CN107824496A - The mechanical decontamination plant of solar energy electroplax - Google Patents
The mechanical decontamination plant of solar energy electroplax Download PDFInfo
- Publication number
- CN107824496A CN107824496A CN201710957605.3A CN201710957605A CN107824496A CN 107824496 A CN107824496 A CN 107824496A CN 201710957605 A CN201710957605 A CN 201710957605A CN 107824496 A CN107824496 A CN 107824496A
- Authority
- CN
- China
- Prior art keywords
- solar energy
- energy electroplax
- cleaning
- driven pulley
- flat board
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 238000009392 mechanical decontamination Methods 0.000 title claims abstract description 17
- 238000004140 cleaning Methods 0.000 claims abstract description 91
- 241000196324 Embryophyta Species 0.000 claims description 37
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 26
- 229920001971 elastomer Polymers 0.000 claims description 24
- 235000002505 Centaurea nigra Nutrition 0.000 claims description 15
- 241001073742 Mylopharodon conocephalus Species 0.000 claims description 13
- 239000000463 material Substances 0.000 claims description 7
- 238000005452 bending Methods 0.000 claims description 4
- 238000007789 sealing Methods 0.000 claims description 4
- 238000005406 washing Methods 0.000 claims description 3
- 238000005202 decontamination Methods 0.000 abstract description 25
- 230000003588 decontaminative effect Effects 0.000 abstract description 25
- 230000007246 mechanism Effects 0.000 abstract description 17
- 238000010276 construction Methods 0.000 abstract description 6
- 230000002000 scavenging effect Effects 0.000 abstract description 3
- 230000000694 effects Effects 0.000 description 11
- 238000010521 absorption reaction Methods 0.000 description 10
- 238000009434 installation Methods 0.000 description 8
- 238000000034 method Methods 0.000 description 7
- 230000006378 damage Effects 0.000 description 6
- 238000010586 diagram Methods 0.000 description 6
- 239000007921 spray Substances 0.000 description 6
- 230000001360 synchronised effect Effects 0.000 description 6
- 230000009471 action Effects 0.000 description 5
- 238000012423 maintenance Methods 0.000 description 4
- 238000001179 sorption measurement Methods 0.000 description 4
- 230000005540 biological transmission Effects 0.000 description 3
- 238000005096 rolling process Methods 0.000 description 3
- 240000003323 Centaurea nigra Species 0.000 description 2
- 239000004971 Cross linker Substances 0.000 description 2
- 244000043261 Hevea brasiliensis Species 0.000 description 2
- 239000006057 Non-nutritive feed additive Substances 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- OCKPCBLVNKHBMX-UHFFFAOYSA-N butylbenzene Chemical compound CCCCC1=CC=CC=C1 OCKPCBLVNKHBMX-UHFFFAOYSA-N 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000005611 electricity Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229920003052 natural elastomer Polymers 0.000 description 2
- 229920001194 natural rubber Polymers 0.000 description 2
- 238000010248 power generation Methods 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 239000007779 soft material Substances 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 1
- IYCZBJXFSZSHPN-DLOVCJGASA-N Ala-Cys-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O IYCZBJXFSZSHPN-DLOVCJGASA-N 0.000 description 1
- HYIDEIQUCBKIPL-CQDKDKBSSA-N Ala-Phe-His Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N HYIDEIQUCBKIPL-CQDKDKBSSA-N 0.000 description 1
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 1
- OEVCHROQUIVQFZ-YTLHQDLWSA-N Ala-Thr-Ala Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](C)C(O)=O OEVCHROQUIVQFZ-YTLHQDLWSA-N 0.000 description 1
- AUFHLLPVPSMEOG-YUMQZZPRSA-N Arg-Gly-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O AUFHLLPVPSMEOG-YUMQZZPRSA-N 0.000 description 1
- QHUOOCKNNURZSL-IHRRRGAJSA-N Arg-Tyr-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O QHUOOCKNNURZSL-IHRRRGAJSA-N 0.000 description 1
- AKEBUSZTMQLNIX-UWJYBYFXSA-N Asn-Ala-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N AKEBUSZTMQLNIX-UWJYBYFXSA-N 0.000 description 1
- IAMNNSSEBXDJMN-CIUDSAMLSA-N Asp-Cys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)N IAMNNSSEBXDJMN-CIUDSAMLSA-N 0.000 description 1
- QFMCHXSGIZPBKG-ZLUOBGJFSA-N Cys-Ala-Asp Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N QFMCHXSGIZPBKG-ZLUOBGJFSA-N 0.000 description 1
- SKSJPIBFNFPTJB-NKWVEPMBSA-N Cys-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CS)N)C(=O)O SKSJPIBFNFPTJB-NKWVEPMBSA-N 0.000 description 1
- ZMWOJVAXTOUHAP-ZKWXMUAHSA-N Cys-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N ZMWOJVAXTOUHAP-ZKWXMUAHSA-N 0.000 description 1
- VFGADOJXRLWTBU-JBDRJPRFSA-N Cys-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N VFGADOJXRLWTBU-JBDRJPRFSA-N 0.000 description 1
- JRZMCSIUYGSJKP-ZKWXMUAHSA-N Cys-Val-Asn Chemical compound SC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O JRZMCSIUYGSJKP-ZKWXMUAHSA-N 0.000 description 1
- 241000628997 Flos Species 0.000 description 1
- KLKYKPXITJBSNI-CIUDSAMLSA-N Gln-Met-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O KLKYKPXITJBSNI-CIUDSAMLSA-N 0.000 description 1
- KUBFPYIMAGXGBT-ACZMJKKPSA-N Gln-Ser-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KUBFPYIMAGXGBT-ACZMJKKPSA-N 0.000 description 1
- PCBBLFVHTYNQGG-LAEOZQHASA-N Glu-Asn-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N PCBBLFVHTYNQGG-LAEOZQHASA-N 0.000 description 1
- CUXJIASLBRJOFV-LAEOZQHASA-N Glu-Gly-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O CUXJIASLBRJOFV-LAEOZQHASA-N 0.000 description 1
- UQJNXZSSGQIPIQ-FBCQKBJTSA-N Gly-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)CN UQJNXZSSGQIPIQ-FBCQKBJTSA-N 0.000 description 1
- PDLQNLSEJXOQNQ-IHPCNDPISA-N His-Trp-Lys Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(O)=O)C1=CN=CN1 PDLQNLSEJXOQNQ-IHPCNDPISA-N 0.000 description 1
- SVZFKLBRCYCIIY-CYDGBPFRSA-N Ile-Pro-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SVZFKLBRCYCIIY-CYDGBPFRSA-N 0.000 description 1
- 241000143233 Mytilus coruscus Species 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- AEEQKUDWJGOFQI-SRVKXCTJSA-N Phe-Cys-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N AEEQKUDWJGOFQI-SRVKXCTJSA-N 0.000 description 1
- FKYKZHOKDOPHSA-DCAQKATOSA-N Pro-Leu-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FKYKZHOKDOPHSA-DCAQKATOSA-N 0.000 description 1
- XYAFCOJKICBRDU-JYJNAYRXSA-N Pro-Phe-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O XYAFCOJKICBRDU-JYJNAYRXSA-N 0.000 description 1
- HKHCTNFKZXAMIF-KKUMJFAQSA-N Ser-Tyr-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CC1=CC=C(O)C=C1 HKHCTNFKZXAMIF-KKUMJFAQSA-N 0.000 description 1
- MQCPGOZXFSYJPS-KZVJFYERSA-N Thr-Ala-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MQCPGOZXFSYJPS-KZVJFYERSA-N 0.000 description 1
- NOWXWJLVGTVJKM-PBCZWWQYSA-N Thr-Asp-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O NOWXWJLVGTVJKM-PBCZWWQYSA-N 0.000 description 1
- XPNSAQMEAVSQRD-FBCQKBJTSA-N Thr-Gly-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)NCC(=O)NCC(O)=O XPNSAQMEAVSQRD-FBCQKBJTSA-N 0.000 description 1
- YJVJPJPHHFOVMG-VEVYYDQMSA-N Thr-Met-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O YJVJPJPHHFOVMG-VEVYYDQMSA-N 0.000 description 1
- CTDPLKMBVALCGN-JSGCOSHPSA-N Tyr-Gly-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O CTDPLKMBVALCGN-JSGCOSHPSA-N 0.000 description 1
- WOAQYWUEUYMVGK-ULQDDVLXSA-N Tyr-Lys-Arg Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WOAQYWUEUYMVGK-ULQDDVLXSA-N 0.000 description 1
- VSYROIRKNBCULO-BWAGICSOSA-N Tyr-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)O VSYROIRKNBCULO-BWAGICSOSA-N 0.000 description 1
- RYHUIHUOYRNNIE-NRPADANISA-N Val-Ser-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RYHUIHUOYRNNIE-NRPADANISA-N 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 238000007259 addition reaction Methods 0.000 description 1
- 108010045350 alanyl-tyrosyl-alanine Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000003712 anti-aging effect Effects 0.000 description 1
- 108010068380 arginylarginine Proteins 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000007068 beta-elimination reaction Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000006229 carbon black Substances 0.000 description 1
- 235000019994 cava Nutrition 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229920006235 chlorinated polyethylene elastomer Polymers 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 238000013016 damping Methods 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000002803 fossil fuel Substances 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 108010036413 histidylglycine Proteins 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000011900 installation process Methods 0.000 description 1
- 108010027338 isoleucylcysteine Proteins 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000005693 optoelectronics Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000006462 rearrangement reaction Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
Classifications
-
- B08B1/20—
-
- H—ELECTRICITY
- H02—GENERATION; CONVERSION OR DISTRIBUTION OF ELECTRIC POWER
- H02S—GENERATION OF ELECTRIC POWER BY CONVERSION OF INFRARED RADIATION, VISIBLE LIGHT OR ULTRAVIOLET LIGHT, e.g. USING PHOTOVOLTAIC [PV] MODULES
- H02S40/00—Components or accessories in combination with PV modules, not provided for in groups H02S10/00 - H02S30/00
- H02S40/10—Cleaning arrangements
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E10/00—Energy generation through renewable energy sources
- Y02E10/50—Photovoltaic [PV] energy
Abstract
The present invention provides a kind of mechanical decontamination plant of solar energy electroplax, belong to solar energy clean dirt technical field, device includes disk and the lower flat board being connected by support frame with disk, disk surrounding is connected with upper flat plate, upper flat plate lateral wall is connected with driven pulley, and support frame is two arranged in a crossed manner, and lower flat board surrounding is connected with driving wheel, lower flat board bottom surface is provided centrally with motor, and lower flat board bottom surface surrounding is connected with wiper mechanism.Wiper mechanism can up and down, move left and right, comprehensively cleaned, its operation is controlled by control cabinet, and cleaning is accurate quick, saves significantly on scavenging period, reduces the cleaning loss of solar energy.This decontamination plant is simple in construction, and the continuity clean dirt to solar energy electroplax can be achieved, and decontamination cost is low.
Description
Technical field
The invention belongs to solar energy clean dirt technical field, and in particular to a kind of mechanical decontamination dress of solar energy electroplax
Put.
Background technology
Biology is formed from the earth just mainly to survive with the light and heat of sun offer, and is also understood from ancient human and dried with sunlight
Object, and as the method for preserving food, such as salt manufacturing and solarization cured fish.But under fossil fuel reduction, just intentionally solar energy
Further development.The utilization of solar energy has Passive use（Photothermal deformation）With opto-electronic conversion two ways.Solar power generation one
The emerging regenerative resource of kind.Sensu lato solar energy is the source of many energy on the earth, such as wind energy, chemical energy, the gesture of water
Can etc..Solar cell refers to the electromagnetism species to be generated electricity using the energy of sunshine.Filled relative to common batteries with recyclable
For battery, solar cell belongs to more energy efficient environmentally friendly green product.
And exposed solar cell module out of doors, be easy to accumulation dust, so not only influence daylighting effect so as to
Transformation efficiency is reduced, so must be cleaned in time to solar energy electroplax.Traditional photovoltaic plant solar panel it is clear
It is clean mainly to be cleaned by artificial.The cleaning process of the method is relatively cumbersome, and efficiency is low, and solar energy electroplax is dual platen
When, its artificial cleaning difficulty is bigger, and time-consuming longer.
And it is also basic using the cleaning for manually carrying out installing early stage in solar energy electroplax installation process, this cleaning way is not
Hand labor intensity is only increased, also easily because manual operation causes the damage of solar energy electroplax when also reducing operating efficiency, and cleaning
It is bad, therefore how the simple and effective solar panel that carries out installs the cleaning of early stage, and easily carry out later maintenance
Cleaning, becomes particularly important to solar energy career development.
The content of the invention
An object of the present invention is to provide the solar energy electroplax before a kind of suitable cleaning installation, its clean dirt effect
It is good, and can simple realization double-sided solar electroplax cleaning, greatly reduce hand labor intensity, clean dirt efficiency high and can be real
The mechanical decontamination plant of solar energy electroplax of existing continuous wash.
The second object of the present invention is in the solar energy electroplax in a kind of suitable cleaning use is provided, the letter of its apparatus structure
It is single, can roll on themselves cleaning, clean dirt efficiency high, reliability is high, the solar energy electroplax small to solar-electricity dash-board injury machinery
Formula decontamination plant.
The present invention is for the scheme taken of solution above-mentioned technical problem：The mechanical decontamination plant of solar energy electroplax, including
Disk and the lower flat board being connected by support frame with disk, disk surrounding are connected with upper flat plate, upper flat plate lateral wall be connected with from
Driving wheel, support frame are two arranged in a crossed manner, and lower flat board surrounding is connected with driving wheel, and lower flat board bottom surface is provided centrally with motor,
Lower flat board bottom surface surrounding is connected with wiper mechanism.Support frame arranged in a crossed manner can be rotated by motor driven, therefore can be realized continuous
The clean dirt of property solar energy electroplax；Wiper mechanism can up and down, move left and right, comprehensively cleaned, its operate by control cabinet
Control, cleaning is accurate quick, saves significantly on scavenging period, reduces the cleaning loss of solar energy.Driving wheel and driven pulley work are strong
Degree is high, and good mechanical property makes the operation of device have high reliability.This decontamination plant is simple in construction, can be achieved to solar-electricity
The continuity clean dirt of plate, clean dirt cost are low.
To optimize above-mentioned technical proposal, the measure taken also includes：Disk surrounding connects transverse slat, transverse slat by expansion link
Upper end is provided with micromachine, and the output shaft of micromachine connects upper flat plate through transverse slat.The rotation of micromachine is passed by output shaft
Pass upper flat plate so that upper flat plate is rotated centered on output shaft, when double-sided solar electroplax is positioned on upper flat plate, simultaneously
After cleaning, micromachine, which rotates, make it that the another side of double-sided solar electroplax is exposed, and then can reach easy cleaning
The effect of double-sided solar electroplax；Disk connects transverse slat, the Retractable characteristic of expansion link so that the present apparatus by expansion link
The clean dirt of the solar energy electroplax of different size can be applied to, add the scope of application of the present apparatus.
Preferably, support frame upper end is fixedly connected on the fixed block of disk bottom surface, support frame lower end is connected to lower flat
The sliding block of plate upper bottom surface.Sliding block can make support frame rotate, because support frame upper end is affixed, therefore what support frame upper end connected
Disk can also rotate therewith, and then can realize the clean dirt of successional solar energy electroplax.
Preferably, upper flat plate bottom surface is connected with cleaning sponge by rotating shaft, cleaning sponge upper end is hardhead sponge material,
Cleaning sponge lower end is soft sponge material, and main water inlet tube is embedded with inside hardhead sponge, outlet pipe, main water inlet tube are embedded with inside soft sponge
It is tightly connected between outlet pipe by flexible pipe.It is suitable to the cleaning dynamics of solar energy electroplax to clean sponge, does not easily cause the sun
The damage of energy electroplax, and it can realize that water spray is synchronous with wiping and carry out, and significantly improve clean dirt effect.Hardhead sponge is to cleaning sea
Silk floss has a supporting role, the pressure between increase cleaning sponge and solar energy electroplax, improves clean dirt effect, soft sponge and too
Positive energy electroplax is directly contacted, and soft sponge hardness is low, and small, the pressure of cooperation hardhead sponge transmission, Liang Zhexiang are injured to solar energy electroplax
Mutually collaboration, makes cleaning dynamics just right；Main water inlet tube will intake and pass to multiple outlet pipes by flexible pipe, and outlet pipe exports out
Water direction is towards solar energy electroplax direction, the pressure of hardhead sponge transmission so that the pressure increase for the water that outlet pipe is ejected, so as to
So that removal of the cleaning sponge to the stain of solar-electricity plate surface shows unexpected effect, it is embedded it is multiple go out
Water pipe, water spray progress synchronous with what is wiped is realized, the cleaning performance of solar energy electroplax is significantly improved, reduces clean dirt institute
Take time.
Preferably, the rotating shaft of motor passes through lower flat board, rotating shaft can be in circular chute by connecting rod connection sliding block, sliding block
Interior motion.Motor rotates, and drives sliding block to rotate by rotating shaft, and the rotation of sliding block drives support frame to rotate, and motor driving is flat
Surely so that the motion stabilization of corresponding component and convenient, enable the work of present apparatus efficient stable.
Preferably, driven pulley includes the support ring positioned at both sides, rubber is connected between support ring, is provided with inside rubber
Cave in space, driven pulley is one side closed and center is connected with fixture, and driven pulley opposite side is opening and opening edge along being connected with
Sealing ring.Support ring positioned at both sides adds the intensity of driven wheel side, is allowed to meet to roll to require；Connected between support ring
Rubber add driven wheel side pliability, avoid the excessive scraping solar energy electroplax of driven pulley hardness；The sky that caves in is set in rubber
Between, and driven pulley is one side closed, a side opening so that driven pulley left and right directions forms the space of similar sucker, and due to rubber
Flexibility, can simply discharge air in space of caving in, the vacuum space of formation causes adsorbed object to be firmly fixed.This
Driven pulley can not only realize scroll actions, also with adsorption function so that this decontamination plant can realize the absorption of solar energy electroplax
Cleaning and roll on themselves cleaning, suitable for installation cleaning early stage of solar energy electroplax and later maintenance clean dirt, are expanded
The scope of application of this decontamination plant, improve the utilization rate of the present apparatus.
Preferably, active wheel construction is consistent with driven pulley, driving wheel is connected to power drive unit, and driven pulley is connected to
Provided with rotating shaft and can 90 ° bending connectors.Driving wheel connects drive device, solar energy electroplax after installation is cleaned
When, present apparatus side is put, cleaned by the motion of active wheel drive unit；Driven pulley is connected with connector, when installation is clear early stage
When washing independent solar energy electroplax, adjustment connector makes driven pulley opening outwardly, and absorption solar energy electroplax is cleaned, and works as cleaning
During the solar energy electroplax of later maintenance, adjustment connector makes driven pulley opening outwardly, realize roller function towards side, side,
Carry out automatic rolling clean dirt.
Preferably, lower flat board bottom surface is surrounded by staggered form slideway, staggered form slideway is embedded to be provided with wiper mechanism.
Wiper mechanism can move in staggered form slideway so that cleaning is comprehensive, and wiper mechanism is included with being embedded in staggered form slideway
Sliding shoe, the bottom plate that sliding shoe connection can stretch up and down, bottom plate connect cleaning case by expansion link that can be elastic, you can real
Existing cleaning case cleans to the different azimuth of solar energy electroplax, improves operating efficiency, mitigates hand labor intensity.
Compared with prior art, beneficial effects of the present invention are:1）This decontamination plant is simple in construction, can be achieved to solar energy
The continuity clean dirt of electroplax, cleaning cost are low；2）Present apparatus upper flat plate itself can rotate, and can realize double-sided solar electricity
The cleaning of plate, and clean easy, efficiency high；3）It is suitable to the cleaning dynamics of solar energy electroplax to clean sponge, does not easily cause the sun
The damage of energy electroplax, and it can realize that water spray is synchronous with wiping and carry out, and significantly improve clean dirt effect；4）This driven pulley is not only
Can be achieved scroll actions, also with adsorption function so that this decontamination plant can realize solar energy electroplax absorption cleaning and from
Row rolls clean dirt, expands the scope of application of this decontamination plant.
Present invention employs above-mentioned technical proposal to provide a kind of mechanical decontamination plant of solar energy electroplax, compensate for existing skill
The deficiency of art, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is the structural representation of the present invention；
Fig. 2 is the upper bottom surface schematic diagram of upper flat plate of the present invention and disk；
Fig. 3 is the bottom surface schematic diagram of upper flat plate of the present invention and disk；
Fig. 4 is the bottom surface schematic diagram of the lower flat board of the present invention；
Fig. 5 is the upper bottom surface schematic diagram of the lower flat board of the present invention；
Fig. 6 is the front view of driven pulley of the present invention
Fig. 7 is the right view of driven pulley of the present invention；
Fig. 8 is the left view of driven pulley of the present invention；
Fig. 9 is the sectional view of present invention cleaning sponge；
Figure 10 is schematic diagram when connector of the present invention is in 180 °；
Figure 11 is schematic diagram when connector of the present invention is in 90 °.
Description of reference numerals：1 upper flat plate；2 driven pulleys；201 support rings；202 cave in space；203 rubber；204 fixtures；
3 support frames；4 times flat boards；5 driving wheels；6 wiper mechanisms；7 motors；8 micromachines；9 transverse slats；10 output shafts；11 disks；12 is solid
Determine block；13 staggered form slideways；14 circular chutes；15 sliding blocks；16 rotating shafts；17 connecting rods；18 cleaning sponges；181 hardhead sponge；182
Main water inlet tube；183 soft sponges；184 outlet pipes.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 11, the mechanical decontamination plant of solar energy electroplax, including disk 11 and be connected by support frame 3 with disk 11
Lower flat board 4, the surrounding of disk 11 is connected with upper flat plate 1, and the lateral wall of upper flat plate 1 is connected with driven pulley 2, and support frame 3 is two friendships
Fork is set, and the upper end of support frame 3 is fixedly connected on the fixed block 12 of the bottom surface of disk 11, and the lower end of support frame 3 is connected on lower flat board 4
The sliding block 15 of bottom surface.The lower surrounding of flat board 4 is connected with driving wheel 5, and the lower bottom surface of flat board 4 is provided centrally with motor 7, and motor 7 turns
Axle 16 passes through lower flat board 4, and rotating shaft 16 can be moved by the connection sliding block 15 of connecting rod 17, sliding block 15 in circular chute 14.It is lower flat
The bottom surface surrounding of plate 4 is connected with wiper mechanism 6.The surrounding of disk 11 connects transverse slat 9 by expansion link, and the upper end of transverse slat 9 is provided with miniature
Motor 8, the output shaft 10 of micromachine 8 connect upper flat plate 1 through transverse slat 9.The bottom surface of upper flat plate 1 is connected with cleaning by rotating shaft
Sponge 18, cleaning sponge 18 upper end be the material of hardhead sponge 181, and it is the soft material of sponge 183 to clean the lower end of sponge 18, hardhead sponge 181
Inside is embedded with main water inlet tube 182, and the soft inside of sponge 183 is embedded with outlet pipe 184, passed through between main water inlet tube 182 and outlet pipe 184
Flexible pipe is tightly connected.Driven pulley 2 includes the support ring 201 positioned at both sides, and rubber 203, rubber are connected between support ring 201
203 inside are provided with space 202 of caving in, and driven pulley 2 is one side closed and center is connected with fixture 204, and the opposite side of driven pulley 2 is to open
Mouth is simultaneously connected with sealing ring in opening edge edge.The structure of driving wheel 5 is consistent with driven pulley 2, and driving wheel 5 is connected to power drive unit,
Driven pulley 2 be connected to provided with rotating shaft and can 90 ° bending connectors.
This decontamination plant is simple in construction, and the continuity clean dirt to solar energy electroplax can be achieved, and cleaning cost is low；This dress
Putting upper flat plate 1 itself can rotate, and can realize the cleaning of double-sided solar electroplax, and clean easy, efficiency high；Clean sponge 18
It is suitable to the cleaning dynamics of solar energy electroplax, the damage of solar energy electroplax is not easily caused, and it can realize that water spray is synchronous with wiping
Carry out, significantly improve clean dirt effect；Driven pulley 2 can not only realize scroll actions, also with adsorption function so that this decontamination
Device can realize absorption cleaning and the roll on themselves clean dirt of solar energy electroplax, expand the applicable model of this decontamination plant
Enclose.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 2：
As shown in Fig. 1 ~ 11, the mechanical decontamination plant of solar energy electroplax, including disk 11 and be connected by support frame 3 with disk 11
Lower flat board 4, the surrounding of disk 11 is connected with upper flat plate 1, and the lateral wall of upper flat plate 1 is connected with driven pulley 2, and support frame 3 is two friendships
Fork is set, and the lower surrounding of flat board 4 is connected with driving wheel 5, and the lower bottom surface of flat board 4 is provided centrally with motor 7, the lower bottom surface four of flat board 4
It is connected with wiper mechanism 6 week.Support frame 3 arranged in a crossed manner can be driven rotation by motor 7, therefore can realize continuity solar energy electroplax
Clean dirt；Wiper mechanism 6 can up and down, move left and right, comprehensively cleaned, its operation is controlled by control cabinet, cleaning essence
It is really quick, scavenging period is saved significantly on, reduces the cleaning loss of solar energy.Driving wheel 5 and the working strength of driven pulley 2 are high, machinery
Performance is good, makes the operation of device have high reliability.This decontamination plant is simple in construction, and the continuity to solar energy electroplax can be achieved
Cleaning, cleaning cost are low.
The surrounding of disk 11 connects transverse slat 9 by expansion link, and the upper end of transverse slat 9 is provided with micromachine 8, the output of micromachine 8
Axle 10 connects upper flat plate 1 through transverse slat 9.The rotation of micromachine 8 passes to upper flat plate 1 by output shaft 10 so that upper flat plate 1 with
Rotated centered on output shaft 10, when double-sided solar electroplax is positioned on upper flat plate 1, after simultaneously cleaning, micromachine 8
Rotation make it that the another side of double-sided solar electroplax is exposed, and then can reach the work(of easy cleaning double-sided solar electroplax
Effect；Disk 11 connects transverse slat 9, the Retractable characteristic of expansion link by expansion link so that the present apparatus can be applied to difference
The cleaning of the solar energy electroplax of specification, add the scope of application of the present apparatus.
The upper end of support frame 3 is fixedly connected on the fixed block 12 of the bottom surface of disk 11, and the lower end of support frame 3 is connected to lower flat board 4
The sliding block 15 of upper bottom surface.Sliding block 15 can make support frame 3 rotate, because the upper end of support frame 3 is affixed, therefore the upper end of support frame 3
The disk 11 of connection can also rotate therewith, and then can realize the clean dirt of successional solar energy electroplax.
The bottom surface of upper flat plate 1 is connected with cleaning sponge 18 by rotating shaft, and cleaning sponge 18 upper end is the material of hardhead sponge 181,
Cleaning sponge 18 lower end is the soft material of sponge 183, and the inside of hardhead sponge 181 is embedded with main water inlet tube 182, and the soft inside of sponge 183 is embedded with
Outlet pipe 184, it is tightly connected between main water inlet tube 182 and outlet pipe 184 by flexible pipe.Sponge 18 is cleaned to solar energy electroplax
Cleaning dynamics are suitable, do not easily cause the damage of solar energy electroplax, and it can realize that water spray is synchronous with wiping and carry out, and significantly improve clear
Wash effect.Hardhead sponge 181 has supporting role, the pressure between increase cleaning sponge 18 and solar energy electroplax to cleaning sponge 18
Power, cleaning performance is improved, soft sponge 183 is directly contacted with solar energy electroplax, and the soft hardness of sponge 183 is low, and solar energy electroplax is hindered
Evil is small, and the pressure for coordinating hardhead sponge 181 to transmit, both mutually cooperate with, and make cleaning dynamics just right；Main water inlet tube 182 will enter
Water passes to multiple outlet pipes 184 by flexible pipe, and outlet pipe 184 exports water outlet direction towards solar energy electroplax direction, hardhead sponge 181
The pressure of transmission so that the pressure increase for the water that outlet pipe 184 is ejected, so that cleaning sponge 18 is to solar energy electroplax
The removal of the stain on surface shows unexpected effect, embedded multiple outlet pipes 184, realizes water spray and wipes
Synchronous progress, the cleaning performance of solar energy electroplax is significantly improved, the time required to reducing cleaning.
The rotating shaft 16 of motor 7 passes through lower flat board 4, and by the connection sliding block 15 of connecting rod 17, sliding block 15 can be in circle for rotating shaft 16
Moved in slideway 14.Motor 7 rotates, and drives sliding block 15 to rotate by rotating shaft 16, and the rotation of sliding block 15 drives support frame 3 to revolve
Turn, motor 7 drives steadily so that the motion stabilization of corresponding component and convenient, enable the work of present apparatus efficient stable.
Driven pulley 2 includes the support ring 201 positioned at both sides, is connected with rubber 203 between support ring 201, inside rubber 203
Provided with space 202 of caving in, driven pulley 2 is one side closed and center is connected with fixture 204, and the opposite side of driven pulley 2 is opening and opened
Mouth edge is connected with sealing ring.Support ring 201 positioned at both sides adds the intensity of the side of driven pulley 2, is allowed to meet to roll to want
Ask；The rubber 203 connected between support ring 201 adds the side pliability of driven pulley 2, avoids the excessive scraping of the hardness of driven pulley 2
Solar energy electroplax；Space 202 of caving in is set in rubber 203, and driven pulley 2 is one side closed, a side opening so that driven pulley 2 or so
Direction forms the space of similar sucker, and due to the flexibility of rubber 203, can simply discharge air in space 202 of caving in, be formed
Vacuum space adsorbed object can be firmly fixed.This driven pulley 2 can not only realize scroll actions, also have absorption work(
Can so that this decontamination plant can realize the absorption cleaning and roll on themselves cleaning of solar energy electroplax, suitable for solar energy electroplax
Cleaning installation early stage and later maintenance cleaning, expand the scope of application of this decontamination plant, improve the utilization rate of the present apparatus.
Above-mentioned rubber 203 is modified natural rubber material, and its composition and its parts by weight are：15 ~ 22 parts of natural rubber, butylbenzene
5 ~ 7 parts of glue, 18 ~ 24 parts of chlorinated polyethylene rubber, 15 ~ 20 parts of carbon black, 4 ~ 6 parts of clay, 7 ~ 10 parts of aromatic naphtha, age resistor 1 ~ 2.5
Part, 0.1 ~ 0.15 part of processing aid, 2.2 ~ 3.5 parts of zinc oxide, 0.8 ~ 1.3 part of accelerator, 0.11 ~ 0.18 part of co-crosslinker, its
Middle processing aid, accelerator and co-crosslinker are that in the market is routinely bought, and age resistor is active peptides, the amino acid of active peptides
Sequence is：TDHQMAQSACIGVSQDNAYASAIPRDCHGGTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKRRGE
ENVSYKPFVSHWKYGVACFYTHCGPNFCCCIS, its ozone resistance of the rubber 203 of mentioned component and ageing-resistant performance are good, resist
Tearing strength is preferable, and the addition of age resistor can be effectively improved the performance for the rubber 203 for preparing gained, can effectively improve rubber molecule
The stability of chain, avoid the main chain, side chain, cross linked chain of rubber molecular chain from being broken, suppress to occur molecule in rubber 203 and occur
Substitution reaction, addition reaction, beta-elimination reaction and molecular rearrangement reaction etc., the ageing resistace of rubber 203 is effectively improved, is carried
The high inner molecular structure stability of rubber 203 so that the rubber of preparation has excellent anti ageing property, and elastic performance is good,
The compactness height of structure of molecule, good airproof performance so that driven pulley 2 has excellent absorption property, improves the reliable of decontamination plant
Property.
The structure of driving wheel 5 is consistent with driven pulley 2, and driving wheel 5 is connected to power drive unit, and driven pulley 2, which is connected to, to be provided with
Rotating shaft and can 90 ° bending connectors.Driving wheel 5 connects drive device, will when the solar energy electroplax after cleaning installation
Present apparatus side is put, and is cleaned by the motion of the drive device of driving wheel 5；Driven pulley 2 is connected with connector, when installation cleaning early stage is only
During vertical solar energy electroplax, adjustment connector makes driven pulley 2 be open outwardly, and absorption solar energy electroplax is cleaned, after cleaning
During the solar energy electroplax that the phase safeguards, adjustment connector makes driven pulley 2 be open outwardly, to realize roller function towards side, side, enter
Row is automatic to roll cleaning.
Above-mentioned connector is similar Damping rotation shaft structure, and two independent bar overlappings are provided with rotating shaft so that two independent bars
Can surround axis of rotation, and in rotating shaft 90 ° be provided with screens block with 180 ° of places so that two independent bars can carry out 90 ° of rotation tune
Section, realizes the switching of the adsorption function of driven pulley 2 and rolling function.
The lower bottom surface of flat board 4 is surrounded by staggered form slideway 13, and staggered form slideway 13 is embedded to be provided with wiper mechanism 6.Clearly
Washing machine structure 6 can move in staggered form slideway 13 so that cleaning is comprehensive, and wiper mechanism 6 is included with being embedded in staggered form slideway 13
Interior sliding shoe, the bottom plate that sliding shoe connection can stretch up and down, bottom plate connect cleaning case by expansion link that can be elastic, i.e.,
Cleaning case can be achieved to clean the different azimuth of solar energy electroplax, improve operating efficiency, mitigate hand labor intensity.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 3：
As shown in Fig. 1 ~ 11, when being cleaned before carrying out solar energy electroplax installation, its operation principle is：This decontamination plant is put vertically
Put and fix, upper flat plate 1 and lower flat board 4 is in upper-lower position, driven pulley 2 is adjusted to opening outwardly, is absorption work(
Can, the control cabinet for being connected to motor 7 and wiper mechanism 6 is opened, makes motor 7 and the timing working of wiper mechanism 6, standing exists
Device side, solar energy electroplax to be cleaned is adsorbed onto on driven pulley 2 and fixed, wiper mechanism 6 enters to solar energy electroplax automatically
Row cleaning, motor 7, which rotates, causes support frame 3 to rotate, and then drives the upper flat plate 1 for being adsorbed with solar energy electroplax to rotate, will be upper flat
The face of the unadsorbed solar energy electroplax of the opposite side of plate 1 goes to operating personnel institute station location, and operating personnel continue to inhale solar energy electroplax
Attached to be fixed on decontamination plant, the solar energy electroplax that repetitive operation finishes to first piece of absorption and cleaning is rotated to operating personnel institute
Station location, operating personnel remove the solar energy electroplax that cleaning finishes, replace with solar energy electroplax to be cleaned and work on, and operate
Personnel need to only pick and place solar energy electroplax, and simple to operate, manpower consumption is low, and decontamination plant can clean polylith solar-electricity simultaneously
Plate, cleaning efficiency are high, and when cleaning double-sided solar electroplax, operating personnel still carry out aforesaid operations, in this decontamination plant
Micromachine 8 is opened, and drives upper flat plate 1 to rotate so that the solar energy electroplax being attracted on driven pulley 2 can carry out changing face clear
Wash, adsorbed one side inwardly is rotated to outwardly, and then identical cleaning is carried out by wiper mechanism 6, complete to two-sided
The cleaning of solar energy electroplax, operating personnel repeat above-mentioned action, and to solar energy electroplax, all cleaning finishes, and closing control case, completes
Operation.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 4：
As shown in Fig. 1 ~ 11, when cleaning the solar energy electroplax in use, the solar energy electroplax in use is generally slightly slant setting,
This decontamination plant is fallen down to place, upper flat plate 1 and lower flat board 4 is in front and back position, adjustment driven pulley 2 is open towards side,
Side outwardly, is rolling function, cleaning sponge 18 is turned out, upset is extremely concordant with driven pulley 2, and external water pipe is connected
Main water inlet tube 182 is connected to, the drive device that driving driving wheel 5 rolls is opened, allows this decontamination plant free and regular
Mobile, the cleaning sponge 8 concordant with driven pulley 2 is cleaned to solar energy electroplax surface dirt, spot etc., its cleaning performance
Good, driven pulley 2 and the edge of driving wheel 5 are provided with infrared detection, and this decontamination plant can be avoided to drop or collide.For large area
Power generation region, often put for the connection of polylith solar energy electroplax, now this decontamination plant can be cleaned continuously and automatically, can be very big
Cleaning cost is reduced, and the operation to operating personnel requires low, effectively reduces manpower consumption, reduces cost of labor, when all clear
The control cabinet for turning off this decontamination plant is washed into, easy to operate, cleaning efficiency is high.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Pujiang County frontlighting Science and Technology Ltd.
<120>The mechanical decontamination plant of solar energy electroplax
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 102
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Gln Asp
1 5 10 15
Asn Ala Tyr Ala Ser Ala Ile Pro Arg Asp Cys His Gly Gly Thr Cys
20 25 30
Glu Gly Ile Cys Ala Asp Ala Thr Ala Thr Met Asp Arg Tyr Ser Asp
35 40 45
Thr Gly Gly Pro Leu Ser Thr Ala Arg Cys Val Asn Ala Phe His Phe
50 55 60
Tyr Lys Arg Arg Gly Glu Glu Asn Val Ser Tyr Lys Pro Phe Val Ser
65 70 75 80
His Trp Lys Tyr Gly Val Ala Cys Phe Tyr Thr His Cys Gly Pro Asn
85 90 95
Phe Cys Cys Cys Ile Ser
100
Claims (7)
1. the mechanical decontamination plant of solar energy electroplax, including disk（11）With pass through support frame（3）With disk（11）Under connection
Flat board（4）, it is characterised in that：Described disk（11）Surrounding is connected with upper flat plate（1）, described upper flat plate（1）Lateral wall connects
It is connected to driven pulley（2）, described support frame（3）Lower flat board arranged in a crossed manner for two, described（4）Surrounding is connected with driving wheel
（5）, described lower flat board（4）Bottom surface is provided centrally with motor（7）, described lower flat board（4）Bottom surface surrounding is connected with clearly
Washing machine structure（6）.
2. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described disk（11）Four
Week connects transverse slat by expansion link（9）, described transverse slat（9）Upper end is provided with micromachine（8）, described micromachine（8）'s
Output shaft（10）Through transverse slat（9）Connect upper flat plate（1）.
3. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described support frame（3）
Upper end is fixedly connected on disk（11）The fixed block of bottom surface（12）, described support frame（3）Lower end is connected to lower flat board（4）On
The sliding block of bottom surface（15）.
4. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described upper flat plate（1）
Bottom surface is connected with cleaning sponge by rotating shaft（18）, described cleaning sponge（18）Upper end is hardhead sponge（181）Material, it is described
Cleaning sponge（18）Lower end is soft sponge（183）Material, described hardhead sponge（181）Inside is embedded with main water inlet tube（182）, institute
The soft sponge stated（183）Inside is embedded with outlet pipe（184）, described main water inlet tube（182）And outlet pipe（184）Between by soft
The seal of tube connects.
5. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described motor（7）'s
Rotating shaft（16）Through lower flat board（4）, described rotating shaft（16）Pass through connecting rod（17）Connection sliding block（15）, described sliding block（15）
Can be in circular chute（14）Interior motion.
6. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described driven pulley（2）
Including the support ring positioned at both sides（201）, described support ring（201）Between be connected with rubber（203）, described rubber
（203）Inside is provided with space of caving in（202）, described driven pulley（2）One side closed and center is connected with fixture（204）, institute
The driven pulley stated（2）Opposite side is opening and opening edge edge is connected with sealing ring.
7. the mechanical decontamination plant of solar energy electroplax according to claim 1, it is characterised in that：Described driving wheel（5）
Structure and driven pulley（2）Unanimously, described driving wheel（5）It is connected to power drive unit, described driven pulley（2）It is connected to and sets
Have rotating shaft and can 90 ° bending connectors.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957605.3A CN107824496A (en) | 2017-10-16 | 2017-10-16 | The mechanical decontamination plant of solar energy electroplax |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957605.3A CN107824496A (en) | 2017-10-16 | 2017-10-16 | The mechanical decontamination plant of solar energy electroplax |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107824496A true CN107824496A (en) | 2018-03-23 |
Family
ID=61648060
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710957605.3A Withdrawn CN107824496A (en) | 2017-10-16 | 2017-10-16 | The mechanical decontamination plant of solar energy electroplax |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107824496A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111545501A (en) * | 2020-04-19 | 2020-08-18 | 高茹 | Solar panel system |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN204912146U (en) * | 2015-07-13 | 2015-12-30 | 上海新孚美变速箱技术服务有限公司 | A universal cleaning equipment for refabrication of automatic transmission casing |
| KR20160033615A (en) * | 2014-09-16 | 2016-03-28 | 성균관대학교산학협력단 | Solar cell cleaning robot and cleaning method using the same |
| CN205436449U (en) * | 2016-01-07 | 2016-08-10 | 浙江谷高光伏科技有限公司 | Improved generation solar energy polycrystal silicon chip cleaning equipment |
| CN205490378U (en) * | 2016-03-10 | 2016-08-17 | 山东豪沃电气有限公司 | Automatic equipment that cleans of solar cell panel |
| CN105966490A (en) * | 2016-06-29 | 2016-09-28 | 青岛萨纳斯智能科技股份有限公司 | Walking device of solar panel cleaning robot |
-
2017
- 2017-10-16 CN CN201710957605.3A patent/CN107824496A/en not_active Withdrawn
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160033615A (en) * | 2014-09-16 | 2016-03-28 | 성균관대학교산학협력단 | Solar cell cleaning robot and cleaning method using the same |
| CN204912146U (en) * | 2015-07-13 | 2015-12-30 | 上海新孚美变速箱技术服务有限公司 | A universal cleaning equipment for refabrication of automatic transmission casing |
| CN205436449U (en) * | 2016-01-07 | 2016-08-10 | 浙江谷高光伏科技有限公司 | Improved generation solar energy polycrystal silicon chip cleaning equipment |
| CN205490378U (en) * | 2016-03-10 | 2016-08-17 | 山东豪沃电气有限公司 | Automatic equipment that cleans of solar cell panel |
| CN105966490A (en) * | 2016-06-29 | 2016-09-28 | 青岛萨纳斯智能科技股份有限公司 | Walking device of solar panel cleaning robot |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111545501A (en) * | 2020-04-19 | 2020-08-18 | 高茹 | Solar panel system |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN105852731B (en) | Based on all-electric system to the cleaning method of glass window | |
| CN206786597U (en) | It is a kind of can automated cleaning solar panels solar street light | |
| CN105880244B (en) | A kind of cleaning method of solar panel | |
| CN209715851U (en) | A kind of solar panels cleaning plant | |
| CN108856152A (en) | A kind of new-energy automobile solar panel cleaning apparatus for self | |
| KR20160142570A (en) | Solar cell cleaning robot tracking on rail of solar cell | |
| CN201791632U (en) | Power recovering device of power spraying room | |
| CN107819436A (en) | A kind of wind-proof photovoltaic power generation equipment of efficiency high of removing sand for desert | |
| CN110048667A (en) | A kind of dust-extraction unit that automatically tracks and remove the snow for photovoltaic power generation plate | |
| CN104113278A (en) | Self-cleaning solar-energy photovoltaic assembly | |
| CN107824498A (en) | A kind of solar energy electroplax cleaning device | |
| CN112161341A (en) | Zigbee-based air purification equipment for smart home | |
| CN107824496A (en) | The mechanical decontamination plant of solar energy electroplax | |
| CN109259272A (en) | The sterilization integrated equipment of cleaning, drying | |
| CN209627312U (en) | A kind of solar energy photovoltaic panel possessing self-cleaning function | |
| CN106491053A (en) | A kind of plug-type ceiling wiping arrangement | |
| CN203872125U (en) | Combination rotation disc type cleaning device for photovoltaic assembly | |
| CN108566153A (en) | A kind of photovoltaic plant cleaning apparatus for self | |
| CN215773030U (en) | Self-cleaning solar cell panel | |
| CN205762843U (en) | For cleaning the device of solar energy photovoltaic panel | |
| CN209659212U (en) | A kind of solar energy photovoltaic panel with regulatory function | |
| CN108906748A (en) | Glass sunlight house cleaning machine | |
| CN108729391A (en) | A kind of energy-saving and environment-friendly compact road sweeper device | |
| CN202235139U (en) | High-rising building outer layer glass washing device | |
| CN208401792U (en) | A kind of cleaning device of solar panels |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180323 |
|
| WW01 | Invention patent application withdrawn after publication |