CN107824498B - Solar panel belt cleaning device - Google Patents
Solar panel belt cleaning device Download PDFInfo
- Publication number
- CN107824498B CN107824498B CN201710957584.5A CN201710957584A CN107824498B CN 107824498 B CN107824498 B CN 107824498B CN 201710957584 A CN201710957584 A CN 201710957584A CN 107824498 B CN107824498 B CN 107824498B
- Authority
- CN
- China
- Prior art keywords
- cleaning
- flat plate
- sponge
- solar panel
- solar
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
- 238000004140 cleaning Methods 0.000 title claims abstract description 132
- 230000007246 mechanism Effects 0.000 claims abstract description 23
- 229920001971 elastomer Polymers 0.000 claims description 21
- 239000005060 rubber Substances 0.000 claims description 21
- 238000005406 washing Methods 0.000 claims description 21
- 239000000463 material Substances 0.000 claims description 9
- 238000007789 sealing Methods 0.000 claims description 9
- 230000008093 supporting effect Effects 0.000 claims description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 19
- 230000000694 effects Effects 0.000 description 10
- 238000009434 installation Methods 0.000 description 10
- 238000005096 rolling process Methods 0.000 description 10
- 230000009471 action Effects 0.000 description 6
- 238000001179 sorption measurement Methods 0.000 description 6
- 238000012423 maintenance Methods 0.000 description 5
- 238000005507 spraying Methods 0.000 description 5
- 238000010521 absorption reaction Methods 0.000 description 4
- 238000007796 conventional method Methods 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 239000006057 Non-nutritive feed additive Substances 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000006229 carbon black Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 244000043261 Hevea brasiliensis Species 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- 230000003712 anti-aging effect Effects 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 239000000428 dust Substances 0.000 description 2
- 230000005611 electricity Effects 0.000 description 2
- 238000011086 high cleaning Methods 0.000 description 2
- 229920003052 natural elastomer Polymers 0.000 description 2
- 229920001194 natural rubber Polymers 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 235000002639 sodium chloride Nutrition 0.000 description 2
- 230000001360 synchronised effect Effects 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 1
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 1
- ISCYZXFOCXWUJU-KZVJFYERSA-N Ala-Thr-Met Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(O)=O ISCYZXFOCXWUJU-KZVJFYERSA-N 0.000 description 1
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 1
- RWDVGVPHEWOZMO-GUBZILKMSA-N Arg-Cys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCNC(N)=N)C(O)=O RWDVGVPHEWOZMO-GUBZILKMSA-N 0.000 description 1
- QQEWINYJRFBLNN-DLOVCJGASA-N Asn-Ala-Phe Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 QQEWINYJRFBLNN-DLOVCJGASA-N 0.000 description 1
- AKEBUSZTMQLNIX-UWJYBYFXSA-N Asn-Ala-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N AKEBUSZTMQLNIX-UWJYBYFXSA-N 0.000 description 1
- KVMPVNGOKHTUHZ-GCJQMDKQSA-N Asp-Ala-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KVMPVNGOKHTUHZ-GCJQMDKQSA-N 0.000 description 1
- ILJQISGMGXRZQQ-IHRRRGAJSA-N Asp-Arg-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ILJQISGMGXRZQQ-IHRRRGAJSA-N 0.000 description 1
- IAMNNSSEBXDJMN-CIUDSAMLSA-N Asp-Cys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)N IAMNNSSEBXDJMN-CIUDSAMLSA-N 0.000 description 1
- JJQGZGOEDSSHTE-FOHZUACHSA-N Asp-Thr-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JJQGZGOEDSSHTE-FOHZUACHSA-N 0.000 description 1
- UXUSHQYYQCZWET-WDSKDSINSA-N Cys-Glu-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O UXUSHQYYQCZWET-WDSKDSINSA-N 0.000 description 1
- ZMWOJVAXTOUHAP-ZKWXMUAHSA-N Cys-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N ZMWOJVAXTOUHAP-ZKWXMUAHSA-N 0.000 description 1
- VFGADOJXRLWTBU-JBDRJPRFSA-N Cys-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N VFGADOJXRLWTBU-JBDRJPRFSA-N 0.000 description 1
- KLKYKPXITJBSNI-CIUDSAMLSA-N Gln-Met-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O KLKYKPXITJBSNI-CIUDSAMLSA-N 0.000 description 1
- KUBFPYIMAGXGBT-ACZMJKKPSA-N Gln-Ser-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KUBFPYIMAGXGBT-ACZMJKKPSA-N 0.000 description 1
- QQLBPVKLJBAXBS-FXQIFTODSA-N Glu-Glu-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O QQLBPVKLJBAXBS-FXQIFTODSA-N 0.000 description 1
- SABZDFAAOJATBR-QWRGUYRKSA-N Gly-Cys-Phe Chemical compound [H]NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SABZDFAAOJATBR-QWRGUYRKSA-N 0.000 description 1
- QITBQGJOXQYMOA-ZETCQYMHSA-N Gly-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QITBQGJOXQYMOA-ZETCQYMHSA-N 0.000 description 1
- SCJJPCQUJYPHRZ-BQBZGAKWSA-N Gly-Pro-Asn Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O SCJJPCQUJYPHRZ-BQBZGAKWSA-N 0.000 description 1
- HFPVRZWORNJRRC-UWVGGRQHSA-N Gly-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN HFPVRZWORNJRRC-UWVGGRQHSA-N 0.000 description 1
- GWCJMBNBFYBQCV-XPUUQOCRSA-N Gly-Val-Ala Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O GWCJMBNBFYBQCV-XPUUQOCRSA-N 0.000 description 1
- LOXMWQOKYBGCHF-JBDRJPRFSA-N Ile-Cys-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O LOXMWQOKYBGCHF-JBDRJPRFSA-N 0.000 description 1
- SVZFKLBRCYCIIY-CYDGBPFRSA-N Ile-Pro-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SVZFKLBRCYCIIY-CYDGBPFRSA-N 0.000 description 1
- LECIJRIRMVOFMH-ULQDDVLXSA-N Lys-Pro-Phe Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 LECIJRIRMVOFMH-ULQDDVLXSA-N 0.000 description 1
- 241000237524 Mytilus Species 0.000 description 1
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- AEEQKUDWJGOFQI-SRVKXCTJSA-N Phe-Cys-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N AEEQKUDWJGOFQI-SRVKXCTJSA-N 0.000 description 1
- DBNGDEAQXGFGRA-ACRUOGEOSA-N Phe-Tyr-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CCCCN)C(=O)O)N DBNGDEAQXGFGRA-ACRUOGEOSA-N 0.000 description 1
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- NOWXWJLVGTVJKM-PBCZWWQYSA-N Thr-Asp-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O NOWXWJLVGTVJKM-PBCZWWQYSA-N 0.000 description 1
- KWTRGSQOQHZKIA-PMVMPFDFSA-N Trp-Lys-Tyr Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)CCCCN)C(O)=O)C1=CC=C(O)C=C1 KWTRGSQOQHZKIA-PMVMPFDFSA-N 0.000 description 1
- VSYROIRKNBCULO-BWAGICSOSA-N Tyr-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)O VSYROIRKNBCULO-BWAGICSOSA-N 0.000 description 1
- RYHUIHUOYRNNIE-NRPADANISA-N Val-Ser-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RYHUIHUOYRNNIE-NRPADANISA-N 0.000 description 1
- KRAHMIJVUPUOTQ-DCAQKATOSA-N Val-Ser-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KRAHMIJVUPUOTQ-DCAQKATOSA-N 0.000 description 1
- HWNYVQMOLCYHEA-IHRRRGAJSA-N Val-Ser-Tyr Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N HWNYVQMOLCYHEA-IHRRRGAJSA-N 0.000 description 1
- 108010045350 alanyl-tyrosyl-alanine Proteins 0.000 description 1
- 108010041407 alanylaspartic acid Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 108010047495 alanylglycine Proteins 0.000 description 1
- 150000001413 amino acids Chemical group 0.000 description 1
- 239000010692 aromatic oil Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229920006235 chlorinated polyethylene elastomer Polymers 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000013016 damping Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000004134 energy conservation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 239000002803 fossil fuel Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 108010036413 histidylglycine Proteins 0.000 description 1
- 108010092114 histidylphenylalanine Proteins 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000005381 potential energy Methods 0.000 description 1
- 238000010248 power generation Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000005201 scrubbing Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 229920003048 styrene butadiene rubber Polymers 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
Images
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/30—Cleaning by methods involving the use of tools by movement of cleaning members over a surface
- B08B1/32—Cleaning by methods involving the use of tools by movement of cleaning members over a surface using rotary cleaning members
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/10—Cleaning by methods involving the use of tools characterised by the type of cleaning tool
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/02—Cleaning by the force of jets or sprays
Landscapes
- Cleaning In General (AREA)
- Photovoltaic Devices (AREA)
- Cleaning By Liquid Or Steam (AREA)
Abstract
The invention provides a solar panel cleaning device, which belongs to the technical field of solar cleaning and comprises an upper flat plate and a lower flat plate connected with the upper flat plate through a support frame, wherein driven wheels are connected with the periphery of the upper flat plate, the support frame is arranged in a crossed manner, driving wheels are connected with the periphery of the lower flat plate, a motor is arranged in the center of the lower bottom surface of the lower flat plate, and a cleaning mechanism is connected with the periphery of the lower bottom surface of the lower flat plate. The cross-arranged support frames can be driven by a motor to rotate, so that continuous cleaning of the solar panel can be realized; the cleaning mechanism can move up and down and left and right to clean comprehensively, the operation of the cleaning mechanism is controlled by the control box, the cleaning is accurate and quick, the cleaning time is obviously saved, and the cleaning loss of solar energy is reduced. The cleaning device is simple in structure, can continuously clean the solar panel, and is low in cleaning cost.
Description
Technical Field
The invention belongs to the technical field of solar cleaning, and particularly relates to a solar panel cleaning device.
Background
Living creatures formed from the earth live mainly with heat and light provided by the sun, and ancient mankind also knows to sun-dry things and to serve as a method of preserving food, such as salt making and salted fish. However, with the reduction of fossil fuels, solar energy is intentionally developed further. The solar energy is used in two modes, passive utilization (photothermal conversion) and photoelectric conversion. Solar power generation is an emerging renewable energy source. Solar energy in a broad sense is a source of much energy on earth, such as wind energy, chemical energy, potential energy of water, and so on. The solar cell is an electromagnetic type that generates electricity by using energy of sunlight. Compared with common batteries and recyclable rechargeable batteries, the solar battery belongs to a green product with more energy conservation and environmental protection.
The solar cell module exposed outdoors is easy to accumulate dust, so that the lighting effect is influenced, the conversion efficiency is reduced, and the solar cell module must be cleaned in time. Traditional solar panels of photovoltaic power stations are cleaned mainly by manual scrubbing. The cleaning process of the method is relatively complicated and the efficiency is low.
And also adopt the manual work to install earlier washing in the solar energy electroplax installation, this cleaning method has not only increased artifical intensity of labour, still reduces work efficiency, and also easily leads to the damage of solar energy electroplax because of manual operation during the washing, so how can simply effectually carry out the washing of solar cell panel installation earlier to and convenient carry out the later maintenance washing, become very important to solar energy industry development.
Disclosure of Invention
The invention aims to provide a solar panel cleaning device which is suitable for cleaning a solar panel before installation, has high cleaning quality and high reliability, greatly reduces the labor intensity of workers, has high efficiency and can realize continuous cleaning.
The invention also aims to provide a solar panel cleaning device which is suitable for cleaning and using the solar panel, has simple structure, can automatically clean in a rolling way, has high cleaning efficiency and high reliability and causes little damage to the solar panel.
The scheme adopted by the invention for solving the technical problems is as follows: the utility model provides a solar energy electroplax belt cleaning device, includes the last flat board and passes through the lower flat board of support frame and last dull and stereotyped connection, goes up the flat board and is connected with from the driving wheel all around, and the support frame is two cross arrangement, and lower flat board is connected with the action wheel all around, and bottom surface center is provided with the motor under the lower flat board, and bottom surface is connected with wiper mechanism all around under the lower flat board. The cross-arranged support frames can be driven by a motor to rotate, so that continuous cleaning of the solar panel can be realized; the cleaning mechanism can move up and down and left and right to clean comprehensively, the operation of the cleaning mechanism is controlled by the control box, the cleaning is accurate and quick, the cleaning time is obviously saved, and the cleaning loss of solar energy is reduced. The cleaning device is simple in structure, can continuously clean the solar panel, and is low in cleaning cost.
In order to optimize the above technical solution, the measures further include: the upper end of the support frame is fixedly connected with the fixed block on the lower bottom surface of the upper flat plate, and the lower end of the support frame is connected with the sliding block on the upper bottom surface of the lower flat plate. A rotating shaft of the motor penetrates through the lower flat plate, the rotating shaft is connected with a sliding block through a connecting rod, and the sliding block can move in the circular slide way. The motor is rotatory, orders about the slider through the pivot and rotates, and the rotation of slider drives the support frame and takes place rotatoryly, so make and rotate with the last flat board of support frame upper end rigid coupling, adsorb in last flat board solar energy electroplax all around also along with it rotates, so can realize the continuity of solar energy electroplax and wash.
Preferably, the periphery of the upper bottom surface of the upper flat plate is connected with a cleaning sponge through a rotating shaft, the upper end of the cleaning sponge is made of hard sponge materials, the lower end of the cleaning sponge is made of soft sponge materials, a main water inlet pipe is embedded in the hard sponge, a water outlet pipe is embedded in the soft sponge, and the main water inlet pipe and the water outlet pipe are connected in a sealing mode through hoses. The cleaning sponge is suitable for cleaning the solar panel, the solar panel is not easy to damage, water spraying and wiping can be synchronously performed, and the cleaning effect is obviously improved. The hard sponge has a supporting effect on the cleaning sponge, the pressure between the cleaning sponge and the solar panel is increased, the cleaning effect is improved, the soft sponge is in direct contact with the solar panel, the hardness of the soft sponge is low, the damage to the solar panel is small, and the cleaning sponge and the solar panel cooperate with each other to ensure that the cleaning force is proper by matching the pressure transmitted by the hard sponge; main inlet tube passes through the hose with intaking and transmits for a plurality of outlet pipes, outlet pipe export water direction is towards the solar energy electroplax direction, the pressure of hard sponge transmission, make the pressure increase of the water that the outlet pipe jetted, thereby make the washing sponge demonstrate unexpected effect to getting rid of the stubborn stain on solar energy electroplax surface, embedded a plurality of outlet pipes, realized spraying water and the synchronous go on of cleaning, the cleaning performance who has showing and having improved the solar energy electroplax, reduce and wash the required time.
Preferably, the driven wheel comprises support rings positioned on two sides, rubber is connected between the support rings, an invagination space is arranged in the rubber, one side of the driven wheel is closed, the center of the driven wheel is connected with a fixing piece, and the other side of the driven wheel is provided with an opening and the edge of the opening is connected with a sealing ring. The support rings on the two sides increase the strength of the side surface of the driven wheel, so that the rolling requirement is met; the rubber connected between the support rings increases the side flexibility of the driven wheel, and avoids scraping the solar panel due to excessive hardness of the driven wheel; the interior invagination space that establishes of rubber, and follow driving wheel one side and seal, one side opening for follow driving wheel left and right sides direction formation similar sucking disc's space, and because the compliance of rubber, can simply discharge air in the invagination space, the vacuum space of formation makes by the firm fixed of adsorbed object. This from driving wheel not only can realize the action of rolling, still has the absorption function for this belt cleaning device can realize the absorption washing and the self-propelled roll washing of solar energy electroplax, is applicable to the installation of solar energy electroplax and washs in earlier stage and later maintenance washs, has enlarged this belt cleaning device's application scope, improves this device's utilization ratio.
Preferably, the driving wheel structure is consistent with the driven wheel, the driving wheel is connected with the power driving device, and the driven wheel is connected with the connecting piece which is provided with a rotating shaft and can be bent by 90 degrees. The driving wheel is connected with the driving device, when the solar panel after installation is cleaned, the device is laterally placed, and the solar panel is cleaned by the driving wheel driving device; from the driving wheel connection with the connecting piece, when the installation washs independent solar energy electroplax earlier stage, the adjustment connecting piece makes from the driving wheel opening outwards, adsorbs the solar energy electroplax and washs, and when wasing the solar energy electroplax of later maintenance, the adjustment connecting piece makes from driving wheel opening towards one side, and the side outwards realizes the gyro wheel function, carries out automatic roll washing.
Preferably, the periphery of the lower bottom surface of the lower flat plate is provided with a crossed slide way, and a cleaning mechanism is embedded in the crossed slide way. The wiper mechanism can remove in the crossing slide for wash comprehensively, the wiper mechanism include with embedded sliding block in the crossing slide, the bottom plate that can stretch out and draw back from top to bottom is connected to the sliding block, the bottom plate is connected through telescopic link that can stretch out and draw back from beginning to end and is washd the case, can realize wasing the case and wash the different position of solar energy electroplax, has improved work efficiency, alleviates artifical intensity of labour.
Compared with the prior art, the cleaning device has the beneficial effects that 1) the cleaning device has simple structure, can realize continuous cleaning of the solar panel and has low cleaning cost; 2) the cleaning sponge is suitable for the cleaning force of the solar electric plate, the solar electric plate is not easy to damage, the cleaning sponge can spray water and clean synchronously, the cleaning effect is obviously improved by 3), the driven wheel can realize rolling action, and the cleaning sponge also has an adsorption function, so that the cleaning sponge can realize adsorption cleaning and self-rolling cleaning of the solar electric plate, and the application range of the cleaning sponge is enlarged.
The solar panel cleaning device provided by the invention adopts the technical scheme, overcomes the defects of the prior art, and is reasonable in design and convenient to operate.
Drawings
FIG. 1 is a schematic structural view of the present invention;
FIG. 2 is a schematic top view of the top plate of the present invention;
FIG. 3 is a bottom view of the upper plate of the present invention;
FIG. 4 is a bottom view of the lower plate of the present invention;
FIG. 5 is a schematic top view of the lower plate of the present invention;
FIG. 6 is a cross-sectional view of a cleaning sponge of the present invention;
FIG. 7 is a right side view of the driven wheel of the present invention;
FIG. 8 is a front view of the driven wheel of the present invention;
FIG. 9 is a left side elevational view of the driven wheel of the present invention;
FIG. 10 is a schematic view of the connector of the present invention at 180;
figure 11 is a schematic view of a connector of the present invention at 90.
Description of reference numerals: 1, putting a flat plate; 2, a driven wheel; 201 supporting a ring; 202 an invaginated space; 203 rubber; 204 a fixing member; 3, supporting a frame; 4, a lower flat plate; 5, driving wheels; 6, cleaning the mechanism; 7, a motor; 8, cleaning the sponge; 801 hard sponge; 802 a main water inlet pipe; 803 a soft sponge; 804 water outlet pipe; 9, fixing blocks; 10 a cross-type slide; 11, a circular slideway; 12, a sliding block; 13 a rotating shaft; 14 connecting the rods.
Detailed Description
The following is described in further detail with reference to the accompanying drawings and examples:
example 1:
as shown in fig. 1-11, a solar panel cleaning device, including last dull and stereotyped 1 and the lower dull and stereotyped 4 of being connected with last dull and stereotyped 1 through support frame 3, it is connected with from driving wheel 2 to go up dull and stereotyped 1 all around, it is connected with washing sponge 8 through the pivot all around to go up dull and stereotyped 1 bottom surface, 8 upper ends of washing sponge are hard sponge 801 material, wash sponge 8 lower extreme and be soft sponge 803 material, hard sponge 801 is inside to be inlayed and to have main inlet tube 802, soft sponge 803 is inside to be inlayed and to have outlet pipe 804, through hose sealing connection between main inlet tube 802 and the outlet. The support frame 3 is two crossing arrangement, and 3 upper ends of support frame fixed connection in the fixed block 9 of upper plate 1 lower bottom surface, 3 lower extremes of support frame connect in the slider 12 of lower plate 4 upper bottom surface. The periphery of the lower flat plate 4 is connected with a driving wheel 5, the center of the lower bottom surface of the lower flat plate 4 is provided with a motor 7, a rotating shaft 13 of the motor 7 penetrates through the lower flat plate 4, the rotating shaft 13 is connected with a sliding block 12 through a connecting rod 14, and the sliding block 12 can move in a circular slideway 11. The driven wheel 2 comprises support rings 201 located on two sides, rubber 203 is connected between the support rings 201, an invagination space 202 is arranged inside the rubber 203, one side of the driven wheel 2 is closed, the center of the driven wheel is connected with a fixing piece 204, and the other side of the driven wheel 2 is provided with an opening and the edge of the opening is connected with a sealing ring. The structure of the driving wheel 5 is consistent with that of the driven wheel 2, the driving wheel 5 is connected with the power driving device, and the driven wheel 2 is connected with a connecting piece which is provided with a rotating shaft and can be bent by 90 degrees. The periphery of the lower bottom surface of the lower flat plate 4 is connected with a cleaning mechanism 6. The periphery of the lower bottom surface of the lower flat plate 4 is provided with a crossed slideway 10, and a cleaning mechanism 6 is embedded in the crossed slideway 10.
The cleaning device has a simple structure, can realize continuous cleaning of the solar panel, and has low cleaning cost; the cleaning sponge 8 is suitable for cleaning the solar electric plate, the solar electric plate is not easy to damage, water spraying and cleaning can be achieved synchronously, the cleaning effect is remarkably improved, rolling action can be achieved from the driving wheel 2, the cleaning sponge also has an adsorption function, the cleaning sponge can achieve adsorption cleaning and self-rolling cleaning of the solar electric plate, and the application range of the cleaning sponge is enlarged.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
Example 2:
as shown in fig. 1 to 11, a solar panel cleaning device comprises an upper flat plate 1 and a lower flat plate 4 connected with the upper flat plate 1 through a support frame 3, wherein the periphery of the upper flat plate 1 is connected with driven wheels 2, the support frames 3 are arranged in a crossed manner, the periphery of the lower flat plate 4 is connected with driving wheels 5, a motor 7 is arranged at the center of the lower bottom surface of the lower flat plate 4, and the periphery of the lower bottom surface of the lower flat plate 4 is connected with a cleaning mechanism 6. The supporting frames 3 which are arranged in a crossed manner can be driven by the motor 7 to rotate, so that continuous cleaning of the solar panel can be realized; the cleaning mechanism 6 can move up and down and left and right to perform comprehensive cleaning, the operation of the cleaning mechanism is controlled by the control box, the cleaning is accurate and quick, the cleaning time is obviously saved, and the cleaning loss of solar energy is reduced. The cleaning device is simple in structure, can continuously clean the solar panel, and is low in cleaning cost.
The upper end of the support frame 3 is fixedly connected with a fixed block 9 on the lower bottom surface of the upper flat plate 1, and the lower end of the support frame 3 is connected with a slide block 12 on the upper bottom surface of the lower flat plate 4. A rotating shaft 13 of the motor 7 penetrates through the lower flat plate 4, the rotating shaft 13 is connected with a sliding block 12 through a connecting rod 14, and the sliding block 12 can move in the circular slide rail 11. The motor 7 rotates, the rotating shaft 13 drives the sliding block 12 to rotate, the rotating of the sliding block 12 drives the supporting frame 3 to rotate, so that the upper flat plate 1 fixedly connected with the upper end of the supporting frame 3 rotates, and the solar electric plates adsorbed on the periphery of the upper flat plate 1 also rotate along with the rotation of the upper flat plate 1, so that continuous cleaning of the solar electric plates can be realized.
Go up dull and stereotyped 1 upper base surface and be connected with washing sponge 8 through the pivot all around, wash 8 upper ends of sponge and be hard sponge 801 materials, wash 8 lower extremes of sponge and be soft sponge 803 materials, hard sponge 801 is inside to be inlayed and to have main inlet tube 802, and soft sponge 803 is inside to be inlayed and to have outlet pipe 804, passes through hose sealing connection between main inlet tube 802 and the outlet pipe 804. The cleaning sponge 8 is suitable for cleaning the solar panel, the solar panel is not easy to damage, water spraying and wiping can be achieved synchronously, and the cleaning effect is obviously improved. The hard sponge 801 has a supporting effect on the cleaning sponge 8, the pressure between the cleaning sponge 8 and the solar panel is increased, the cleaning effect is improved, the soft sponge 803 is in direct contact with the solar panel, the hardness of the soft sponge 803 is low, the damage to the solar panel is small, and the cleaning force is proper due to the cooperation of the pressure transmitted by the hard sponge 801 and the pressure transmitted by the soft sponge 803; main inlet tube 802 passes through the hose with the intaking and transmits for a plurality of outlet pipes 804, outlet pipe 804 exports the water direction and faces the solar energy electroplax direction, the pressure of hard sponge 801 transmission, make the pressure increase of the water that outlet pipe 804 jetted, thereby make washing sponge 8 demonstrate unexpected effect to getting rid of the stubborn stain on solar energy electroplax surface, a plurality of embedded outlet pipes 804, realized spraying water and the synchronous go on of cleaning, the cleaning performance who has showing and having improved the solar energy electroplax, reduce and wash required time.
The driven wheel 2 comprises support rings 201 located on two sides, rubber 203 is connected between the support rings 201, an invagination space 202 is arranged inside the rubber 203, one side of the driven wheel 2 is closed, the center of the driven wheel is connected with a fixing piece 204, and the other side of the driven wheel 2 is provided with an opening and the edge of the opening is connected with a sealing ring. The support rings 201 on both sides increase the strength of the side surface of the driven wheel 2, so that the rolling requirement is met; the rubber 203 connected between the support rings 201 increases the side flexibility of the driven wheel 2, and avoids scraping the solar panel by the too high hardness of the driven wheel 2; the invagination space 202 is arranged in the rubber 203, one side of the driven wheel 2 is closed, and one side of the driven wheel is opened, so that a space similar to a sucker is formed in the left and right directions of the driven wheel 2, air in the invagination space 202 can be simply discharged due to the flexibility of the rubber 203, and the formed vacuum space enables an adsorbed object to be firmly fixed. This from driving wheel 2 not only can realize the action of rolling, still has the absorption function for this belt cleaning device can realize the absorption washing and the self-propelled roll washing of solar energy electroplax, is applicable to the installation of solar energy electroplax and washs in earlier stage and later maintenance washs, has enlarged this belt cleaning device's application scope, improves this device's utilization ratio.
The rubber 203 is a modified natural rubber material and comprises the following components in parts by weight: 15-22 parts of natural rubber, 5-7 parts of styrene-butadiene rubber, 18-24 parts of chlorinated polyethylene rubber, 15-20 parts of carbon black, 4-6 parts of argil, 7-10 parts of aromatic oil, 1-2.5 parts of an anti-aging agent, 0.1-0.15 part of a processing aid, 2.2-3.5 parts of zinc oxide, 0.8-1.3 parts of an accelerator and 0.11-0.18 part of a co-crosslinking agent, wherein the anti-aging agent, the accelerator and the co-crosslinking agent are purchased conventionally in the market, the processing aid is active polypeptide, and the amino acid sequence of the active polypeptide is as follows: TDHQMAQSACIGVSQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKRRGEENVSYKPFVVSHWKYGVAGCFYTHCGPNFCCCIS, the rubber 203 with the above components has good ozone resistance and aging resistance, and ideal tear strength, the addition of the processing aid can change the surface structures of the carbon black and the argil, promote the compatibility of the carbon black and the argil with functional groups of other components, improve the mechanical characteristics of the rubber 203, and improve the stability of the molecular structure in the rubber 203, so that the prepared rubber has excellent aging resistance, and the rubber has good elasticity, high structural density of molecules and good sealing performance, so that the driven wheel 2 has excellent adsorption performance, and the reliability of a cleaning device is improved.
The structure of the driving wheel 5 is consistent with that of the driven wheel 2, the driving wheel 5 is connected with the power driving device, and the driven wheel 2 is connected with a connecting piece which is provided with a rotating shaft and can be bent by 90 degrees. The driving wheel 5 is connected with a driving device, when the solar panel after installation is cleaned, the device is laterally placed, and the driving wheel 5 drives the device to move for cleaning; from driving wheel 2 and being connected with the connecting piece, when the installation washs independent solar energy electroplax earlier stage, the adjustment connecting piece makes from driving wheel 2 openings outwards, adsorbs the solar energy electroplax and washs, and when wasing the solar energy electroplax of later maintenance, the adjustment connecting piece makes from driving wheel 2 openings towards one side, and the side outwards realizes the gyro wheel function, carries out automatic roll washing.
Above-mentioned connecting piece is similar damping pivot structure, and two independent poles overlap the department and be equipped with the pivot for two independent poles can rotate around the pivot, and are equipped with the screens piece in pivot 90 and 180 departments, make two independent poles can carry out 90 rotation regulation, realize from the switching of 2 adsorption function of driving wheel and roll function.
The periphery of the lower bottom surface of the lower flat plate 4 is provided with a crossed slideway 10, and a cleaning mechanism 6 is embedded in the crossed slideway 10. Wiper mechanism 6 can remove in crossing slide 10 for wash comprehensively, wiper mechanism 6 include with embedded sliding block in crossing slide 10, the bottom plate that can stretch out and draw back from top to bottom is connected to the sliding block, the bottom plate through the telescopic link connection washing case that can stretch out and draw back around, can realize wasing the case and wash the different positions of solar energy electroplax, has improved work efficiency, alleviates artifical intensity of labour.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
Example 3:
as shown in fig. 1 to 11, when cleaning the solar panel before installation, the working principle is as follows: the cleaning device is vertically placed and fixed, the upper flat plate 1 and the lower flat plate 4 are positioned at the upper position and the lower position, the driven wheel 2 is adjusted to have an opening facing outwards, the control box connected with the motor 7 and the cleaning mechanism 6 is opened, the motor 7 and the cleaning mechanism 6 work at regular time, an operator stands at one side of the device, a solar electric plate to be cleaned is adsorbed on the driven wheel 2 and fixed, the cleaning mechanism 6 automatically cleans the solar electric plate, the motor 7 rotates to enable the support frame 3 to rotate, further the upper flat plate 1 adsorbed with the solar electric plate is driven to rotate, the surface of the other side of the upper flat plate 1, which is not adsorbed with the solar electric plate, is rotated to the position where the operator stands, the operator continues to adsorb and fix the solar electric plate on the cleaning device, the operation is repeatedly carried out until the first adsorbed and cleaned solar electric plate rotates to the position where the operator stands, and the operator takes off the cleaned solar electric plate, the solar panel that treats the washing in the change continues work, and operating personnel only need get and put the solar panel, and easy operation, artifical consumption is low, and belt cleaning device can wash polylith solar panel simultaneously, and the cleaning efficiency is high, and operating personnel repeats above-mentioned action and finishes to the whole washing of solar panel, closes the control box, accomplishes the operation.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
Example 4:
as shown in fig. 1 to 11, when cleaning a solar panel in use, the solar panel in use is generally placed in a slightly inclined manner, the cleaning device is placed upside down, the upper flat plate 1 and the lower flat plate 4 are positioned at front and rear positions, the opening of the driven wheel 2 is adjusted to face one side, the side face faces outwards, the cleaning sponge 8 is made to have a rolling function, the cleaning sponge 8 is rotated outwards and is turned to be flush with the driven wheel 2, an external water pipe is connected to the main water inlet pipe 802, and the driving device for driving the driving wheel 5 to roll is opened, so that the cleaning device can freely and regularly move, dust, stains and the like on the surface of the solar panel are cleaned by the cleaning sponge 8 flush with the driven wheel 2, the cleaning effect is good, infrared detection is arranged at the edges of the driven wheel 2 and the driving wheel 5, and the cleaning device. To large tracts of land electricity generation region, often connect for polylith solar energy electroplax and put, this belt cleaning device can wash automatically in succession this moment, can greatly reduce the cleaning cost, and low to operating personnel's operating requirement, effectively reduce the artifical consumption, reduce the cost of labor, accomplish when whole wash make close this belt cleaning device's control box can, easy and simple to handle, the cleaning efficiency is high.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
The above embodiments are merely illustrative, and not restrictive, and those skilled in the art can make various changes and modifications without departing from the spirit and scope of the invention. Therefore, all equivalent technical solutions also belong to the scope of the present invention, and the protection scope of the present invention should be defined by the claims.
Sequence listing
<110> sea salt Patep science and technology Limited
<120> a solar energy electroplax belt cleaning device
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 105
<212> PRT
<213> Artificial Synthesis (Mytilus corescuus)
<400> 1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Gln Asp
1 5 10 15
Asn Ala Tyr Ala Ser Ala Ile Pro Arg Asp Cys His Gly Gly Lys Thr
20 25 30
Cys Glu Gly Ile Cys Ala Asp Ala Thr Ala Thr Met Asp Arg Tyr Ser
35 40 45
Asp Thr Gly Gly Pro Leu Ser Thr Ala Arg Cys Val Asn Ala Phe His
50 55 60
Phe Tyr Lys Arg Arg Gly Glu Glu Asn Val Ser Tyr Lys Pro Phe Val
65 70 75 80
Val Ser His Trp Lys Tyr Gly Val Ala Gly Cys Phe Tyr Thr His Cys
85 90 95
Gly Pro Asn Phe Cys Cys Cys Ile Ser
100 105
Claims (4)
1. The utility model provides a solar energy electroplax belt cleaning device, includes last flat board (1) and lower dull and stereotyped (4) of being connected through support frame (3) and last flat board (1), its characterized in that: the periphery of the upper flat plate (1) is connected with driven wheels (2), the two supporting frames (3) are arranged in a crossed manner, the periphery of the lower flat plate (4) is connected with driving wheels (5), the center of the lower bottom surface of the lower flat plate (4) is provided with a motor (7), and the periphery of the lower bottom surface of the lower flat plate (4) is connected with a cleaning mechanism (6); the upper end of the support frame (3) is fixedly connected with a fixed block (9) on the lower bottom surface of the upper flat plate (1), and the lower end of the support frame (3) is connected with a sliding block (12) on the upper bottom surface of the lower flat plate (4); a rotating shaft (13) of the motor (7) penetrates through the lower flat plate (4), the rotating shaft (13) is connected with a sliding block (12) through a connecting rod (14), and the sliding block (12) can move in the circular slide way (11); go up dull and stereotyped (1) go up the bottom surface and be connected with washing sponge (8) through the pivot all around, washing sponge (8) upper end be hard sponge (801) material, washing sponge (8) lower extreme be soft sponge (803) material, hard sponge (801) inside embedded main inlet tube (802), soft sponge (803) inside embedded outlet pipe (804), main inlet tube (802) and outlet pipe (804) between through hose sealing connection.
2. The solar panel cleaning apparatus of claim 1, wherein: follow driving wheel (2) including support ring (201) that are located both sides, support ring (201) between be connected with rubber (203), rubber (203) inside be equipped with invagination space (202), follow driving wheel (2) one side seal and the center is connected with mounting (204), follow driving wheel (2) opposite side be the opening and the opening border is connected with the sealing washer.
3. The solar panel cleaning apparatus of claim 1, wherein: the structure of the driving wheel (5) is consistent with that of the driven wheel (2), the driving wheel (5) is connected with the power driving device, and the driven wheel (2) is connected with a connecting piece which is provided with a rotating shaft and can be bent by 90 degrees.
4. The solar panel cleaning apparatus of claim 1, wherein: the lower plate (4) is provided with cross type slide ways (10) on the periphery of the lower bottom surface, and cleaning mechanisms (6) are embedded in the cross type slide ways (10).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957584.5A CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710957584.5A CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107824498A CN107824498A (en) | 2018-03-23 |
| CN107824498B true CN107824498B (en) | 2020-12-22 |
Family
ID=61648093
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710957584.5A Expired - Fee Related CN107824498B (en) | 2017-10-16 | 2017-10-16 | Solar panel belt cleaning device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107824498B (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109494166A (en) * | 2018-11-13 | 2019-03-19 | 惠州西电仲恺人工智能联合创新实验室有限公司 | The online vision detection system of solar panel |
| CN114999115A (en) * | 2022-05-26 | 2022-09-02 | 中国地质大学（武汉） | Remote maintenance-free geological deformation and slumping early warning device |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101779667B1 (en) * | 2014-09-16 | 2017-09-20 | 성균관대학교산학협력단 | Solar cell cleaning robot and cleaning method using the same |
| CN204912146U (en) * | 2015-07-13 | 2015-12-30 | 上海新孚美变速箱技术服务有限公司 | A universal cleaning equipment for refabrication of automatic transmission casing |
| CN205436449U (en) * | 2016-01-07 | 2016-08-10 | 浙江谷高光伏科技有限公司 | Improved generation solar energy polycrystal silicon chip cleaning equipment |
| CN205490378U (en) * | 2016-03-10 | 2016-08-17 | 山东豪沃电气有限公司 | Automatic equipment that cleans of solar cell panel |
| CN105966490A (en) * | 2016-06-29 | 2016-09-28 | 青岛萨纳斯智能科技股份有限公司 | Walking device of solar panel cleaning robot |
-
2017
- 2017-10-16 CN CN201710957584.5A patent/CN107824498B/en not_active Expired - Fee Related
Also Published As
| Publication number | Publication date |
|---|---|
| CN107824498A (en) | 2018-03-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN204710743U (en) | A kind of photovoltaic panel cleaning device | |
| CN209550098U (en) | A kind of photovoltaic intelligent power station photovoltaic clearing apparatus | |
| CN202516814U (en) | Intelligent automatic cleaning system of solar panel | |
| CN208466620U (en) | A kind of photovoltaic battery panel clean robot | |
| CN211191089U (en) | Vegetable agricultural greenhouse | |
| CN108856152A (en) | A kind of new-energy automobile solar panel cleaning apparatus for self | |
| CN208853310U (en) | A kind of photovoltaic panel surface cleaning system | |
| CN207339780U (en) | A kind of automatically cleaning solar panel | |
| CN208840114U (en) | A kind of solar cell module automatic dust removing apparatus | |
| KR20160142570A (en) | Solar cell cleaning robot tracking on rail of solar cell | |
| CN115913082B (en) | Solar photovoltaic device | |
| CN105773572A (en) | Photovoltaic intelligent dust and snow removing robot | |
| CN107824498B (en) | Solar panel belt cleaning device | |
| CN206859538U (en) | A kind of solar energy rain shade that can clear up dedusting automatically | |
| CN204866683U (en) | Automatic cleaning device of warmhouse booth | |
| CN205851439U (en) | Mobile photovoltaic module cleaning device | |
| CN111006175A (en) | Solar street lamp of adjustable solar cell panel angle | |
| CN104113278A (en) | Self-cleaning solar-energy photovoltaic assembly | |
| CN210965991U (en) | Photovoltaic power plant dust removal brush | |
| CN209020845U (en) | A kind of hand-held photovoltaic module Special cleaning tool | |
| CN209415313U (en) | One kind having self-cleaning solar street light | |
| CN203724031U (en) | Environment-friendly cleaning device for glass curtain wall of high-rise building | |
| CN205762708U (en) | Solar panel dust arrester | |
| CN205413855U (en) | Frame -type photovoltaic cleans machine people | |
| CN209413748U (en) | A kind of show window convenient for cleaning |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20201222 |
|
| CF01 | Termination of patent right due to non-payment of annual fee |