft sponge hardness is low, small to solar energy electroplax injury, coordinates the pressure of hardhead sponge transmission, both are mutual
Collaboration, makes cleaning dynamics just right；Main water inlet tube will intake passes to multiple outlet pipes, outlet pipe outlet water outlet by flexible pipe
Direction is towards solar energy electroplax direction, the pressure of hardhead sponge transmission so that the pressure increase for the water that outlet pipe is ejected, so that
Removal of the sponge to the stain of solar-electricity plate surface must be cleaned and show unexpected effect, embedded multiple water outlets
Pipe, water spray progress synchronous with what is wiped is realized, significantly improve the cleaning performance of solar energy electroplax, reduce cleaning and taken
Between.
Preferably, driven pulley includes the support ring positioned at both sides, rubber is connected between support ring, is provided with inside rubber
Cave in space, driven pulley is one side closed and center is connected with fixture, and driven pulley opposite side is opening and opening edge along being connected with
Sealing ring.Support ring positioned at both sides adds the intensity of driven wheel side, is allowed to meet to roll to require；Connected between support ring
Rubber add driven wheel side pliability, avoid the excessive scraping solar energy electroplax of driven pulley hardness；The sky that caves in is set in rubber
Between, and driven pulley is one side closed, a side opening so that driven pulley left and right directions forms the space of similar sucker, and due to rubber
Flexibility, can simply discharge air in space of caving in, the vacuum space of formation causes adsorbed object to be firmly fixed.This
Driven pulley can not only realize scroll actions, also with adsorption function so that this cleaning device can realize the absorption of solar energy electroplax
Cleaning and roll on themselves cleaning, installation cleaning early stage and later maintenance suitable for solar energy electroplax are cleaned, and it is clear to expand this
The scope of application of cleaning device, improve the utilization rate of the present apparatus.
Preferably, active wheel construction is consistent with driven pulley, driving wheel is connected to power drive unit, and driven pulley is connected to
Provided with rotating shaft and can 90 ° bending connectors.Driving wheel connects drive device, solar energy electroplax after installation is cleaned
When, present apparatus side is put, cleaned by the motion of active wheel drive unit；Driven pulley is connected with connector, when installation is clear early stage
When washing independent solar energy electroplax, adjustment connector makes driven pulley opening outwardly, and absorption solar energy electroplax is cleaned, and works as cleaning
During the solar energy electroplax of later maintenance, adjustment connector makes driven pulley opening outwardly, realize roller function towards side, side,
Automatic roll is carried out to clean.
Preferably, lower flat board bottom surface is surrounded by staggered form slideway, staggered form slideway is embedded to be provided with wiper mechanism.
Wiper mechanism can move in staggered form slideway so that cleaning is comprehensive, and wiper mechanism is included with being embedded in staggered form slideway
Sliding shoe, the bottom plate that sliding shoe connection can stretch up and down, bottom plate connect cleaning case by expansion link that can be elastic, you can real
Existing cleaning case cleans to the different azimuth of solar energy electroplax, improves operating efficiency, mitigates hand labor intensity.
Compared with prior art, beneficial effects of the present invention are:1）This cleaning device is simple in construction, can be achieved to solar energy
The continuity cleaning of electroplax, cleaning cost are low；2）It is suitable to the cleaning dynamics of solar energy electroplax to clean sponge, does not easily cause the sun
The damage of energy electroplax, and it can realize that water spray is synchronous with wiping and carry out, and significantly improve cleaning performance 3）This driven pulley not only can be real
Existing scroll actions, also with adsorption function so that this cleaning device can realize the absorption cleaning of solar energy electroplax and voluntarily roll
Dynamic cleaning, expand the scope of application of this cleaning device.
Present invention employs above-mentioned technical proposal to provide a kind of solar energy electroplax cleaning device, compensate for prior art not
Foot, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is the structural representation of the present invention；
Fig. 2 is the upper bottom surface schematic diagram of upper flat plate of the present invention；
Fig. 3 is the bottom surface schematic diagram of upper flat plate of the present invention；
Fig. 4 is the bottom surface schematic diagram of the lower flat board of the present invention；
Fig. 5 is the upper bottom surface schematic diagram of the lower flat board of the present invention；
Fig. 6 is the sectional view of present invention cleaning sponge；
Fig. 7 is the right view of driven pulley of the present invention；
Fig. 8 is the front view of driven pulley of the present invention；
Fig. 9 is the left view of driven pulley of the present invention；
Figure 10 is schematic diagram when connector of the present invention is in 180 °；
Figure 11 is schematic diagram when connector of the present invention is in 90 °.
Description of reference numerals：1 upper flat plate；2 driven pulleys；201 support rings；202 cave in space；203 rubber；204 fixtures；
3 support frames；4 times flat boards；5 driving wheels；6 wiper mechanisms；7 motors；8 cleaning sponges；801 hardhead sponge；802 main water inlet tubes；803 is soft
Sponge；804 outlet pipes；9 fixed blocks；10 staggered form slideways；11 circular chutes；12 sliding blocks；13 rotating shafts；14 connecting rods.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 11, a kind of solar energy electroplax cleaning device, including upper flat plate 1 and be connected by support frame 3 with upper flat plate 1
Lower flat board 4, the surrounding of upper flat plate 1 is connected with driven pulley 2, and the upper bottom surface surrounding of upper flat plate 1 is connected with cleaning sponge 8 by rotating shaft,
It is the material of hardhead sponge 801 to clean the upper end of sponge 8, and cleaning sponge 8 lower end is the soft material of sponge 803, and the inside of hardhead sponge 801 is embedded with master
Water inlet pipe 802, the soft inside of sponge 803 are embedded with outlet pipe 804, are sealed and connected by flexible pipe between main water inlet tube 802 and outlet pipe 804
Connect.Support frame 3 is two arranged in a crossed manner, and the upper end of support frame 3 is fixedly connected on the fixed block 9 of the bottom surface of upper flat plate 1, support frame 3
Lower end is connected to the sliding block 12 of the lower upper bottom surface of flat board 4.The lower surrounding of flat board 4 is connected with driving wheel 5, and the lower bottom surface center of flat board 4 is set
Motor 7 is equipped with, the rotating shaft 13 of motor 7 passes through lower flat board 4, and by the connection sliding block 12 of connecting rod 14, sliding block 12 can be in circle for rotating shaft 13
Moved in shape slideway 11.Driven pulley 2 includes the support ring 201 positioned at both sides, and rubber 203, rubber are connected between support ring 201
203 inside are provided with space 202 of caving in, and driven pulley 2 is one side closed and center is connected with fixture 204, and the opposite side of driven pulley 2 is to open
Mouth is simultaneously connected with sealing ring in opening edge edge.The structure of driving wheel 5 is consistent with driven pulley 2, and driving wheel 5 is connected to power drive unit,
Driven pulley 2 be connected to provided with rotating shaft and can 90 ° bending connectors.The lower bottom surface surrounding of flat board 4 is connected with wiper mechanism 6.Under
The bottom surface of flat board 4 is surrounded by staggered form slideway 10, and staggered form slideway 10 is embedded to be provided with wiper mechanism 6.
This cleaning device is simple in construction, can be achieved to clean the continuity of solar energy electroplax, cleaning cost is low；Clean sponge
The cleaning dynamics of 8 pairs of solar energy electroplax are suitable, do not easily cause the damage of solar energy electroplax, and it can realize that water spray is synchronous with wiping
Carry out, scroll actions can not only be realized by significantly improving cleaning performance this driven pulley 2, also with adsorption function so that this cleaning dress
The absorption cleaning and roll on themselves cleaning of achievable solar energy electroplax are put, expands the scope of application of this cleaning device.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 2：
As shown in Fig. 1 ~ 11, a kind of solar energy electroplax cleaning device, including upper flat plate 1 and be connected by support frame 3 with upper flat plate 1
Lower flat board 4, the surrounding of upper flat plate 1 is connected with driven pulley 2, and support frame 3 is two arranged in a crossed manner, and the lower surrounding of flat board 4 is connected with master
Driving wheel 5, the lower bottom surface of flat board 4 are provided centrally with motor 7, and the lower bottom surface surrounding of flat board 4 is connected with wiper mechanism 6.It is arranged in a crossed manner
Support frame 3 rotation can be driven by motor 7, therefore the cleaning of continuity solar energy electroplax can be realized；Wiper mechanism 6 can up and down, it is left
Move right, comprehensively cleaned, its operation is controlled by control cabinet, and cleaning is accurate quick, saves significantly on scavenging period, reduces too
The cleaning loss of positive energy.This cleaning device is simple in construction, can be achieved to clean the continuity of solar energy electroplax, cleaning cost is low.
The upper end of support frame 3 is fixedly connected on the fixed block 9 of the bottom surface of upper flat plate 1, and the lower end of support frame 3 is connected to lower flat board 4
The sliding block 12 of upper bottom surface.The rotating shaft 13 of motor 7 passes through lower flat board 4, and by the connection sliding block 12 of connecting rod 14, sliding block 12 can for rotating shaft 13
Moved in circular chute 11.Motor 7 rotates, and drives sliding block 12 to rotate by rotating shaft 13, and the rotation of sliding block 12 drives support frame 3
Rotate, so that the upper flat plate 1 affixed with the upper end of support frame 3 rotates, be adsorbed in the solar-electricity of the surrounding of upper flat plate 1
Plate also concomitant rotation, therefore the continuity cleaning of solar energy electroplax can be realized.
The upper bottom surface surrounding of upper flat plate 1 is connected with cleaning sponge 8 by rotating shaft, and cleaning sponge 8 upper end is the material of hardhead sponge 801
Material, cleaning sponge 8 lower end are the soft material of sponge 803, and the inside of hardhead sponge 801 is embedded with main water inlet tube 802, and the soft inside of sponge 803 is embedding
There is outlet pipe 804, be tightly connected between main water inlet tube 802 and outlet pipe 804 by flexible pipe.Sponge 8 is cleaned to solar energy electroplax
Cleaning dynamics it is suitable, do not easily cause the damage of solar energy electroplax, and it can realize water spray progress synchronous with wiping, significantly improve
Cleaning performance.Hardhead sponge 801 has supporting role, the pressure between increase cleaning sponge 8 and solar energy electroplax to cleaning sponge 8
Power, cleaning performance is improved, soft sponge 803 is directly contacted with solar energy electroplax, and the soft hardness of sponge 803 is low, and solar energy electroplax is hindered
Evil is small, and the pressure for coordinating hardhead sponge 801 to transmit, both mutually cooperate with, and make cleaning dynamics just right；Main water inlet tube 802 will enter
Water passes to multiple outlet pipes 804 by flexible pipe, and outlet pipe 804 exports water outlet direction towards solar energy electroplax direction, hardhead sponge 801
The pressure of transmission so that the pressure increase for the water that outlet pipe 804 is ejected, so that cleaning sponge 8 is to solar energy electroplax
The removal of the stain on surface shows unexpected effect, embedded multiple outlet pipes 804, realizes water spray and wipes
Synchronous progress, the cleaning performance of solar energy electroplax is significantly improved, the time required to reducing cleaning.
Driven pulley 2 includes the support ring 201 positioned at both sides, is connected with rubber 203 between support ring 201, inside rubber 203
Provided with space 202 of caving in, driven pulley 2 is one side closed and center is connected with fixture 204, and the opposite side of driven pulley 2 is opening and opened
Mouth edge is connected with sealing ring.Support ring 201 positioned at both sides adds the intensity of the side of driven pulley 2, is allowed to meet to roll to want
Ask；The rubber 203 connected between support ring 201 adds the side pliability of driven pulley 2, avoids the excessive scraping of the hardness of driven pulley 2
Solar energy electroplax；Space 202 of caving in is set in rubber 203, and driven pulley 2 is one side closed, a side opening so that driven pulley 2 or so
Direction forms the space of similar sucker, and due to the flexibility of rubber 203, can simply discharge air in space 202 of caving in, be formed
Vacuum space adsorbed object can be firmly fixed.This driven pulley 2 can not only realize scroll actions, also have absorption work(
Can so that this cleaning device can realize the absorption cleaning and roll on themselves cleaning of solar energy electroplax, suitable for solar energy electroplax
Cleaning installation early stage and later maintenance cleaning, expand the scope of application of this cleaning device, improve the utilization rate of the present apparatus.
Above-mentioned rubber 203 is modified natural rubber material, and its composition and its parts by weight are：15 ~ 22 parts of natural rubber, butylbenzene
5 ~ 7 parts of glue, 18 ~ 24 parts of chlorinated polyethylene rubber, 15 ~ 20 parts of carbon black, 4 ~ 6 parts of clay, 7 ~ 10 parts of aromatic naphtha, age resistor 1 ~ 2.5
Part, 0.1 ~ 0.15 part of processing aid, 2.2 ~ 3.5 parts of zinc oxide, 0.8 ~ 1.3 part of accelerator, 0.11 ~ 0.18 part of co-crosslinker, its
Middle age resistor, accelerator and co-crosslinker are that in the market is routinely bought, and processing aid is active peptides, the amino acid of active peptides
Sequence is：TDHQMAQSACIGVSQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKRRG
EENVSYKPFVVSHWKYGVAGCFYTHCGPNFCCCIS, its ozone resistance of the rubber 203 of mentioned component and ageing-resistant performance
Good, tearing toughness is preferable, and the addition of processing aid can change carbon black and clay surface texture, promote both with other into
The functional group divided is compatible, lifts the mechanical property of rubber 203, improves the inner molecular structure stability of rubber 203 so that the rubber of preparation
Glue has excellent anti ageing property, and elastic performance is good, the compactness height of structure of molecule, good airproof performance so that driven pulley 2 has
There is excellent absorption property, improve the reliability of cleaning device.
The structure of driving wheel 5 is consistent with driven pulley 2, and driving wheel 5 is connected to power drive unit, and driven pulley 2, which is connected to, to be provided with
Rotating shaft and can 90 ° bending connectors.Driving wheel 5 connects drive device, will when the solar energy electroplax after cleaning installation
Present apparatus side is put, and is cleaned by the motion of the drive device of driving wheel 5；Driven pulley 2 is connected with connector, when installation cleaning early stage is only
During vertical solar energy electroplax, adjustment connector makes driven pulley 2 be open outwardly, and absorption solar energy electroplax is cleaned, after cleaning
During the solar energy electroplax that the phase safeguards, adjustment connector makes driven pulley 2 be open outwardly, to realize roller function towards side, side, enter
Row is automatic to roll cleaning.
Above-mentioned connector is similar Damping rotation shaft structure, and two independent bar overlappings are provided with rotating shaft so that two independent bars
Can surround axis of rotation, and in rotating shaft 90 ° be provided with screens block with 180 ° of places so that two independent bars can carry out 90 ° of rotation tune
Section, realizes the switching of the adsorption function of driven pulley 2 and rolling function.
The lower bottom surface of flat board 4 is surrounded by staggered form slideway 10, and staggered form slideway 10 is embedded to be provided with wiper mechanism 6.Clearly
Washing machine structure 6 can move in staggered form slideway 10 so that cleaning is comprehensive, and wiper mechanism 6 is included with being embedded in staggered form slideway 10
Interior sliding shoe, the bottom plate that sliding shoe connection can stretch up and down, bottom plate connect cleaning case by expansion link that can be elastic, i.e.,
Cleaning case can be achieved to clean the different azimuth of solar energy electroplax, improve operating efficiency, mitigate hand labor intensity.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 3：
As shown in Fig. 1 ~ 11, when being cleaned before carrying out solar energy electroplax installation, its operation principle is：This cleaning device is put vertically
Put and fix, upper flat plate 1 and lower flat board 4 is in upper-lower position, driven pulley 2 is adjusted to opening outwardly, is absorption work(
Can, the control cabinet for being connected to motor 7 and wiper mechanism 6 is opened, makes motor 7 and the timing working of wiper mechanism 6, standing exists
Device side, solar energy electroplax to be cleaned is adsorbed onto on driven pulley 2 and fixed, wiper mechanism 6 enters to solar energy electroplax automatically
Row cleaning, motor 7, which rotates, causes support frame 3 to rotate, and then drives the upper flat plate 1 for being adsorbed with solar energy electroplax to rotate, will be upper flat
The face of the unadsorbed solar energy electroplax of the opposite side of plate 1 goes to operating personnel institute station location, and operating personnel continue to inhale solar energy electroplax
Attached to be fixed on cleaning device, the solar energy electroplax that repetitive operation finishes to first piece of absorption and cleaning is rotated to operating personnel institute
Station location, operating personnel remove the solar energy electroplax that cleaning finishes, replace with solar energy electroplax to be cleaned and work on, and operate
Personnel need to only pick and place solar energy electroplax, and simple to operate, manpower consumption is low, and cleaning device can clean polylith solar-electricity simultaneously
Plate, cleaning efficiency is high, and operating personnel repeat above-mentioned action, and to solar energy electroplax, all cleaning finishes, and closing control case, completes behaviour
Make.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 4：
As shown in Fig. 1 ~ 11, when cleaning the solar energy electroplax in use, the solar energy electroplax in use is generally slightly slant setting,
This cleaning device is fallen down to place, upper flat plate 1 and lower flat board 4 is in front and back position, adjustment driven pulley 2 is open towards side,
Side outwardly, is rolling function, cleaning sponge 8 is turned out, upset is extremely concordant with driven pulley 2, and external water pipe is connected
Main water inlet tube 802 is connected to, the drive device that driving driving wheel 5 rolls is opened, allows this cleaning device free and regular
Mobile, the cleaning sponge 8 concordant with driven pulley 2 is cleaned to solar energy electroplax surface dirt, spot etc., its cleaning performance
Good, driven pulley 2 and the edge of driving wheel 5 are provided with infrared detection, and this cleaning device can be avoided to drop or collide.For large area
Power generation region, often put for the connection of polylith solar energy electroplax, now this cleaning device can be cleaned continuously and automatically, can be very big
Cleaning cost is reduced, and the operation to operating personnel requires low, effectively reduces manpower consumption, reduces cost of labor, when all clear
The control cabinet for turning off this cleaning device is washed into, easy to operate, cleaning efficiency is high.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Sea salt sends Mortopl Science and Technology Ltd.
<120>A kind of solar energy electroplax cleaning device
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 105
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Gln Asp
1 5 10 15
Asn Ala Tyr Ala Ser Ala Ile Pro Arg Asp Cys His Gly Gly Lys Thr
20 25 30
Cys Glu Gly Ile Cys Ala Asp Ala Thr Ala Thr Met Asp Arg Tyr Ser
35 40 45
Asp Thr Gly Gly Pro Leu Ser Thr Ala Arg Cys Val Asn Ala Phe His
50 55 60
Phe Tyr Lys Arg Arg Gly Glu Glu Asn Val Ser Tyr Lys Pro Phe Val
65 70 75 80
Val Ser His Trp Lys Tyr Gly Val Ala Gly Cys Phe Tyr Thr His Cys
85 90 95
Gly Pro Asn Phe Cys Cys Cys Ile Ser
100 105
Claims (7)
1. a kind of solar energy electroplax cleaning device, including upper flat plate（1）With pass through support frame（3）With upper flat plate（1）Under connection
Flat board（4）, it is characterised in that：Described upper flat plate（1）Surrounding is connected with driven pulley（2）, described support frame（3）For two friendships
Fork is set, described lower flat board（4）Surrounding is connected with driving wheel（5）, described lower flat board（4）Bottom surface is provided centrally with motor
（7）, described lower flat board（4）Bottom surface surrounding is connected with wiper mechanism（6）.
A kind of 2. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described support frame（3）On
End is fixedly connected on upper flat plate（1）The fixed block of bottom surface（9）, described support frame（3）Lower end is connected to lower flat board（4）Upper bottom
The sliding block in face（12）.
A kind of 3. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described motor（7）Turn
Axle（13）Through lower flat board（4）, described rotating shaft（13）Pass through connecting rod（14）Connection sliding block（12）, described sliding block（12）Can
In circular chute（11）Interior motion.
A kind of 4. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described upper flat plate（1）On
Bottom surface surrounding is connected with cleaning sponge by rotating shaft（8）, described cleaning sponge（8）Upper end is hardhead sponge（801）Material, it is described
Cleaning sponge（8）Lower end is soft sponge（803）Material, described hardhead sponge（801）Inside is embedded with main water inlet tube（802）, institute
The soft sponge stated（803）Inside is embedded with outlet pipe（804）, described main water inlet tube（802）And outlet pipe（804）Between by soft
The seal of tube connects.
A kind of 5. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described driven pulley（2）Bag
Include the support ring positioned at both sides（201）, described support ring（201）Between be connected with rubber（203）, described rubber（203）
Inside is provided with space of caving in（202）, described driven pulley（2）One side closed and center is connected with fixture（204）, it is described from
Driving wheel（2）Opposite side is opening and opening edge edge is connected with sealing ring.
A kind of 6. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described driving wheel（5）Knot
Structure and driven pulley（2）Unanimously, described driving wheel（5）It is connected to power drive unit, described driven pulley（2）It is connected to and is provided with
Rotating shaft and can 90 ° bending connectors.
A kind of 7. solar energy electroplax cleaning device according to claim 1, it is characterised in that：Described lower flat board（4）Under
Bottom surface is surrounded by staggered form slideway（10）, described staggered form slideway（10）It is embedded to be provided with wiper mechanism（6）.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957584.5A CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957584.5A CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107824498A true CN107824498A (en) | 2018-03-23 |
| CN107824498B CN107824498B (en) | 2020-12-22 |
Family
ID=61648093
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710957584.5A Expired - Fee Related CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107824498B (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109494166A (en) * | 2018-11-13 | 2019-03-19 | 惠州西电仲恺人工智能联合创新实验室有限公司 | The online vision detection system of solar panel |
| CN114999115A (en) * | 2022-05-26 | 2022-09-02 | 中国地质大学（武汉） | Remote maintenance-free geological deformation and slumping early warning device |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN204912146U (en) * | 2015-07-13 | 2015-12-30 | 上海新孚美变速箱技术服务有限公司 | A universal cleaning equipment for refabrication of automatic transmission casing |
| KR20160033615A (en) * | 2014-09-16 | 2016-03-28 | 성균관대학교산학협력단 | Solar cell cleaning robot and cleaning method using the same |
| CN205436449U (en) * | 2016-01-07 | 2016-08-10 | 浙江谷高光伏科技有限公司 | Improved generation solar energy polycrystal silicon chip cleaning equipment |
| CN205490378U (en) * | 2016-03-10 | 2016-08-17 | 山东豪沃电气有限公司 | Automatic equipment that cleans of solar cell panel |
| CN105966490A (en) * | 2016-06-29 | 2016-09-28 | 青岛萨纳斯智能科技股份有限公司 | Walking device of solar panel cleaning robot |
-
2017
- 2017-10-16 CN CN201710957584.5A patent/CN107824498B/en not_active Expired - Fee Related
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160033615A (en) * | 2014-09-16 | 2016-03-28 | 성균관대학교산학협력단 | Solar cell cleaning robot and cleaning method using the same |
| CN204912146U (en) * | 2015-07-13 | 2015-12-30 | 上海新孚美变速箱技术服务有限公司 | A universal cleaning equipment for refabrication of automatic transmission casing |
| CN205436449U (en) * | 2016-01-07 | 2016-08-10 | 浙江谷高光伏科技有限公司 | Improved generation solar energy polycrystal silicon chip cleaning equipment |
| CN205490378U (en) * | 2016-03-10 | 2016-08-17 | 山东豪沃电气有限公司 | Automatic equipment that cleans of solar cell panel |
| CN105966490A (en) * | 2016-06-29 | 2016-09-28 | 青岛萨纳斯智能科技股份有限公司 | Walking device of solar panel cleaning robot |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109494166A (en) * | 2018-11-13 | 2019-03-19 | 惠州西电仲恺人工智能联合创新实验室有限公司 | The online vision detection system of solar panel |
| CN114999115A (en) * | 2022-05-26 | 2022-09-02 | 中国地质大学（武汉） | Remote maintenance-free geological deformation and slumping early warning device |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107824498B (en) | 2020-12-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN209550098U (en) | A kind of photovoltaic intelligent power station photovoltaic clearing apparatus | |
| CN109245687B (en) | Photovoltaic plate supporting device | |
| CN108856152A (en) | A kind of new-energy automobile solar panel cleaning apparatus for self | |
| CN208840114U (en) | A kind of solar cell module automatic dust removing apparatus | |
| CN209715851U (en) | A kind of solar panels cleaning plant | |
| CN208466620U (en) | A kind of photovoltaic battery panel clean robot | |
| CN204523690U (en) | Large-sized photovoltaic power station photovoltaic module automatic rinser | |
| CN104201980A (en) | Cleaning device and cleaning method for solar cell panel | |
| KR20160142570A (en) | Solar cell cleaning robot tracking on rail of solar cell | |
| CN207126852U (en) | A kind of photovoltaic cell board cleaning device | |
| CN201871499U (en) | Cleaning device for surface of photovoltaic cell panel | |
| CN206859538U (en) | A kind of solar energy rain shade that can clear up dedusting automatically | |
| CN203862587U (en) | Roller type cleaning device for photovoltaic modules | |
| CN208853310U (en) | A kind of photovoltaic panel surface cleaning system | |
| CN107824498A (en) | A kind of solar energy electroplax cleaning device | |
| CN206810741U (en) | For the intelligent automatic cleaning device of photovoltaic panel | |
| CN109617519A (en) | A solar panel cleaning robotic arm | |
| CN107824496A (en) | The mechanical decontamination plant of solar energy electroplax | |
| CN211127670U (en) | Urban renewable energy source circulating power generation equipment | |
| CN203872125U (en) | Combination rotation disc type cleaning device for photovoltaic assembly | |
| CN108566153B (en) | Photovoltaic power plant is from cleaning device | |
| CN106491053A (en) | A kind of plug-type ceiling wiping arrangement | |
| CN208437287U (en) | A kind of manufacture of solar cells cleaning drying device | |
| CN205762843U (en) | For cleaning the device of solar energy photovoltaic panel | |
| CN108729391A (en) | A kind of energy-saving and environment-friendly compact road sweeper device |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20201222 |