WO2023014128A1 - Api5에 특이적으로 결합하는 항체 및 이의 용도 - Google Patents
Api5에 특이적으로 결합하는 항체 및 이의 용도 Download PDFInfo
- Publication number
- WO2023014128A1 WO2023014128A1 PCT/KR2022/011593 KR2022011593W WO2023014128A1 WO 2023014128 A1 WO2023014128 A1 WO 2023014128A1 KR 2022011593 W KR2022011593 W KR 2022011593W WO 2023014128 A1 WO2023014128 A1 WO 2023014128A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- antibody
- antigen
- api5
- binding fragment
- Prior art date
Links
- 230000027455 binding Effects 0.000 title claims abstract description 85
- 239000000427 antigen Substances 0.000 claims abstract description 84
- 102000036639 antigens Human genes 0.000 claims abstract description 84
- 108091007433 antigens Proteins 0.000 claims abstract description 84
- 239000012634 fragment Substances 0.000 claims abstract description 68
- 208000016691 refractory malignant neoplasm Diseases 0.000 claims abstract description 13
- 206010028980 Neoplasm Diseases 0.000 claims description 65
- 210000004027 cell Anatomy 0.000 claims description 54
- 201000011510 cancer Diseases 0.000 claims description 52
- 108090000623 proteins and genes Proteins 0.000 claims description 52
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 40
- 102000004169 proteins and genes Human genes 0.000 claims description 40
- 239000013598 vector Substances 0.000 claims description 39
- 238000000034 method Methods 0.000 claims description 36
- 125000003729 nucleotide group Chemical group 0.000 claims description 24
- 239000002773 nucleotide Substances 0.000 claims description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims description 20
- 150000007523 nucleic acids Chemical class 0.000 claims description 18
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 16
- 108020004707 nucleic acids Proteins 0.000 claims description 16
- 102000039446 nucleic acids Human genes 0.000 claims description 16
- 229940088872 Apoptosis inhibitor Drugs 0.000 claims description 7
- 230000001093 anti-cancer Effects 0.000 claims description 7
- 239000000158 apoptosis inhibitor Substances 0.000 claims description 7
- 108091006086 inhibitor proteins Proteins 0.000 claims description 7
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 6
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 6
- 201000010881 cervical cancer Diseases 0.000 claims description 6
- 239000003937 drug carrier Substances 0.000 claims description 5
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 4
- 201000005202 lung cancer Diseases 0.000 claims description 4
- 208000020816 lung neoplasm Diseases 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 3
- 208000000453 Skin Neoplasms Diseases 0.000 claims description 3
- 201000000849 skin cancer Diseases 0.000 claims description 3
- 206010000830 Acute leukaemia Diseases 0.000 claims description 2
- 206010061424 Anal cancer Diseases 0.000 claims description 2
- 208000007860 Anus Neoplasms Diseases 0.000 claims description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 claims description 2
- 206010005003 Bladder cancer Diseases 0.000 claims description 2
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 2
- 206010006187 Breast cancer Diseases 0.000 claims description 2
- 208000026310 Breast neoplasm Diseases 0.000 claims description 2
- 208000006332 Choriocarcinoma Diseases 0.000 claims description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 2
- 206010023825 Laryngeal cancer Diseases 0.000 claims description 2
- 206010025323 Lymphomas Diseases 0.000 claims description 2
- 208000032271 Malignant tumor of penis Diseases 0.000 claims description 2
- 208000003445 Mouth Neoplasms Diseases 0.000 claims description 2
- 208000010505 Nose Neoplasms Diseases 0.000 claims description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 2
- 206010033128 Ovarian cancer Diseases 0.000 claims description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 2
- 208000002471 Penile Neoplasms Diseases 0.000 claims description 2
- 206010034299 Penile cancer Diseases 0.000 claims description 2
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 claims description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 2
- 206010035610 Pleural Neoplasms Diseases 0.000 claims description 2
- 206010060862 Prostate cancer Diseases 0.000 claims description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 2
- 206010038389 Renal cancer Diseases 0.000 claims description 2
- 201000000582 Retinoblastoma Diseases 0.000 claims description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 claims description 2
- 206010057644 Testis cancer Diseases 0.000 claims description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 2
- 230000001154 acute effect Effects 0.000 claims description 2
- 201000005188 adrenal gland cancer Diseases 0.000 claims description 2
- 201000011165 anus cancer Diseases 0.000 claims description 2
- 201000009036 biliary tract cancer Diseases 0.000 claims description 2
- 208000020790 biliary tract neoplasm Diseases 0.000 claims description 2
- 208000024207 chronic leukemia Diseases 0.000 claims description 2
- 208000029742 colonic neoplasm Diseases 0.000 claims description 2
- 201000004101 esophageal cancer Diseases 0.000 claims description 2
- 206010017758 gastric cancer Diseases 0.000 claims description 2
- 201000010982 kidney cancer Diseases 0.000 claims description 2
- 206010023841 laryngeal neoplasm Diseases 0.000 claims description 2
- 208000032839 leukemia Diseases 0.000 claims description 2
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 claims description 2
- 201000007270 liver cancer Diseases 0.000 claims description 2
- 208000014018 liver neoplasm Diseases 0.000 claims description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 2
- 201000001441 melanoma Diseases 0.000 claims description 2
- 208000037830 nasal cancer Diseases 0.000 claims description 2
- 201000002528 pancreatic cancer Diseases 0.000 claims description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 2
- 201000008006 pharynx cancer Diseases 0.000 claims description 2
- 201000003437 pleural cancer Diseases 0.000 claims description 2
- 208000037968 sinus cancer Diseases 0.000 claims description 2
- 206010062261 spinal cord neoplasm Diseases 0.000 claims description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 claims description 2
- 201000011549 stomach cancer Diseases 0.000 claims description 2
- 201000003120 testicular cancer Diseases 0.000 claims description 2
- 201000002510 thyroid cancer Diseases 0.000 claims description 2
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 2
- 208000034578 Multiple myelomas Diseases 0.000 claims 1
- 201000002314 small intestine cancer Diseases 0.000 claims 1
- 230000014509 gene expression Effects 0.000 abstract description 18
- 208000037819 metastatic cancer Diseases 0.000 abstract description 6
- 208000011575 metastatic malignant neoplasm Diseases 0.000 abstract description 6
- 201000009030 Carcinoma Diseases 0.000 abstract description 5
- 206010038111 Recurrent cancer Diseases 0.000 abstract description 5
- 238000002560 therapeutic procedure Methods 0.000 abstract description 4
- 102100039986 Apoptosis inhibitor 5 Human genes 0.000 abstract description 3
- 101000959871 Homo sapiens Apoptosis inhibitor 5 Proteins 0.000 abstract description 3
- 238000011275 oncology therapy Methods 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 37
- 238000011282 treatment Methods 0.000 description 28
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 15
- 235000001014 amino acid Nutrition 0.000 description 15
- 229940024606 amino acid Drugs 0.000 description 12
- 150000001413 amino acids Chemical group 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- 239000013604 expression vector Substances 0.000 description 11
- 238000011160 research Methods 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 238000011224 anti-cancer immunotherapy Methods 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 238000009169 immunotherapy Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 238000006467 substitution reaction Methods 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 108020004705 Codon Proteins 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 5
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 5
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 5
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 5
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- 230000006907 apoptotic process Effects 0.000 description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 5
- 238000002869 basic local alignment search tool Methods 0.000 description 5
- -1 by codon degeneracy Chemical class 0.000 description 5
- 238000012790 confirmation Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 101150112774 Api5 gene Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 230000010782 T cell mediated cytotoxicity Effects 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 238000011394 anticancer treatment Methods 0.000 description 4
- 230000001747 exhibiting effect Effects 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 230000026731 phosphorylation Effects 0.000 description 4
- 238000006366 phosphorylation reaction Methods 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 102100035769 Apoptotic chromatin condensation inducer in the nucleus Human genes 0.000 description 3
- 101710139767 Apoptotic chromatin condensation inducer in the nucleus Proteins 0.000 description 3
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 2
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 2
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960003852 atezolizumab Drugs 0.000 description 2
- 229950002916 avelumab Drugs 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 238000002619 cancer immunotherapy Methods 0.000 description 2
- 229960005091 chloramphenicol Drugs 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000012063 dual-affinity re-targeting Methods 0.000 description 2
- 229950009791 durvalumab Drugs 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000006058 immune tolerance Effects 0.000 description 2
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229950007213 spartalizumab Drugs 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- SXOUIMVOMIGLHO-AATRIKPKSA-N (E)-3-(indol-2-yl)acrylic acid Chemical compound C1=CC=C2NC(/C=C/C(=O)O)=CC2=C1 SXOUIMVOMIGLHO-AATRIKPKSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 101710106450 Apoptosis inhibitor 5 Proteins 0.000 description 1
- 101100059333 Arabidopsis thaliana CYCA1-2 gene Proteins 0.000 description 1
- 102000004452 Arginase Human genes 0.000 description 1
- 108700024123 Arginases Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 102000003952 Caspase 3 Human genes 0.000 description 1
- 108090000397 Caspase 3 Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 1
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102100032484 Down syndrome critical region protein 8 Human genes 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 208000001976 Endocrine Gland Neoplasms Diseases 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 241000696272 Gull adenovirus Species 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101001016533 Homo sapiens Down syndrome critical region protein 8 Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101001055145 Homo sapiens Interleukin-2 receptor subunit beta Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 101001059991 Homo sapiens Mitogen-activated protein kinase kinase kinase kinase 1 Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 101001102797 Homo sapiens Transmembrane protein PVRIG Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 1
- 101100321817 Human parvovirus B19 (strain HV) 7.5K gene Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100026879 Interleukin-2 receptor subunit beta Human genes 0.000 description 1
- 102000042838 JAK family Human genes 0.000 description 1
- 108091082332 JAK family Proteins 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102100028199 Mitogen-activated protein kinase kinase kinase kinase 1 Human genes 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 206010028570 Myelopathy Diseases 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 229940044606 RIG-I agonist Drugs 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 206010039897 Sedation Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 102100039630 Transmembrane protein PVRIG Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 239000012670 alkaline solution Substances 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000000611 antibody drug conjugate Substances 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 229940049595 antibody-drug conjugate Drugs 0.000 description 1
- 230000005904 anticancer immunity Effects 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 229950007712 camrelizumab Drugs 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229940067219 cetrelimab Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000001246 colloidal dispersion Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- 238000009109 curative therapy Methods 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000001973 epigenetic effect Effects 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 102000045823 human API5 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 229940126546 immune checkpoint molecule Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000007944 immunity cancer cycle Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- PLVPPLCLBIEYEA-UHFFFAOYSA-N indoleacrylic acid Natural products C1=CC=C2C(C=CC(=O)O)=CNC2=C1 PLVPPLCLBIEYEA-UHFFFAOYSA-N 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007916 intrasternal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000029559 malignant endocrine neoplasm Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 244000309459 oncolytic virus Species 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000036280 sedation Effects 0.000 description 1
- 229940121497 sintilimab Drugs 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
Definitions
- the present invention was made by the grant number 2019M3A9A8066884 under the support of the Ministry of Science and ICT of the Republic of Korea, and the research management institution for the above task is the National Research Foundation of Korea, the research project name is “Bio.Medical Technology Development (R&D)”, and the research project name is “Immune Establishment of an efficacy evaluation system for an API5 target antibody innovative new drug to overcome lung cancer refractory to checkpoint inhibitory antibody treatment”, the host institution is Korea University, and the research period is 2019.06.01-2020.12.31.
- the present invention relates to antibodies or antigen-binding fragments thereof that specifically bind to API5, and uses thereof. More specifically, it relates to an antibody or antigen-binding fragment thereof that specifically binds to API5, and cancer treatment uses thereof.
- a major cause of these clinical challenges is related to the acquisition of resistance by cancer cells to anti-cancer immunotherapy. Therefore, in order to improve the efficiency of cancer treatment, research on overcoming cancer resistance and research on targeting methods are required.
- the cancer immunity cycle which is a series of processes in which a cancer cell-specific T cell immune response is formed, must be smoothly formed. These processes include 1) tumor apoptosis and exposure of tumor antigens, 2) presentation of tumor antigens by antigen-presenting cells, 3) induction of tumor antigen-specific T cell generation by antigen-presenting cells, and 4) induction of tumor antigen T cells into tumor sites. migration, 5) penetration into tumors, and 6) cancer cell recognition and apoptosis induction cycles.
- API5 Apoptosis inhibitor protein 5
- NANOG immune tolerance-inducing factor 5
- Inhibition of API5 may reduce cancer immunotherapy resistance and recurrence. Therefore, there is a need to develop an antibody or binding fragment thereof capable of overcoming immune resistance and increasing the efficiency of anti-cancer immunotherapy by specifically binding to API5.
- the present inventors have made intensive research efforts to develop target antibodies for the treatment of resistant cancer, recurrent cancer after anticancer treatment, or metastatic cancer.
- the present invention was completed by developing a novel antibody or antigen-binding fragment thereof that specifically binds to API5 (Apoptosis inhibitor protein 5), whose expression is increased in various carcinomas.
- API5 Apoptosis inhibitor protein 5
- an object of the present invention is to provide an antibody or antigen-binding fragment thereof that specifically binds to API5 (Apoptosis inhibitor protein 5) protein.
- Another object of the present invention is to provide a nucleic acid molecule comprising a nucleotide sequence encoding the antibody or antigen-binding fragment thereof.
- Another object of the present invention is to provide a recombinant vector comprising the nucleic acid molecule.
- Another object of the present invention is to provide a host cell containing the recombinant vector.
- Another object of the present invention is to provide a pharmaceutical composition for treating cancer comprising an antibody or antigen-binding fragment thereof that specifically binds to the API5 protein.
- Another object of the present invention is to provide a method for treating cancer comprising the step of administering an antibody or antigen-binding fragment thereof that specifically binds to the API5 protein, or the pharmaceutical composition for treating cancer to a subject in need of treatment. .
- the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to API5 (Apoptosis inhibitor protein 5) protein.
- API5 Apoptosis inhibitor protein 5
- the present inventors have made intensive research efforts to develop target antibodies for the treatment of resistant cancer, recurrent cancer after anticancer treatment, or metastatic cancer. As a result, a novel antibody or antigen-binding fragment thereof that specifically binds to API5 (apoptosis inhibitor protein 5), whose expression is increased in various carcinomas, was developed.
- API5 apoptosis inhibitor protein 5
- API5 Apoptosis inhibitor protein 5
- AAC-11 Cancer Res. 1997, 57(18):4063-9
- API5 gene has been reported to be involved in increased cancer survival in several cancer cells. Through physical binding with Acinus (ACIN1), it inhibits the induction of apoptosis through Acinus-mediated DNA fragmentation and blocks the activity of Caspase-3, an apoptotic protein. It is known (EMBO J. 2009, 28(11):1576-88).
- primary cancer refers to a normal cancer
- recurrent cancer refers to a cancer that has recurred after conventional cancer treatment
- resistant cancer exhibits extremely low sensitivity to the cancer treatment and is not suitable for the treatment. It means cancer that does not show improvement, alleviation, alleviation, or curative symptoms by
- conventional cancer treatment may include surgery, chemotherapy, radiation therapy, hormone therapy, biological therapy, immunotherapy, and the like, but is not limited thereto.
- metalastatic cancer is used in the same sense as “cancer metastasis” or “metastatic cancer”, and means that a primary cancer or recurrent cancer that has occurred in a specific site has metastasized to another site.
- the antibody or antigen-binding fragment thereof that specifically binds to the API5 protein is a) CDR (complementarity determining region) -H (Heavy chain) 1 comprising the amino acid sequence of SEQ ID NO: 1; a heavy chain variable region comprising CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2 and CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3; and b) light chain (CDR-L)1 comprising the amino acid sequence of SEQ ID NO: 4, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 5, and CDR-L3 comprising the amino acid sequence of SEQ ID NO: 6. It may be an antibody or an antigen-binding fragment thereof comprising a light chain variable region, but is not limited thereto.
- the antibody or antigen-binding fragment thereof is each derived from clone 3F2 derived from the human antibody library selected in Examples of the present invention, but is not limited thereto.
- the antibody or antigen-binding fragment thereof is an antibody or antigen thereof comprising a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8 It may be a binding fragment, but is not limited thereto.
- the API5 protein is human-derived API5 protein or mouse-derived API5 protein, but is not limited thereto.
- the antibody or antigen-binding fragment thereof binds to an epitope present in the API5 polypeptide or rhAPI5 polypeptide represented by any one of the amino acid sequences of SEQ ID NOs: 17 to 18.
- amino acid sequence of SEQ ID NO: 17 represents the human-derived API5 protein.
- amino acid sequence of SEQ ID NO: 18 represents a full-length recombinant human API15 (rhAPI5) polypeptide.
- amino acid sequence is listed in the sequence listing attached to this specification, and is shown in Table 1 below.
- the framework sequence of the variable region of the antibody or antigen-binding fragment thereof is derived from a human-derived framework sequence or a mouse-derived framework sequence, but is not limited thereto.
- the antibody or antigen-binding fragment thereof is a monoclonal antibody, polyclonal antibody, scFv, Fab, F (ab), F (including the heavy chain variable region and the light chain variable region) ab)2, scFv-Fc, minibody, diabody, triabody, tetrabody, bibody, multispecific antibody, human antibody, humanized antibody, chimeric antibody, or antigen-binding fragment thereof, but is not limited thereto no.
- Antibodies of the present invention can be generated using various phage display methods known in the art [Brinkman et al., 1995, J. Immunol. Methods, 182:41-50]; [Ames et al., 1995, J. Immunol. Methods, 184, 177-186]; [Kettleborough et al. 1994, Eur. J. Immunol, 24, 952-958]; [Persic et al., 1997, Gene, 187, 9-18]; and [Burton et al., 1994, Adv.
- antibody refers to an antibody specific to the API5 protein, and includes a complete antibody form as well as an antigen binding fragment of an antibody molecule.
- a complete antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain is linked to the heavy chain by disulfide bonds.
- the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types, and subclasses include gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), and gamma 3 ( ⁇ 3). ), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) and alpha 2 ( ⁇ 2).
- the constant region of the light chain has kappa and lambda types (Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA (1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4, pp. 45-65, Sinauer Associates, Inc., Sunderland, MA (1984)).
- the term "antigen-binding fragment” refers to a fragment having an antigen-binding function, such as Fab, F(ab'), F(ab') 2 , chemically linked F(ab') 2 and Fv, etc. includes Among antibody fragments, Fab has a structure having variable regions of light and heavy chains, constant regions of light chains, and a first constant region (CH1) of heavy chains, and has one antigen-binding site. Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
- the F(ab') 2 antibody is produced by forming a disulfide bond between cysteine residues in the hinge region of Fab'.
- Fv is a minimal antibody fragment having only the heavy chain variable region and the light chain variable region. Recombinant technology for generating Fv fragments is described in PCT International Publication Patent Applications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 and WO 88/09344.
- the heavy chain variable region and the light chain variable region are connected by a non-covalent bond
- the heavy chain variable region and the short chain variable region are generally shared through a peptide linker.
- antibody fragments are linked by bonds or directly linked at the C-terminus, so that they can form a dimer-like structure like double-chain Fv.
- Such antibody fragments can be obtained using proteolytic enzymes (for example, restriction digestion of whole antibodies with papain yields Fab and digestion with pepsin yields F(ab') 2 fragments), or It can be produced through genetic recombination technology.
- the antibody is specifically scFv form or complete antibody form.
- the heavy chain constant region may be selected from any one isotype of gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) or epsilon ( ⁇ ).
- the constant regions are gamma 1 (IgG1), gamma 2 (IgG2), gamma 3 (IgG3) and gamma 4 (IgG4).
- the light chain constant region may be of the kappa or lambda type, specifically kappa type.
- the term “heavy chain” refers to a full-length heavy chain comprising a variable region domain VH and three constant region domains CH1, CH2 and CH3 comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen and a full-length heavy chain thereof I mean all fragments.
- the term "light chain” as used herein refers to both a full-length light chain and fragments thereof comprising a variable region domain VL and a constant region domain CL comprising an amino acid sequence having sufficient variable region sequence to impart specificity to an antigen.
- CDR complementarity determining region
- HVR hypervariable region
- the heavy chains (CDR-H1, CDR-H2, and CDR-H3) and light chains (CDR-L1, CDR-L2, and CDR-L3) each contain three CDRs. CDRs provide key contact residues for antibody binding to an antigen or epitope.
- the antibody or antigen-binding fragment thereof is a full-length or intact polyclonal or monoclonal antibody, as well as antigen-binding fragments thereof (eg, Fab, Fab', F(ab')2, Fab3 , Fv and variants thereof), fusion proteins comprising one or more antibody portions, humanized antibodies, minibodies, diabodies, triabodies, tetrabodies, linear antibodies, single chain antibodies (scFv), scFv-Fc, bipartite Specific antibodies, multispecific antibodies, other modified configurations of immunoglobulin molecules containing antigen recognition sites of the required specificity include glycosylation variants of antibodies, amino acid sequence variants of antibodies and covalently modified antibodies.
- antigen-binding fragments thereof eg, Fab, Fab', F(ab')2, Fab3 , Fv and variants thereof
- fusion proteins comprising one or more antibody portions, humanized antibodies, minibodies, diabodies, triabodies, tetrabod
- modified antibodies and antigen-binding fragments thereof include nanobodies, AlbudAbs, dual affinity re-targeting (DARTs), bispecific T-cell engagers (BiTEs), tandem diabodies (TandAbs), dual acting Fabs (DAFs), two- These include in-one antibodies, small modular immunopharmaceuticals (SMIPs), fynomers fused to antibodies (FynomAbs), dual variable domain immunoglobulins (DVD-Igs), peptide modified antibodies (CovX-bodies), duobodies and triomAbs.
- SMIPs small modular immunopharmaceuticals
- FynomAbs fused to antibodies
- DVD-Igs dual variable domain immunoglobulins
- CovX-bodies duobodies and triomAbs.
- the list of such antibodies and antigen-binding fragments thereof is not limited to the above.
- FR refers to variable domain residues other than hypervariable region residues.
- the FRs of a variable domain generally consist of four FR domains FR1, FR2, FR3 and FR4.
- HVR and FR sequences generally appear in the following order in VH and VL/VK:
- FRH1 Framework region 1 of heavy chain
- CDRH1-FRH2-CDRH2-FRH3-CDRH3-FRH4 Framework region 1 of heavy chain
- the antibody or antigen-binding fragment may appear in the following order:
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to an antigen.
- the variable domains of the heavy and light chains of native antibodies (VH and VL, respectively) generally have similar structures, each domain having four conserved framework regions (FR) and three hypervariable regions (HVR) ).
- FR conserved framework regions
- HVR hypervariable regions
- a single VH or VL domain may be sufficient to confer antigen-binding specificity.
- an antibody that binds to a particular antigen can be separated using a VH or VL domain from an antibody that binds the antigen and screens a library of complementary VL or VH domains, respectively.
- the term "specifically binds" or the like means that an antibody or antigen-binding fragment thereof, or other construct such as an scFv, forms a complex with an antigen that is relatively stable under physiological conditions. Specific binding is at least about 1 x 10 -6 M or less (eg, 9 x 10 -7 M, 8 x 10 -7 M, 7 x 10 -7 M, 6 x 10 -7 M , 5 x 10 -7 M , 4 x 10 -7 M, 3 x 10 -7 M, 2 x 10 -7 M, or 1 x 10 -7 M), preferably 1 x 10 -7 M or less (eg 9 x 10 -8 M , 8 x 10 -8 M, 7 x 10 -8 M, 6 x 10 -8 M, 5 x 10 -8 M, 4 x 10 -8 M, 3 x 10 -8 M, 2 x 10 -8 M , or 1 x 10 -8 M), more preferably 1 x 10 -8 M or less (eg 9 x
- affinity refers to the strength of the sum of non-covalent interactions between a single binding site of a molecule (eg antibody) and its binding partner (eg antigen).
- binding affinity refers to an intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). indicates The affinity of a molecule Y with its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
- human antibody refers to an amino acid sequence of an antibody produced by a human or a human cell, or an antibody derived from a non-human source that utilizes human antibody repertoires or other human antibody coding sequences. It has the corresponding amino acid sequence. This definition of a human antibody excludes humanized antibodies comprising non-human antigen-binding moieties.
- chimeric antibody means that a portion of the heavy and/or light chain is derived from a particular source or species and the remainder of the heavy and/or light chain is from a different source or species. means an antibody.
- humanized antibody refers to a chimeric immunoglobulin containing minimal sequence derived from a non-human immunoglobulin of a non-human (e.g., mouse, chicken) antibody, an immunoglobulin chain or fragment thereof (e.g., eg Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequence of an antibody).
- a humanized antibody is obtained in which residues of a complementarity-determining region (CDR) of the recipient are selected from a non-human species (donor antibody) having the desired specificity, affinity, and capacity, such as mouse, chicken, rat, or rabbit. It is a human immunoglobulin (recipient antibody) replaced by residues from the CDRs of
- humanized antibodies may contain residues found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further improve and optimize antibody performance.
- the humanized antibody will comprise at least one, and typically both, variable domains in which all or substantially all of the CDR regions correspond to CDR regions of a non-human immunoglobulin, and wherein the FR All or substantially all of the region has the sequence of the FR region of a human immunoglobulin.
- the humanized antibody includes, in an immunoglobulin constant region (Fc region), at least a portion or substantial human immunoglobulin constant region (Fc region) sequence.
- Variants of the antibody or antigen-binding fragment have "substantial similarity", i.e. at least about 90% sequence identity when the two peptide sequences are optimally aligned, such as by the programs GAP or BESTFIT using default gap weights; more preferably means sharing at least about 95%, 98% or 99% sequence identity.
- residue positions that are not identical differ by conservative amino acid substitutions.
- a "conservative amino acid substitution” is one in which an amino acid residue is replaced by another amino acid residue having a side chain (R group) with similar chemical properties (eg, charge or hydrophobicity). In general, conservative amino acid substitutions do not substantially alter the functionality of the protein. Where two or more amino acid sequences differ from each other by conservative substitutions, the percentage or degree of similarity can be adjusted up to correct for the conservative nature of the substitutions.
- amino acid variations are made based on the relative similarity of amino acid side chain substituents, such as hydrophobicity, hydrophilicity, charge, size, etc.
- Analysis of the size, shape and type of amino acid side chain substituents revealed that arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. Accordingly, based on these considerations, arginine, lysine and histidine; alanine, glycine and serine; And phenylalanine, tryptophan and tyrosine are biologically functional equivalents.
- each amino acid is given a hydrophobicity index according to its hydrophobicity and charge: Isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); Tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); Lysine (-3.9); and arginine (-4.5).
- the hydrophobic amino acid index is very important in conferring the interactive biological function of proteins. It is a known fact that amino acids having similar hydrophobicity indexes should be substituted to retain similar biological activities. When a mutation is introduced with reference to the hydrophobicity index, substitution is made between amino acids exhibiting a difference in hydrophobicity index, preferably within ⁇ 2, more preferably within ⁇ 1, and still more preferably within ⁇ 0.5.
- hydrophilicity value When a mutation is introduced by referring to the hydrophilicity value, substitution is made between amino acids exhibiting a difference in hydrophilicity value, preferably within ⁇ 2, more preferably within ⁇ 1, and even more preferably within ⁇ 0.5.
- Amino acid exchanges in proteins that do not entirely alter the activity of the molecule are known in the art (H. Neurath, R.L. Hill, The Proteins, Academic Press, New York, 1979).
- the most commonly occurring exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/ Exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly.
- Antibodies or antigen-binding fragments thereof of the present invention include antibodies or antigen-binding fragments thereof that contain minor changes to the amino acid sequence described above, that is, modifications that hardly affect the tertiary structure and function of the antibody. Thus, in some embodiments, even if they do not match the sequence described above, they may have at least 100%, 93%, 95%, 96%, 97%, or 98% similarity.
- the antibody or antigen-binding fragment thereof of the present invention is a monoclonal antibody, a bispecific antibody, or a multispecific antibody comprising a heavy chain variable region and a light chain variable region comprising the CDRs of the above-described sequence.
- the heavy chain variable region and the light chain variable region included in the antibody or antigen-binding fragment thereof are (Gly-Ser)n, (Gly 2 -Ser)n, (Gly 3 -Ser)n or ( linked by a linker such as Gly 4 -Ser)n.
- n is an integer of 1 to 6, specifically 3 to 4, but is not limited thereto.
- the light chain variable region and heavy chain variable region of the scFv may exist in the following orientation, for example: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the present invention provides a nucleic acid molecule comprising a nucleotide sequence encoding the antibody or antigen-binding fragment thereof that specifically binds to the above-described API5.
- nucleic acid molecule has a meaning comprehensively including DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic building blocks of nucleic acid molecules, are not only natural nucleotides, but also sugars or bases. Also included are analogs where the site is modified (Scheit, Nucleotide Analogs , John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews , 90:543-584 (1990)).
- nucleotide sequence encoding the antibody or antigen-binding fragment thereof of the present invention is sufficient to be a nucleotide sequence encoding the amino acid sequence constituting the antibody or antigen-binding fragment thereof, and is not limited to any specific nucleotide sequence. do.
- nucleotide sequence may be a functionally equivalent codon or a codon encoding the same amino acid (e.g., by codon degeneracy, there are six codons for arginine or serine), or a codon encoding a biologically equivalent amino acid. It includes a nucleotide sequence comprising a.
- the nucleic acid molecule of the present invention encoding the antibody or antigen-binding fragment thereof is construed to include a sequence exhibiting substantial identity therewith.
- the above substantial identity is at least when the sequence of the present invention and any other sequence described above are aligned so as to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art.
- 60% homology such as 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, or 69%)
- 70% homology such as 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%)
- 80% homology e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%)
- 90% homology such as 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
- most specifically a sequence that exhibits at least 95% homology eg, 95%, 96%, 97%, 98%, or 99%. All integers of 60% or more and 100% or less and minor numbers existing therebetween are included within the scope of the present invention with respect to % homology.
- BLAST NCBI Basic Local Alignment Search Tool
- NBCI National Center for Biological Information
- blastp, blastn It can be used in conjunction with sequence analysis programs such as blastx, tblastn and tblastx.
- BLAST is accessible through the BLAST page on the ncbi website. The sequence homology comparison method using this program can be found on the BLAST help page of the ncbi website.
- the heavy chain CDR, light chain CDR, heavy chain variable region, light chain variable region, polypeptide constituting the heavy chain and / or light chain of the antibody or antigen-binding fragment thereof that specifically binds to API5 of the present invention The nucleotide sequence encoding this is listed in the sequence listing attached to this specification, and is also shown in Table 1 above.
- the present invention provides a recombinant vector containing a nucleic acid molecule encoding an antibody or antigen-binding fragment thereof that specifically binds to the above-described API5.
- vector includes transfer vectors and expression vectors.
- delivery vector refers to a composition of matter that contains an isolated nucleic acid and can be used to deliver the isolated nucleic acid into a cell. but is not limited to, linear polynucleotides, polynucleotides linked with ionic or amphiphilic compounds, plasmids and viruses. More specifically, the transfer vector includes an autonomously replicating plasmid or virus. The term should be interpreted as being able to additionally include non-plasmids and non-viral compounds, such as polylysine compounds, liposomes, and the like, that promote transfer of nucleic acids into cells. Viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated viral vectors, retroviral vectors, and lentiviral vectors.
- the term "expression vector” refers to a vector comprising recombinant nucleotides comprising an expression control sequence operably linked to a nucleotide sequence to be expressed in order to express a gene of interest in a host cell.
- An expression vector contains sufficient cis-acting elements for expression, and other elements for expression may be provided by a host cell or an in vitro expression system.
- the expression vector may include a plasmid vector containing a recombinant polynucleotide; cosmid vector; and viral vectors such as bacteriophage vectors, adenoviral vectors, lentiviruses, retroviral vectors and adeno-associated viral vectors.
- the nucleic acid molecule encoding the switch molecule in the vector of the present invention is operatively linked to the promoter of the vector.
- operably linked refers to a functional linkage between a nucleic acid expression control sequence (eg, a promoter, signal sequence, or array of transcriptional regulator binding sites) and another nucleic acid sequence, whereby the regulation The sequence will control the transcription and/or translation of said other nucleic acid sequence.
- a nucleic acid expression control sequence eg, a promoter, signal sequence, or array of transcriptional regulator binding sites
- the recombinant vector system of the present invention can be constructed through various methods known in the art, and specific methods thereof are disclosed in Sambrook et al., Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory Press (2001), , this document is incorporated herein by reference.
- the vector of the present invention can be constructed as a vector for gene cloning, a vector for protein expression, or a vector for gene transfer.
- the vector of the present invention can be constructed using a prokaryotic cell or a eukaryotic cell as a host.
- the vector of the present invention is an expression vector and a eukaryotic cell is used as a host
- a promoter derived from the genome of a mammalian cell e.g., metallothionein promoter, beta-actin promoter, human hemoglobin promoter, and human muscle
- a mammalian virus e.g.
- adenovirus late promoter vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter, tk promoter of HSV, mouse mammary tumor virus (MMTV) promoter, HIV promoter
- the LTR promoter, the promoter of Moloney virus, the promoter of Epstein Barr virus (EBV) and the promoter of Rouss sarcoma virus (RSV) can be used, and usually has a polyadenylation sequence as a transcription termination sequence.
- Vectors of the present invention may be fused with other sequences to facilitate purification of antibodies expressed therefrom.
- Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA).
- the protein expressed by the vector of the present invention is an antibody
- the expressed antibody can be easily purified through a protein A column or the like without an additional sequence for purification.
- the expression vector of the present invention may include a selectable marker gene and/or a reporter gene as a selection marker for evaluating the expression of the antibody or antigen-binding fragment thereof of the present invention and the CAR polypeptide comprising the same.
- Selectable marker genes include antibiotic resistance genes commonly used in the art, for example, for ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. There is a resistance gene. Reporter genes include luciferase, beta-galactosidase, chloramphenicol acetyl transferase, or green fluorescent protein genes.
- Vectors can be readily introduced into host cells, such as mammalian, bacterial, yeast, or insect cells, by methods known in the art.
- vectors can be delivered into host cells by physical, chemical, or biological means.
- the physical means include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
- Such chemical vehicles include colloidal dispersion systems such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- the biological means includes the use of a DNA or RNA vector, such as the above-mentioned lentivirus, retrovirus, or the like.
- the present invention provides an isolated host cell containing a recombinant vector.
- the host cell can be expressed as being transformed by a recombinant vector.
- Any host cell capable of stably and continuously cloning and expressing the vector of the present invention can be used as any host cell known in the art.
- suitable eukaryotic host cells for the vector are yeast (Saccharomyce cerevisiae), insect cells , monkey kidney cells 7 (COS7), NSO cells, SP2/0, Chinese hamster ovary (CHO) cells, W138, baby hamster kidney (BHK) cells, MDCK, myeloma cell line , HuT 78 cells and HEK-293 cells.
- transformed As used herein, the terms “transformed,” “transduced,” or “transfected” refer to a process by which an exogenous nucleic acid is transferred or introduced into a host cell.
- a “transformed”, “transduced” or “transfected” cell is a cell that has been transformed, transduced or transfected with an exogenous nucleic acid, including the cell and progeny cells resulting from its passage. .
- Methods for delivering the vector of the present invention into a host cell include a microinjection method (Capecchi, M.R., Cell, 22:479 (1980)), a calcium phosphate precipitation method (Graham, F.L. et al. , Virology, 52:456 (1973)), electroporation (Neumann, E. et al., EMBO J., 1:841 (1982)), liposome-mediated transfection (Wong, T.K. et al., Gene , 10:87 (1980)), DEAE-dextran treatment (Gopal, Mol.
- vectors can be injected into host cells.
- the recombinant vector contained in the host cell may express the antibody or antigen-binding fragment, or a fusion protein comprising the same, recombined in the host cell, and in this case, a large amount of the antibody or antigen-binding fragment, or fusion get protein.
- the expression vector includes the lac promoter
- gene expression can be induced by treating the host cell with isopropyl-beta-D-thiogalactopyranoside (IPTG).
- the culturing is usually carried out under aerobic conditions, such as by shaking culturing or rotation by a rotator.
- the incubation temperature is preferably in the range of 10 to 40°C, and the incubation time is generally 5 hours to 7 days.
- the pH of the medium is preferably maintained in the range of 3.0 to 9.0 during culture.
- the pH of the medium can be adjusted with inorganic or organic acids, alkaline solutions, urea, calcium carbonate, ammonia, and the like.
- antibiotics such as ampicillin, streptomycin, chloramphenicol, kanamycin, and tetracycline may be added to maintain and express the recombinant vector, if necessary.
- a suitable inducer may be added to the medium, if necessary.
- a suitable inducer may be added to the medium, if necessary.
- the expression vector contains the lac promoter
- IPTG may be added
- the expression vector contains the trp promoter
- indoleacrylic acid may be added to the medium.
- the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising an antibody or antigen-binding fragment thereof that specifically binds to the above-described API5, and a pharmaceutically acceptable carrier to provide.
- the pharmaceutical composition of the present invention uses the above-described antibody or antigen-binding fragment thereof that specifically binds to API5 of the present invention as an active ingredient, the common content between the two is to avoid excessive complexity of the present specification, omit the description.
- the pharmaceutical composition of the present invention uses the above-described antibody or antigen-binding fragment thereof that specifically binds to API5 of the present invention as an active ingredient, it can be usefully used for preventing or treating cancer associated with high expression of API5.
- the cancer of the present invention may be an anticancer immune resistant cancer.
- anti-cancer immune-resistant cancer or “immune-resistant cancer” is used in the same sense as “cancer immunotherapy-resistant cancer”, and refers to a cancer that relapses after anti-cancer treatment by immunotherapy, develops resistance, and has immunosuppressive ability. .
- anti-cancer immunotherapy or “immunotherapy” refers to the integration of all systems in which cancer cells are eliminated by cancer-specific toxic immune cells by inducing an immune response against cancer-specific antigens or cancer-related antigens.
- Methods for inducing immunity to cancer antigens include methods such as genes, proteins, viruses, and dendritic cells.
- the anticancer immunotherapy includes cytokines (eg interferon, GM-CSF, G-CSF, IL-2), CRS-207 immunotherapy, cancer vaccines, monoclonal antibodies, bispecific or multispecific antibodies, antibody drug conjugates , adoptive T cell delivery, Toll receptor agonists, RIG-1 agonists, oncolytic virus therapy, treatment with immunomodulatory small molecules (eg JAK1/2 inhibitors, PI3K ⁇ inhibitors), and checkpoint inhibitors (eg CBL-B, CD20, CD28, CD40, CD70, CD122, CD96, CD73, CD47, CDK2, GITR, CSF1R, JAK, PI3K ⁇ , PI3K ⁇ , TAM, arginase, HPK1, CD137, ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA- 4, inhibitors of immune checkpoint molecules such as LAG3, TIM3, TLR (TLR7/8), TIGIT, CD112R, VISTA,
- the type of cancer of the present invention includes head and neck cancer including brain tumor, spinal cord tumor, retinoblastoma, oral cancer, nasal cancer, sinus cancer, pharynx cancer, laryngeal cancer, and cervical cancer; endocrine cancer, including skin cancer, breast cancer, thyroid cancer, and malignant adrenal tumor; lung cancer, respiratory cancer including pleural tumors; digestive cancers, including esophageal cancer, gastric cancer, malignant tumors of the small intestine, colon cancer, anal cancer, liver cancer, biliary tract cancer, and pancreatic cancer; urinary cancer, including kidney cancer, bladder cancer, prostate cancer, testicular cancer, and penile cancer; gynecological cancer, including cervical cancer, cervical cancer, choriocarcinoma, and ovarian cancer; hematological cancers including acute or chronic leukemia, lymphoma, multiple myelopathy; skin cancer including melanoma, basal cell carcinoma, squamous cell carcinoma; and pediatric cancer
- Pharmaceutically acceptable carriers included in the pharmaceutical composition of the present invention are commonly used in formulation, and include lactose, dextrose, sucrose, sorbitol, mannitol, starch, gum acacia, calcium phosphate, alginate, gelatin, including, but not limited to, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil; it is not going to be
- the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetening agent, a flavoring agent, an emulsifying agent, a suspending agent, a preservative, and the like in addition to the above components.
- a lubricant e.g., a talc, a kaolin, a kaolin, a kaolin, a kaolin, a kaolin, kaolin, kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, manni
- the pharmaceutical composition of the present invention can be administered orally or parenterally, such as intravenous administration, subcutaneous administration, intramuscular administration, intraperitoneal administration, intrathecal administration, intracerebral administration, intrasternal administration, topical administration, intranasal administration, intrapulmonary administration. And it may be administered by intrarectal administration, etc., but is not limited thereto.
- the suitable dosage of the pharmaceutical composition of the present invention varies depending on factors such as formulation method, administration method, patient's age, weight, sex, medical condition, food, administration time, route of administration, excretion rate and reaction sensitivity, A ordinarily skilled physician can readily determine and prescribe dosages effective for the desired treatment or prophylaxis.
- the daily dosage of the pharmaceutical composition of the present invention is 0.0001-100 mg/kg.
- pharmaceutically effective amount means an amount sufficient to prevent or treat the above-mentioned diseases.
- prophylaxis refers to preventive or protective treatment of a disease or disease state.
- treatment refers to reduction, suppression, sedation or eradication of a disease state.
- the pharmaceutical composition of the present invention is prepared in unit dosage form by formulation using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by those skilled in the art. or it may be prepared by incorporating into a multi-dose container.
- the formulation may be in the form of a solution, suspension or emulsion in an oil or aqueous medium, or may be in the form of an extract, powder, suppository, powder, granule, tablet or capsule, and may additionally contain a dispersing agent or stabilizer.
- composition of the present invention may also be used in combination with other pharmaceutically active agents and therapies in addition to the above-mentioned active ingredients.
- the "combination” may be expressed as simultaneous or concomitant administration.
- the pharmaceutical composition of the present invention may further be used in combination with other methods of treating cancer, such as chemotherapy, radiation therapy, tumor-targeted therapy, adjuvant therapy, immunotherapy or surgery.
- Therapeutic agents that can be used in combination with the pharmaceutical composition of the present invention include one or more chemotherapeutic agents known in the art (eg, asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine), one or more targeted therapies (eg bevacizumab, olaparib, PD-1/PD-L1 specific immune checkpoint inhibitors (e.g.
- nivolumab pembrolizumab, atezolizumab, durvalumab, avelumab, semiplimab, atezolizumab, avelumab, tislerizumab, spartalizumab (PDR001), cetreli Mab (JNJ-63723283), Torifalimab (JS001), Camrelizumab (SHR-1210), Scintilimab (IBI308), AB122 (GLS-010), AMP-224, AMP-514/MEDI-0680, BMS936559 , JTX-4014, BGB-108, SHR-1210, MEDI4736, FAZ053, BCD-100, KN035, CS1001, BAT1306, LZM009, AK105, HLX10, SHR-1316, CBT-502(TQB2450), A167(KL-A167) , STI-A101 (ZKAB001), CK-301
- the present invention provides a method for treating cancer comprising the step of administering to a subject in need of treatment a pharmaceutical composition comprising the above-described antibody or antigen-binding fragment thereof as an active ingredient.
- the cancer which is the target disease of the treatment method of the present invention, is as defined in relation to the target disease of the pharmaceutical composition.
- the subject is a mammal or a human.
- the method of treating cancer of the present invention is a method of administering the above-described pharmaceutical composition to a subject, the description of overlapping information is omitted to avoid excessive complexity in the present specification.
- the present invention relates to antibodies or antigen-binding fragments thereof that specifically bind to API5, and uses thereof. Since the antibody or antigen-binding fragment thereof of the present invention has been confirmed to have specific binding to API5, which has increased expression in various carcinomas, it can be applied to treatment of resistant cancer or recurrence or metastatic cancer after anticancer treatment.
- Figure 1 shows a schematic diagram of the humanized antibody production process for API5 target antibody development.
- 2a and 2b show the results of selection of API5 target human antibody 3F2 through human Fab antibody fragment screening.
- Figures 3a and 3b show the result of confirming the binding ability of the API5 target human antibody 3F2 of the present invention with the API5 protein.
- ERK activity ERK phosphorylation
- 5a and 5b show an increase in T cell-mediated apoptosis of cancer cells resistant to anticancer immunity upon treatment with the API5 antibody 3F2 of the present invention.
- Figures 6a and 6b show the results of confirming the anti-cancer immune resistance cancer treatment effect through the administration of the API5 target antibody of the present invention.
- CDR complementarity determining region sequence of the selected 3F2 antibody Heavy chain Light chain CDR-1 GFTFSTYA (SEQ ID NO: 1)
- QSISRY SEQ ID NO: 4
- CDR-2 ISGSGGST SEQ ID NO: 2
- AAS SEQ ID NO: 5
- CDR-3 AKLVLEWQYFSMDH SEQ ID NO: 3
- QQSYSFPWT SEQ ID NO: 6
- the 3F2 antibody had a purity of about 99% or more.
- the K d value was analyzed by ELISA at a total of 8 points including 0 nM and 7 points where the concentration of the 3F2 antibody selected in the above example was serially diluted from 3.125 nM to 200 nM.
- the 3F2 antibody (0, 0.2, 1, 5, and 25 ng/ml) selected in the above example was used as a PD-1/PD-L1 antibody therapy-resistant cancer model, CT26 P3 (colorectal cancer) or TC-1 LP3 (lung cancer). After treatment in cancer cell lines, the level of ERK phosphorylation was confirmed by Western blotting.
- ERK phosphorylation was decreased in a concentration-dependent manner when treated with 3F2 antibody, and at a concentration of 25 ng/ml, compared to 0 ng/ml, it was about 5-fold in CT26 P3 cells and about 10-fold in TC-1 LP3 cells. decrease could be observed.
- CT26 P3 or TC-1 LP3 cell lines were treated with the 3F2 antibody selected in the above example at a concentration of 10 ng/ml for 24 hours.
- Granzyme B a key functional protein for inducing T cell-mediated apoptosis, was delivered to the CT26 P3 or TC-1 LP3 cell lines using BioPORTER lipid-based delivery technique. After about 4 to 6 hours, the degree of apoptosis of cancer cells was confirmed by analyzing the level of active-caspase-3 in cells using flow cytometry equipment.
- balb/c mice (Orient Bio) were subcutaneously inoculated with 1x10 5 CT26 P3 tumor cells per mouse, and 3F2 antibody (200 ug/100 ul) selected in the above example was inoculated every 3 days from the 8th day. ug was intraperitoneally injected 4 times (see FIG. 6a).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들의 용도에 관한 것이다. 본 발명의 항체 또는 이의 항원 결합 단편은 다양한 암종에서 발현이 증가되어 있는 API5에 특이적 결합이 확인되었는 바, 내성암, 항암 치료 후의 재발암, 또는 전이암의 치료 연구 등에 적용될 수 있다.
Description
본 발명은 대한민국 과학기술정보통신부의 지원 하에서 과제번호 2019M3A9A8066884에 의해 이루어진 것으로서, 상기 과제의 연구관리 전문기관은 한국연구재단, 연구사업명은 “바이오.의료기술개발(R&D)”, 연구과제명은 “면역관문 억제 항체치료 불응성 폐암 극복을 위한 API5 표적항체 혁신신약의 유효성 평가 시스템 구축”, 주관기관은 고려대학교, 연구기간은 2019.06.01-2020.12.31 이다.
본 특허출원은 2021년 8월 5일에 대한민국 특허청에 제출된 대한민국 특허출원 제10-2021-0103495호에 대하여 우선권을 주장하며, 상기 특허출원의 개시사항은 본 명세서에 참조로서 삽입된다.
본 발명은 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들의 용도에 관한 것이다. 보다 구체적으로는 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들을 이용한 암의 치료 용도에 관한 것이다.
암의 치료를 위해서는 외과적 수술, 방사선 치료법, 항암제 치료법, 면역치료법 등 다양한 치료 요법이 존재한다. 그 중, 면역관문(immune checkpoint) 인자 PD-1(Programmed cell death protein 1)/PD-L1(Programmed cell death-ligand 1)억제제를 이용한 치료 및 종양 항원 특이 T 세포를 이용한 항암 면역치료는 타 항암 치료 요법에 비해 성공적인 임상효과로 주목받고 있으나 여전히 반응성이 낮고 재발률이 높은 한계점이 있다.
이러한 임상적 난제의 주요 원인은 항암 면역치료에 대한 암세포의 내성 획득과 관련된다. 따라서 암 치료 효율 증진을 위해서는 암의 내성 극복에 대한 연구 및 표적 방법에 대한 연구가 필요하다.
성공적인 항암 면역치료 반응 도출을 위해서는 암세포 특이적인 T 세포 면역 반응이 형성되는 일련의 과정인 암 면역 순환고리(Cancer immunity cycle)가 원활히 형성되어야 한다. 이 과정은 1) 종양의 세포사멸 및 종양 항원 노출, 2) 항원제시세포의 종양 항원 제시, 3) 항원제시세포의 종양 항원 특이적 T 세포 생성 유도, 4) 종양 항원 T 세포의 종양 부위로의 이동, 5) 종양 내로의 침투, 6) 암세포 인지 및 사멸 유도의 순환이다.
이러한 과정 중 하나 혹은 여러 단계에서의 문제 발생은 항암 면역 반응 형성을 막으며, 면역치료 효율을 감소시킨다. 이에, 억제된 각 단계를 재활성시킬 수 있는 암 치료제들과 면역치료법의 병용이 항암 면역치료 내성 극복 방안으로 제안되고 있지만, 각각의 단일 단계 활성만으로는 여러 단계 이상을 극복할 수 없다.
한편, API5(Apoptosis inhibitor protein 5)는 다양한 암종에서 발현이 증가되어 있으며, 본 발명자의 선행 연구에서 ERK 기전을 통해 면역 내성 유도에 관여하는 인자로 보고된 바 있다(Cancer research. 2014). 또한, 후성 유전학적 조절인자와의 결합을 통해 면역 내성 유도 인자 NANOG의 발현을 전사 단계에서 조절함으로써 면역 내성뿐만 아니라 암의 다양한 악성(암전이능, 암줄기능, 항암제 내성 등)의 원인 인자임이 확인되었다(Oncogenesis. 2017, Exp Mol Med. 2017, BMB Rep. 2015, BMC Cancer. 2014). 이러한 API5를 억제하는 경우 암의 면역치료 내성 및 재발성을 감소시킬 수 있을 것이다. 따라서, API5에 특이적으로 결합함으로써 면역 내성을 극복하고 항암 면역치료 효율을 증가시킬 수 있는 항체 또는 이의 결합 단편의 개발이 요구되는 실정이다.
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
본 발명자들은 내성암, 항암 치료 후의 재발암 또는 전이암의 치료를 위한 표적 항체를 개발하고자 예의 연구 노력하였다. 그 결과, 다양한 암종에서 발현이 증가되어 있는 API5(Apoptosis inhibitor protein 5)에 특이적으로 결합하는 신규한 항체 또는 이의 항원 결합 단편을 개발함으로써, 본 발명을 완성하였다.
따라서, 본 발명의 목적은 API5(Apoptosis inhibitor protein 5) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공하는 것이다.
본 발명의 다른 목적은 상기 항체 또는 이의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 핵산 분자를 포함하는 재조합 벡터를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 재조합 벡터를 포함하는 숙주세포를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 API5 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 포함하는 암 치료용 약제학적 조성물을 제공하는 것이다.
본 발명의 다른 목적은 상기 API5 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 또는 상기 암 치료용 약제학적 조성물을 치료가 필요한 대상체에 투여하는 단계를 포함하는 암의 치료방법을 제공하는 것이다.
본 발명의 일 양태에 따르면, 본 발명은 API5(Apoptosis inhibitor protein 5) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공한다.
본 발명자들은 내성암, 항암 치료 후의 재발암 또는 전이암의 치료를 위한 표적 항체를 개발하고자 예의 연구 노력하였다. 그 결과, 다양한 암종에서 발현이 증가되어 있는 API5(Apoptosis inhibitor protein 5)에 특이적으로 결합하는 신규한 항체 또는 이의 항원 결합 단편을 개발하였다.
본 명세서에서, 용어 "API5(Apoptosis inhibitor protein 5)"은 API5 유전자에 의해 인코딩되는 단백질이다. API5 유전자는 성장인자 없이도 세포사멸이 이루어지지 않은 세포의 cDNA 분석을 통해, 발현이 증가된 유전자로 발견되어 AAC-11이라고 명명되었다(Cancer Res. 1997, 57(18):4063-9). API5 유전자는 여러 암세포에서 암의 생존 증가에 관여한다고 보고되었는데, Acinus(ACIN1)와의 물리적 결합을 통해 Acinus-매개 DNA 절편을 통한 세포사멸 유도를 억제하고 세포사멸 단백질인 Caspase-3의 활성을 막는다고 알려져 있다(EMBO J. 2009, 28(11):1576-88).
본 명세서에서 "원발암"은 통상의 암을 뜻하며, "재발암"은 통상의 암 치료 후 재발생된 암을 뜻하고, "내성암"은 상기 암 치료에 대하여 극히 낮은 감수성을 나타내어, 상기 치료에 의해 증세가 호전, 완화, 경감 또는 치료증상을 나타내지 않는 암을 의미한다. 여기서, 통상의 암 치료는 수술, 화학치료, 방사선치료, 호르몬 치료, 생물학적 치료, 면역치료 등을 포함할 수 있으나, 이에 한정되는 것은 아니다. 또한, 본 명세서에서 “전이암”은 “암전이” 또는 “전이성암”과 같은 의미로 사용되며, 특정 부위에서 발생한 원발암 또는 재발암이 다른 부위로 전이된 것을 의미한다.
본 발명의 일 구현예에 있어서, 상기 API5 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 a) 서열번호 1의 아미노산 서열을 포함하는 CDR(complementarity determining region)-H(Heavy chain)1, 서열번호 2의 아미노산 서열을 포함하는 CDR-H2, 및 서열번호 3의 아미노산 서열을 포함하는 CDR-H3를 포함하는 중쇄 가변영역; 및 b) 서열번호 4의 아미노산 서열을 포함하는 CDR-L(Light chain)1, 서열번호 5의 아미노산 서열을 포함하는 CDR-L2, 및 서열번호 6의 아미노산 서열을 포함하는 CDR-L3를 포함하는 경쇄 가변영역을 포함하는 항체 또는 이의 항원 결합 단편일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 항체 또는 이의 항원 결합 단편은 각각 본 발명의 실시예에서 선별한 인간 항체 라이브러리에서 도출한 클론 3F2로부터 유래한 것이나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 항체 또는 이의 항원 결합 단편은 하기 서열번호 7의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 항체 또는 이의 항원 결합 단편일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 API5 단백질은 인간 유래 API5 단백질 또는 마우스 유래 API5 단백질이나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 항체 또는 이의 항원 결합 단편은 서열번호 17 내지 18의 아미노산 서열 중 어느 하나로 표시되는 API5 폴리펩타이드 또는 rhAPI5 폴리펩타이드 내에 존재하는 에피토프(epitope)에 결합하는 것이다.
상기 서열번호 17의 아미노산 서열은 인간 유래 API5 단백질을 표시한다.
상기 서열번호 18의 아미노산 서열은 전장 재조합 인간 API5(recombinant human API15, rhAPI5) 폴리펩타이드를 표시한다.
상기 아미노산 서열은 본 명세서의 첨부된 서열목록에 수록되어 있으며, 하기 표 1에 나타내었다.
서열번호 | 명칭 | 서열 | 종류 |
1 | Amino acid sequence of CDR-H1 of API5 antibody | GFTFSTYA | Protein |
2 | Amino acid sequence of CDR-H2 of API5 antibody | ISGSGGST | Protein |
3 | Amino acid sequence of CDR-H3 of API5 antibody | AKLVLEWQYF SMDH | Protein |
4 | Amino acid sequence of CDR-L1 of API5 antibody | QSISRY | Protein |
5 | Amino acid sequence of CDR-L2 of API5 antibody | AAS | Protein |
6 | Amino acid sequence of CDR-L3 of API5 antibody | QQSYSFPWT | Protein |
7 | Amino acid sequence of VH of API5 antibody | EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKLVLEWQYFSMDHWGQGTLVTVSS | Protein |
8 | Amino acid sequence of VL of API5 antibody | DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPWTFGQGTKVEIK | Protein |
9 | Nucleotide sequence of CDR-H1 of API5 antibody | ggttttactttctctacttatgca | DNA |
10 | Nucleotide sequence of CDR-H2 of API5 antibody | atctctggttctggtggttctact | DNA |
11 | Nucleotide sequence of CDR-H3 of API5 antibody | gccaaactggttctggaatggcagtacttctctatggatcat | DNA |
12 | Nucleotide sequence of CDR-L1 of API5 antibody | cagtctatctctcgttac | DNA |
13 | Nucleotide sequence of CDR-L2 of API5 antibody | gcagcatcc | DNA |
14 | Nucleotide sequence of CDR-L3 of API5 antibody | cagcaatcttactcttttccgtggacg | DNA |
15 | Nucleotide sequence of VH of API5 antibody | gaagtacagttggtcgaaagtggcggtggcctcgtgcaaccgggtggttcactgcgtctgagctgcgccgcctcgggttttactttctctacttatgcaatgtcttgggttcgtcaggcgccgggcaagggtctcgaatgggtttcagcaatctctggttctggtggttctacttactatgccgattcagtgaagggtcgctttaccatttcccgtgacaactctaagaatactctgtatctgcagatgaactcgctgcgtgccgaagacacggccgtctattattgcgccaaactggttctggaatggcagtacttctctatggatcattggggtcagggcactttagtgaccgtctcatcg | DNA |
16 | Nucleotide sequence of VL of API5 antibody | gacattcaaatgacgcagagtccctcctcactgagtgctagcgtgggcgatcgtgtgacaattacttgtcgcgctagccagtctatctctcgttacctgaactggtatcagcagaaaccgggcaaggcgccaaaattgctgatttacgcagcatccactctgcagtctggtgtaccgtcccgtttctctggcagcggttctggtacggattttaccctgaccatctcaagcctccagcctgaagattttgccacctattattgtcagcaatcttactcttttccgtggacgttcgggcagggaactaaagtggaaattaaa | DNA |
17 | Amino acid sequence of human API5 antibody | MPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQILQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK | Protein |
18 | Amino acid sequence of rhAPI5 antibody | MPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQILQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK | Protein |
본 발명의 일 구현예에 있어서, 상기 항체 또는 이의 항원 결합 단편의 가변영역의 프레임워크(framework) 서열은 인간 유래 프레임워크 서열 또는 마우스 유래 프레임워크 서열로부터 유래하는 것이나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 항체 또는 이의 항원 결합 단편은 상기 중쇄 가변영역 및 상기 경쇄 가변영역을 포함하는 모노클로날 항체, 폴리클로날 항체, scFv, Fab, F(ab), F(ab)2, scFv-Fc, 미니바디, 다이아바디, 트리아바디, 테트라바디, 이중항체, 다중특이적 항체, 인간항체, 인간화 항체, 키메라 항체 또는 이들의 항원 결합 단편일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 항체는 당 업계에 알려져 있는 다양한 파지 디스플레이(phage display) 방법을 사용하여 생성될 수 있고, [Brinkman et al., 1995, J. Immunol. Methods, 182:41-50]; [Ames et al., 1995, J. Immunol. Methods, 184, 177-186]; [Kettleborough et al. 1994, Eur. J. Immunol, 24, 952-958]; [Persic et al., 1997, Gene, 187, 9-18]; 및 [Burton et al., 1994, Adv. Immunol., 57, 191-280]; WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; 및 WO 95/20401; 및 US 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743; 및 5,969,108 에 게시된 것을 포함한다.
본 명세서에서, 용어 "항체(antibody)"는 API5 단백질에 대한 특이적 항체로서, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다.
완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(kappa) 및 람다(lambda) 타입을 가진다(Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA(1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4,pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
본 명세서에서, 용어 "항원 결합 단편"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab'), F(ab')2, 화학적으로 연결된 F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 또는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명에서 항체는 구체적으로 scFv 형태이거나 완전한 항체 형태이다. 또한, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 또는 엡실론(ε) 중의 어느 한 이소타입으로부터 선택될 수 있다. 구체적으로는, 불변영역은 감마1(IgG1), 감마 2(IgG2), 감마 3(IgG3) 및 감마 4(IgG4)이다. 경쇄 불변 영역은 카파 또는 람다 형일 수 있으며, 구체적으로는 카파형이다.
본 명세서에서, 용어 "중쇄"는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3 개의 불변 영역 도메인 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한 본 명세서에서 용어 "경쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 "CDR(complementarity determining region)"은 면역글로불린 중쇄 및 경쇄의 초가변영역(hypervariable region, HVR)의 아미노산 서열을 의미한다(Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(CDR-H1, CDR-H2 및 CDR-H3) 및 경쇄(CDR-L1, CDR-L2 및 CDR-L3)에는 각각 3개의 CDR이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 명세서에서 상기 항체 또는 이의 항원 결합 단편은 전장 또는 원래 그대로의 폴리클로날 또는 모노클로날 항체뿐만 아니라, 이의 항원 결합 단편들(예를 들어, Fab, Fab′, F(ab′)2, Fab3, Fv 및 이의 변이체들), 하나 또는 그 이상의 항체 부분을 포함하는 융합 단백질, 인간화 항체, 미니바디, 다이아바디, 트리아바디, 테트라바디, 선형 항체, 단일 체인 항체(scFv), scFv-Fc, 이중특이적 항체, 다중특이적 항체, 필요한 특이성의 항원 인식 부위를 포함하는 면역 글로불린 분자의 다른 변형된 배열형태로서 항체의 글리코실화 변이체, 항체의 아미노산 서열 변이체 및 공유결합으로 변형된 항체를 포함한다. 변형된 항체 및 이의 항원 결합 단편의 구체적인 예에는 나노바디, AlbudAbs, DARTs(dual affinity re-targeting), BiTEs(bispecific T-cell engager), TandAbs(tandem diabodies), DAFs(dual acting Fab), two-in-one antibodies, SMIPs(small modular immunopharmaceuticals), FynomAbs(fynomers fused to antibodies), DVD-Igs(dual variable domain immunoglobulin), CovX-bodies(peptide modified antibodies), 듀오바디 및 triomAbs이 포함된다. 이와 같은 항체 및 이의 항원 결합 단편들의 목록은 상기에 한정되는 것은 아니다.
본 명세서에서, 용어 "프레임 워크(Framework)" 또는 "FR"은 초가변영역 잔기 이외의 가변 도메인 잔기를 나타낸다. 가변 도메인의 FR은 일반적으로 4 개의 FR 도메인 FR1, FR2, FR3 및 FR4로 구성된다. 따라서, HVR 및 FR 서열은 일반적으로 VH 및 VL/VK에서 다음의 순서로 나타난다:
(a) FRH1(Framework region 1 of Heavy chain)-CDRH1(complementarity determining region 1 of Heavy chain)-FRH2-CDRH2-FRH3-CDRH3-FRH4; 및
(b) FRL1(Framework region 1 of Light chain)-CDRL1(complementarity determining region 1 of Light chain)-FRL2-CDRL2-FRL3-CDRL3-FRL4.
본 발명의 다른 구현예에 있어서, 상기 항체 또는 항원 결합 단편은 다음과 같은 순서로 나타날 수 있다:
(a) FRL1(Framework region 1 of Light chain)-CDRL1(complementarity determining region 1 of Light chain)-FRL2-CDRL2-FRL3-CDRL3-FRL4; 및
(b) FRH1(Framework region 1 of Heavy chain)-CDRH1 (complementarity determining region 1 of Heavy chain)-FRH2-CDRH2-FRH3-CDRH3-FRH4.
본 명세서에서, 용어 "가변 영역(variable region)" 또는 "가변 도메인(variable domain)"은 항체를 항원에 결합시키는 것과 관련되는 항체 중쇄 또는 경쇄의 도메인을 의미한다. Native 항체의 중쇄 및 경쇄의 가변 도메인(각각 VH 및 VL)은 일반적으로 유사한 구조를 가지며, 각 도메인은 4 개의 보존된 프레임워크 영역 (framework regions, FR) 및 3 개의 초가변 영역 (hypervariable regions, HVR)을 포함한다. (Kindt et al., Kuby Immunology, 제 6 판, W.H. Freeman and Co., page 91 (2007)). 단일 VH 또는 VL 도메인은 항원-결합 특이성을 부여하기에 충분할 수 있다. 또한, 특정 항원에 결합하는 항체는, 항원과 결합하여 각각 상보적인 VL 또는 VH 도메인의 라이브러리를 스크리닝하는 항체로부터, VH 또는 VL 도메인을 사용하여 분리될 수 있다.
본 명세서에서, 용어 "특이적으로 결합한다" 또는 이와 같은 것은, 항체 또는 이의 항원 결합 단편, 또는 scFv와 같은 다른 구성물이 생리적 조건 하에서 비교적 안정한 항원과 복합체를 형성한다는 것을 의미한다. 특이적 결합은 적어도 약 1 x 10-6 M 이하(예컨대, 9 x 10-7 M, 8 x 10-7 M, 7 x 10-7 M, 6 x 10-7 M, 5 x 10-7 M, 4 x 10-7 M, 3 x 10-7 M, 2 x 10-7 M, 또는 1 x 10-7 M), 바람직하게는 1 x 10-7 M 이하(예컨대, 9 x 10-8 M, 8 x 10-8 M, 7 x 10-8 M, 6 x 10-8 M, 5 x 10-8 M, 4 x 10-8 M, 3 x 10-8 M, 2 x 10-8 M, 또는 1 x 10-8 M), 보다 바람직하게는 1 x 10-8 M 이하(예컨대, 9 x 10-9 M, 8 x 10-9 M, 7 x 10-9 M, 6 x 10-9 M, 5 x 10-9 M, 4 x 10-9 M, 3 x 10-9 M, 2 x 10-9 M, 또는 1 x 10-9 M)의 평형 해리 상수(예를 들어, 이보다 작은 KD는 보다 단단한 결합을 나타냄)로 특성화될 수 있다. 2 개의 분자가 특이적으로 결합하는지 여부를 결정하는 방법은 당 업계에 잘 알려져 있으며, 예를 들어 평형 투석, 표면 플라스몬 공명 등을 포함한다.
본 명세서에서, 용어 "친화도(Affinity)"는 분자(예를 들어, 항체)의 단일 결합 부위와 그 결합 파트너(예를 들어, 항원) 사이의 비공유 상호 작용의 총합의 강도를 의미한다. 달리 명시하지 않는 한, 본원에 사용된 바와 같이, "결합 친화력(binding affinity)"은 결합 쌍(예를 들어, 항체 및 항원)의 구성원 간의 1:1 상호 작용을 반영하는 내인성(intrinsic) 결합 친화력을 나타낸다. 분자 Y와 이의 파트너 Y의 친화도는 일반적으로 해리 상수(Kd)로 나타낼 수 있다. 친화도는 본원에 기술된 것들을 포함하여 당업계에 공지된 통상적인 방법에 의해 측정될 수 있다.
또한 본 명세서에서 용어, "인간 항체(human antibody)"는 인간 또는 인간 세포에 의해 생성된 항체, 또는 인간 항체 레퍼토리(repertoires) 또는 다른 인간 항체 코딩 서열을 이용하는 비인간 근원으로부터 유래된 항체의 아미노산 서열에 상응하는 아미노산 서열을 보유한다. 인간 항체의 이러한 정의는 비인간 항원 결합 잔기를 포함하는 인간화(humanized) 항체를 배제한다.
본 명세서에서 용어, "키메라 항체(chimeric antibody)"는 중쇄 및/또는 경쇄의 일부가 특정 근원(source) 또는 종(species)으로부터 유래되고, 중쇄 및/또는 경쇄의 나머지가 상이한 근원 또는 종에서 유래한 항체를 의미한다.
본 명세서에서 용어 "인간화 항체"는 비-인간(예를 들어, 마우스, 닭) 항체의 비-인간 면역글로불린으로부터 유래된 최소 서열을 함유하는 키메릭 면역글로불린, 이의 면역글로불린 쇄 또는 단편(예를 들어 Fv, Fab, Fab', F(ab')2 또는 항체의 다른 항원-결합 하위서열)이다. 대부분의 경우에, 인간화 항체는 수용자의 상보성-결정 영역(CDR)의 잔기가, 목적하는 특이성, 친화성 및 능력을 갖는 비-인간 종(공여자 항체), 예를 들어 마우스, 닭, 랫트 또는 토끼의 CDR의 잔기에 의해 대체된 인간 면역글로불린(수용자 항체)이다.
또한, 인간화 항체는 수용자 항체에서도 또는 수입된 CDR 또는 프레임워크 서열에서도 발견되지 않는 잔기를 포함할 수 있다. 이러한 변형은 항체 성능을 추가로 개선 및 최적화하기 위해 이루어진다. 일반적으로, 상기 인간화 항체는 적어도 하나, 및 전형적으로는 2개의 모든 가변 도메인을 포함할 것이며, 상기 도메인에서 상기 CDR 영역의 전부 또는 실질적 전부는 비-인간 면역글로불린의 CDR 영역에 상응하고, 상기 FR 영역의 전부 또는 실질적 전부는 인간 면역글로불린의 FR 영역의 서열을 가진다. 상기 인간화 항체는 면역글로불린 불변 영역(Fc region)에, 적어도 일부 또는 실질적인 인간 면역글로불린의 불변 영역(Fc region)서열을 포함한다.
상기 항체 또는 항원 결합 단편의 변이체는 "실질적 유사성"을 가지는 것으로, 2개의 펩타이드 서열이 디폴트 갭 가중치를 사용하는 프로그램 GAP 또는 BESTFIT에 의해서와 같이 최적으로 정렬되는 경우에 적어도 약 90%의 서열 동일성, 더욱 바람직하게는 적어도 약 95%, 98% 또는 99%의 서열 동일성을 공유함을 의미한다. 바람직하게는, 동일하지 않은 잔기 위치는 보존적 아미노산 치환에 의해 상이하다. "보존적 아미노산 치환"은 아미노산 잔기가 유사한 화학적 특성(예: 전하 또는 소수성)을 갖는 측쇄(R기)를 갖는 또 다른 아미노산 잔기에 의해 치환된 것이다. 일반적으로, 보존적 아미노산 치환은 단백질의 기능성을 실질적으로 변화시키지 않는다. 2개 이상의 아미노산 서열이 보존적 치환에 의해 서로 상이한 경우에, 유사성의 퍼센트 또는 정도는 치환의 보존적 성질을 보정하기 위해 상향 조절될 수 있다.
이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 갖으며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서, 이러한 고려 사항에 기초하여, 아르기닌, 라이신과 히스티딘; 알라닌, 글라이신과 세린; 그리고 페닐알라닌, 트립토판과 타이로신은 생물학적으로 기능적 균등물이라 할 수 있다.
변이를 도입하는 데 있어서, 아미노산의 소수성 인덱스(hydropathic idex)가 고려될 수 있다. 각각의 아미노산은 소수성과 전하에 따라 소수성 인덱스가 부여되어 있다: 아이소루이신(+4.5); 발린(+4.2); 루이신(+3.8); 페닐알라닌(+2.8); 시스테인/시스타인(+2.5); 메티오닌(+1.9); 알라닌(+1.8); 글라이신(-0.4); 쓰레오닌(-0.7); 세린(-0.8); 트립토판(-0.9); 타이로신(-1.3); 프롤린(-1.6); 히스티딘(-3.2); 글루타메이트(-3.5); 글루타민(-3.5); 아스파르테이트(-3.5); 아스파라긴(-3.5); 라이신(-3.9); 및 아르기닌(-4.5).
단백질의 상호적인 생물학적 기능(interactive biological function)을 부여하는 데 있어서 소수성 아미노산 인덱스는 매우 중요하다. 유사한 소수성 인덱스를 가지는 아미노산으로 치환하여야 유사한 생물학적 활성을 보유할 수 있다는 것은 공지된 사실이다. 소수성 인덱스를 참조하여 변이를 도입시키는 경우, 바람직하게는 ±2 이내, 보다 바람직하게는 ±1 이내, 보다 더 바람직하게는 ±0.5 이내의 소수성 인덱스 차이를 나타내는 아미노산 사이에서 치환을 한다.
한편, 유사한 친수성 값(hydrophilicity value)을 가지는 아미노산 사이의 치환이 균등한 생물학적 활성을 갖는 단백질을 초래한다는 것도 잘 알려져 있다. 미국 특허 제4,554,101호에 개시된 바와 같이, 다음의 친수성 값이 각각의 아미노산 잔기에 부여되어 있다: 아르기닌(+3.0); 라이신(+3.0); 아스팔테이트(+3.0± 1); 글루타메이트(+3.0± 1); 세린(+0.3); 아스파라긴(+0.2); 글루타민(+0.2); 글라이신(0); 쓰레오닌(-0.4); 프롤린(-0.5 ± 1); 알라닌(-0.5); 히스티딘(-0.5); 시스테인(-1.0); 메티오닌(-1.3); 발린(-1.5); 루이신(-1.8); 아이소루이신(-1.8); 타이로신(-2.3); 페닐알라닌(-2.5); 트립토판(-3.4).
친수성 값을 참조하여 변이를 도입시키는 경우, 바람직하게는 ±2 이내, 보다 바람직하게는 ±1 이내, 보다 더 바람직하게는 ±0.5 이내의 친수성 값 차이를 나타내는 아미노산 사이에서 치환을 한다.
분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다(H. Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다.
본 발명의 항체 또는 이의 항원 결합 단편은 상술한 아미노산 서열에 대하여 소폭의 변화, 즉, 3차 구조 및 항체의 기능에 거의 영향을 미치지 않는 변형을 포함하는 항체 또는 이의 항원 결합 단편을 포함한다. 따라서 어떤 구현예의 경우 상술한 서열과 일치하지 않더라도 적어도 100%, 93%, 95%, 96%, 97%, 또는 98% 이상의 유사성을 가질 수 있다.
본 발명의 일 구현예에 따르면, 본 발명의 항체 또는 이의 항원 결합 단편은 상술한 서열의 CDR을 포함하는 중쇄 가변영역 및 경쇄 가변영역을 포함하는 단일클론 항체, 이중특이적 항체, 다중특이적 항체, 인간 항체, 인간화 항체, 키메라 항체, 단일 체인 항체(scFv), Fab 단편, F(ab')단편, 다이설파이드-결합 Fvs(sdFV) 및 항-이디오타입(항-Id) 항체, 그리고 상기 항체들의 에피토프-결합 단편 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 구체적인 구현예에서, 상기 항체 또는 이의 항원 결합 단편에 포함되는 중쇄 가변영역 및 경쇄 가변영역은 (Gly-Ser)n, (Gly2-Ser)n, (Gly3-Ser)n 또는 (Gly4-Ser)n 등의 링커에 의해 연결된다. 여기서 n은 1 내지 6의 정수이고, 구체적으로는 3 내지 4이나 이에 한정되는 것은 아니다. 상기 scFv의 경쇄 가변영역 및 중쇄 가변영역은 예를 들어 다음의 배향으로 존재할 수 있다: 경쇄 가변영역-링커-중쇄 가변영역 또는 중쇄 가변영역-링커-경쇄 가변영역.
본 발명의 다른 일 양태에 따르면, 본 발명은 상술한 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공한다.
본 명세서에서 용어 "핵산 분자(nucleic acid molecule)"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
본 발명의 상기 항체 또는 이의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열은 상기 항체 또는 이의 항원 결합 단편을 구성하는 아미노산 서열을 인코딩하는 뉴클레오타이드 서열인 것으로 족하며, 어느 특정 뉴클레오타이드 서열에 한정되지 않는다는 것은 당업자에게 자명하다.
이는 뉴클레오티드 서열의 변이가 발생하더라도 변이된 뉴클레오타이드 서열을 단백질로 발현하면 단백질 서열에서 변화를 가져오지 않는 경우도 있기 때문이다. 이를 코돈의 축퇴성이라고 한다. 따라서 상기 뉴클레오타이드 서열은 기능적으로 균등한 코돈 또는 동일한 아미노산을 코딩하는 코돈(예를 들어, 코돈의 축퇴성에 의해, 아르기닌 또는 세린에 대한 코돈은 여섯 개이다), 또는 생물학적으로 균등한 아미노산을 코딩하는 코돈을 포함하는 뉴클레오타이드 서열을 포함한다.
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 상기 항체 또는 이의 항원 결합 단편을 인코딩하는 본 발명의 핵산 분자는 이와 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60% 이상의 상동성(예컨대 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 또는 69%), 보다 구체적으로는 70% 이상의 상동성(예컨대 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 또는 79%), 보다 더 구체적으로는 80% 이상의 상동성(예컨대 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 또는 89%), 보다 더욱더 구체적으로는 90% 이상의 상동성(예컨대 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 또는 99%), 가장 구체적으로는 95% 이상의 상동성(예컨대 95%, 96%, 97%, 98%, 또는 99%)을 나타내는 서열을 의미한다. 상기 60% 이상 100% 이하의 모든 정수 및 이 사이에 존재하는 소수는 % 상동성과 관련하여 본 발명의 범위 내에 포함된다.
서열 비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio. 48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있다. NCBI Basic Local Alignment Search Tool(BLAST)(Altschul et al., J. Mol. Biol. 215:403-10(1990))은 NBCI(National Center for Biological Information) 등에서 접근 가능하며, 인터넷 상에서 blastp, blastn, blastx, tblastn 및 tblastx와 같은 서열 분석 프로그램과 연동되어 이용할 수 있다. BLAST는 ncbi 웹사이트의 BLAST 페이지를 통하여 접속 가능하다. 이 프로그램을 이용한 서열 상동성 비교 방법은 ncbi 웹사이트의 BLAST help 페이지에서 확인할 수 있다.
본 발명의 구체적인 구현예에 따르면, 상기 본 발명의 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편의 중쇄 CDR, 경쇄 CDR, 중쇄 가변영역, 경쇄 가변영역, 중쇄 및/또는 경쇄를 이루는 폴리펩티드와 이를 인코딩하는 뉴클레오타이드 서열은 본 명세서의 첨부된 서열목록에 수록되어 있으며, 상술한 표 1에도 나타내었다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 인코딩하는 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 전달 벡터와 발현 벡터를 포함한다.
본 명세서에서 용어 "전달 벡터"는 단리된 핵산을 포함하고 단리된 핵산을 세포 내부로 전달하는데 사용될 수 있는 물질의 조성을 지칭한다. 선형 폴리뉴클레오티드, 이온성 또는 양친매성 화합물과 연결된 폴리뉴클레오티드, 플라스미드 및 바이러스를 포함하나, 이에 한정되는 것은 아니다. 보다 구체적으로 상기 전달 벡터는 자가 복제성 플라스미드 또는 바이러스를 포함한다. 상기 용어는 세포 내로의 핵산의 전이를 촉진시키는 비-플라스미드 및 비-바이러스성 화합물, 예컨대 폴리리신 화합물, 리포솜 등을 추가적으로 포함할 수 있는 것으로 해석되어야 한다. 바이러스성 전달 벡터는 아데노 바이러스 벡터, 아데노-연관 바이러스 벡터, 레트로바이러스 벡터, 렌티바이러스 벡터를 포함하나, 이에 한정되는 것은 아니다.
본 명세서에서 용어 "발현 벡터"는 숙주 세포에서 목적 유전자를 발현시키기 위하여, 발현시킬 뉴클레오티드 서열에 작동가능하게 연결된 발현 제어 서열을 포함하는 재조합 뉴클레오티드를 포함하는 벡터를 지칭한다. 발현 벡터는 발현을 위한 충분한 시스 작용 인자(cis-acting element)를 포함하고, 발현을 위한 다른 요소는 숙주 세포 또는 시험관 내 발현 시스템에 의해 제공될 수 있다. 상기 발현 벡터는 재조합 폴리뉴클레오티드를 포함하는 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 렌티바이러스, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터를 포함한다. 본 발명의 구체적인 구현예에 따르면, 본 발명의 벡터에서 상기 스위치 분자를 코딩하는 핵산 분자는 상기 벡터의 프로모터와 작동적으로 결합(operatively linked)되어 있다.
본 명세서에서 용어 "작동적으로 결합된"은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열 사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 유전자 클로닝을 위한 벡터, 단백질의 발현을 위한 벡터, 또는 유전자의 전달을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고 진핵 세포를 숙주로 하는 경우에는 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, beta-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
본 발명의 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.
또한, 본 발명의 벡터에 의해 발현되는 단백질이 항체인 경우, 정제를 위한 추가적인 서열 없이도, 발현된 항체는 단백질 A 컬럼 등을 통하여 용이하게 정제할 수 있다.
한편, 본 발명의 발현 벡터는 본 발명의 항체 또는 이의 항원 결합 단편, 및 이를 포함하는 CAR 폴리펩타이드의 발현을 평가하기 위한 선택표지로서 선택가능 마커 유전자 및/또는 리포터 유전자를 포함할 수 있다.
선택가능 마커 유전자로는 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 제네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다. 리포터 유전자로는 루시페라제, 베타-갈락토시다제, 클로람페니콜 아세틸 트랜스퍼라제, 또는 녹색형광 단백질 유전자를 포함한다.
본 발명의 재조합 벡터를 세포 내로 도입하고 발현시키는 방법은 관련 기술분야에 잘 알려져 있다. 벡터는 당업계에 공지된 방법에 의해 숙주 세포, 예를 들어 포유동물, 박테리아, 효모, 또는 곤충 세포 내로 쉽게 도입될 수 있다. 예를 들면, 벡터는 물리적, 화학적, 또는 생물학적 수단에 의해 숙주 세포 내로 전달될 수 있다. 상기 물리적 수단은 인산칼슘 침전, 리포펙션, 입자 폭격(particle bombardment), 미세주입, 전기천공 등을 포함한다. 상기 화학적 수단은 콜로이드 분산액 시스템, 예컨대 거대분자 복합체, 나노 캡슐, 마이크로스피어, 비드, 및 수중유 에멀젼, 마이셀 (micelle), 혼합된 마이셀, 및 리포좀을 포함하는 지질-기반 시스템을 포함한다. 또한, 상기 생물학적 수단은 상술한 렌티바이러스, 레트로바이러스 등, DNA 또는 RNA 벡터의 사용을 포함한다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 재조합 벡터를 포함하는 분리된 숙주세포를 제공한다. 상기 숙주세포는 재조합 벡터에 의해 형질전환 되었다고 표현될 수 있다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 어떠한 숙주 세포도 이용할 수 있으며, 예컨대, 상기 벡터의 적합한 진핵세포 숙주 세포는 이스트(Saccharomyce cerevisiae), 곤충 세포, 원숭이 신장 세포7(COS7: monkey kidney cells), NSO 세포, SP2/0, 차이니즈 햄스터 난소(CHO: Chinese hamster ovary) 세포, W138, 어린 햄스터 신장(BHK: baby hamster kidney) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK-293 세포를 포함하나 이에 한정되지 않는다.
본 명세서에서 용어 "형질전환 된", "형질도입 된" 또는 "형질감염 된"은 외인성 핵산이 숙주세포 내로 전달되거나 도입되는 과정을 지칭한다. "형질전환 된", "형질도입 된" 또는 "형질감염 된" 세포는 외인성 핵산으로 형질전환, 형질도입 또는 형질감염 된 세포이며, 상기 세포는 당해 세포 및 이의 계대배양으로 인한 자손 세포를 포함한다.
본 발명의 벡터를 숙주 세포 내로 운반하는 방법은, 숙주세포가 진핵 세포인 경우에는, 미세 주입법(Capecchi, M.R., Cell, 22:479(1980)), 칼슘 포스페이트 침전법(Graham, F.L. et al., Virology, 52:456(1973)), 전기 천공법(Neumann, E. et al., EMBO J., 1:841(1982)), 리포좀-매개 형질감염법(Wong, T.K. et al., Gene, 10:87(1980)), DEAE-덱스트란 처리법(Gopal, Mol. Cell Biol., 5:1188-1190(1985)), 및 유전자 밤바드먼트(Yang et al., Proc. Natl. Acad. Sci., 87:9568-9572(1990)) 등에 의해 벡터를 숙주 세포 내로 주입할 수 있다.
본 발명에서 숙주세포 내에 포함된 재조합 벡터는 숙주 세포 내에서 재조합 된 상기의 항체 또는 항원 결합 단편, 또는 이를 포함하는 융합단백질을 발현할 수 있으며, 이러한 경우에는 다량의 항체 또는 항원 결합 단편, 또는 융합단백질을 얻게 된다. 예를 들어, 상기 발현 벡터가 lac 프로모터를 포함하는 경우에는 숙주 세포에 IPTG(isopropyl-beta-D-thiogalactopyranoside)를 처리하여 유전자 발현을 유도할 수 있다.
상기 배양은 통상적으로 진탕 배양 또는 회전기에 의한 회전에 의한 것과 같은 호기성 조건하에서 행한다. 배양 온도는 바람직하게는 10 내지 40℃의 범위에서 행하고, 배양시간은 일반적으로 5 시간 내지 7 일간 행한다. 배지의 pH는 배양 중에서 바람직하게는 3.0 내지 9.0의 범위를 유지한다. 배지의 pH는 무기 또는 유기산, 알칼리 용액, 우레아, 칼슘 카보네이트, 암모니아 등으로 조절할 수 있다. 배양 중에는 필요한 경우 재조합 벡터의 유지 및 발현을 위해 암피실린, 스트렙토마이신, 클로람페니콜, 카나마이신 및 테트라사이클린과 같은 항생제를 첨가할 수 있다. 유도(induction) 가능한 프로모터를 갖는 재조합 발현 벡터로 형질전환 된 숙주세포를 배양하는 경우 필요하다면 배지에 적합한 유도제(inducer)를 첨가할 수 있다. 예를 들어, 발현 벡터가 lac 프로모터를 함유하는 경우 IPTG를 첨가하고, trp 프로모터를 포함하는 경우 인돌아크릴산(indoleacrylic acid)을 배지에 첨가할 수 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 약제학적으로 허용되는 담체를 포함하는, 암의 예방 또는 치료용 약제학적 조성물을 제공한다.
본 발명의 약제학적 조성물은 상술한 본 발명의 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 이용하기 때문에, 이 둘 사이에 공통된 내용은 본 명세서의 과도한 복잡성을 피하기 위하여, 그 기재를 생략한다.
본 발명의 약제학적 조성물은 상술한 본 발명의 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 이용하기 때문에, API5의 고발현과 관련된 암의 예방 또는 치료에 유용하게 사용될 수 있다.
본 발명의 일 구현예에 있어서, 본 발명의 암은 항암 면역 내성암일 수 있다.
본 명세서에서 "항암 면역 내성암" 또는 “면역 내성암”은 "항암 면역치료 내성암"과 동일한 의미로 사용되며, 면역요법에 의한 항암치료 후 재발되어 내성이 생기고 면역억제능을 가진 암을 뜻한다.
본 명세서에서 “항암 면역치료” 또는 “면역치료”란 암 특이 항원 또는 암 관련 항원에 대한 면역반응을 유도하여 암 특이성 독성 면역세포에 의해 암세포를 제거하는 모든 체계의 통합을 지칭한다. 암 항원에 대한 면역유도 방법으로는 유전자, 단백질, 바이러스, 수지상세포 등의 방법을 포함한다.
상기 항암 면역치료는 사이토카인(예컨대 인터페론, GM-CSF, G-CSF, IL-2), CRS-207 면역치료, 암 백신, 모노클로날 항체, 이중특이적 또는 다중특이적 항체, 항체 약물 접합체, 차용 T 세포 전달, Toll 수용체 작용제, RIG-1 작용제, 종양용해성 바이러스치료, 면역조절 소분자(예컨대 JAK1/2 억제제, PI3Kδ 억제제)를 이용한 치료, 및 면역관문 억제제(예컨대, CBL-B, CD20, CD28, CD40, CD70, CD122, CD96, CD73, CD47, CDK2, GITR, CSF1R, JAK, PI3Kδ, PI3Kγ, TAM, arginase, HPK1, CD137, ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, LAG3, TIM3, TLR (TLR7/8), TIGIT, CD112R, VISTA, PD-1, PD-L1 및 PD-L2 등의 면역관문 분자에 대한 억제제)를 이용한 치료를 포함한다.
본 발명의 일 구현예에 있어서, 본 발명의 암의 종류로는 뇌종양, 척수종양, 망막 세포종, 구강암, 비강암, 부비동암, 인두암, 후두암, 경부암을 포함하는 두경부암; 피부암, 유방암, 갑상선암, 악성 부신 종양을 포함하는 내분비암; 폐암, 흉막 종양을 포함하는 호흡기암; 식도암, 위암, 소장의 악성 종양, 대장암, 항문암, 간암, 담도암, 췌장암을 포함하는 소화기암; 신장암, 방광암, 전립선암, 고환암, 음경암을 포함하는 비뇨기암; 자궁경부암, 자궁체부암, 융모상피암, 난소암을 포함하는 부인암; 급성 또는 만성 백혈병, 악성림프종, 다발성 골수증을 포함하는 혈액암; 흑색종, 기저세포암, 편평상피세포암을 포함하는 피부암; 및 소아 백혈병 또는 소아 고형 종양을 포함하는 소아암; 등일 수 있다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences(19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 예컨대 정맥내 투여, 피하 투여, 근육 투여, 복강 내 투여, 척수강 내 투여, 뇌내 투여, 흉골내 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.0001-100 mg/kg이다. 본 명세서에서 용어 "약제학적 유효량"은 상술한 질환을 예방 또는 치료하는 데 충분한 양을 의미한다.
본 명세서에서 용어 "예방"은 질환 또는 질환 상태의 방지 또는 보호적인 치료를 의미한다. 본 명세서에서 용어 "치료"는 질환 상태의 감소, 억제, 진정 또는 근절을 의미한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 약제학적 조성물은 또한 상술한 유효성분 이외에 다른 약제학적 활성 약제 및 요법과 조합하여 사용될 수 있다. 상기 "조합"은 동시 또는 병용투여로 표현될 수 있다.
본 발명의 약제학적 조성물은 화학치료, 방사선 치료, 종양-표적 치료, 보조 치료, 면역치료 또는 수술에 의해 암을 치료하는 다른 방법과 조합하여 추가로 사용될 수 있다.
상기 본 발명의 약제학적 조성물과 조합하여 사용될 수 있는 치료제로는 당업계에 공지된 1 이상의 화학치료제(예컨대 아스파라기나제, 부설판, 카보플라틴, 시스플라틴, 다우노루비신, 독소루비신, 플루오로우라실, 겜시타빈, 하이드록시우레아, 메토트렉세이트, 파클리탁셀, 리툭시맙, 빈블라스틴, 빈크리스틴), 1 이상의 표적치료제(예컨대 베바시주맙(bevacizumab), 올라파립(olaparib), PD-1/PD-L1 특이적인 면역 관문 억제제(예컨대 니볼루맙, 펨브롤리주맙, 아테졸리주맙, 더발루맙, 아벨루맙, 세미플리맙, 아테졸리주맙, 아벨루맙, 티슬레리주맙, 스파르탈리주맙(PDR001), 세트렐리맙(JNJ-63723283), 토리팔리맙(JS001), 캄렐리주맙(SHR-1210), 신틸리맙(IBI308), AB122(GLS-010), AMP-224, AMP-514/MEDI-0680, BMS936559, JTX-4014, BGB-108, SHR-1210, MEDI4736, FAZ053, BCD-100, KN035, CS1001, BAT1306, LZM009, AK105, HLX10, SHR-1316, CBT-502(TQB2450), A167(KL-A167), STI-A101(ZKAB001), CK-301, BGB-A333, MSB-2311, HLX20, TSR-042, 또는 LY3300054)가 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 약제학적 조성물을 치료가 필요한 대상체에 투여하는 단계를 포함하는 암의 치료방법을 제공한다.
본 발명의 치료방법의 대상 질병인 상기 암은 약학적 조성물의 치료 대상 질병과 관련하여 정의한 것과 같다.
본 발명의 일 구현예에서, 상기 대상체는 포유동물 또는 인간이다.
본 발명의 암의 치료방법은 상술한 약제학적 조성물을 대상체에 투여하는 방법이므로, 중복되는 내용에 대해서는 본 명세서의 과도한 복잡성을 피하기 위하여 그 기재를 생략한다.
본 발명은 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들의 용도에 관한 것이다. 본 발명의 항체 또는 이의 항원 결합 단편은 다양한 암종에서 발현이 증가되어 있는 API5에 특이적 결합이 확인되었는 바, 내성암 또는 항암 치료 후의 재발 또는 전이암의 치료 연구 등에 적용될 수 있다.
도 1은 API5 표적 항체 개발을 위한 인간화 항체 제작 과정 모식도를 나타낸다.
도 2a 및 도 2b는 인간 Fab 항체 단편 스크리닝을 통한 API5 표적 인간 항체 3F2 선별 결과를 나타낸다.
도 3a 및 도 3b는 본 발명의 API5 표적 인간 항체 3F2의 API5 단백질과의 결합력을 확인한 결과를 나타낸다.
도 4a 및 도 4b는 본 발명의 API5 항체 3F2 처리 시 항암 면역 내성 유도 기전인 ERK의 활성(ERK 인산화)의 감소를 나타낸다.
도 5a 및 도 5b는 본 발명의 API5 항체 3F2 처리 시 항암 면역 내성암 세포의 T 세포 매개 세포사멸 증가를 나타낸다.
도 6a 및 도 6b는 본 발명의 API5 표적 항체 투여를 통한 항암 면역 내성암 치료 효과 확인 결과를 나타낸다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
실시예. API5에 특이적으로 결합하는 항체의 선별
<인간 Fab 합성 라이브러리를 이용한 API5 표적 인간 항체 선별>
API5에 결합하는 항체를 발굴하기 위하여, 도 1과 같이 인간 합성 Fab 파지 라이브러리(Human synthetic Fab phage library)를 사용하고 고정 항원으로 Expi293 세포(Thermo Fisher Scientific)에 API5 유전자 발현 벡터를 일시발현 후 정제한 API5 단백질을 사용하여 파지 디스플레이(phage display) 기술을 통해 API5와 결합능을 나타내는 항체를 선별하였다.
그 결과, 3F2로 명명한 Fab 항체 파지 클론이 선별되었다(표 2).
중쇄(Heavy chain) | 경쇄(Light chain) | |
CDR-1 | GFTFSTYA (서열번호 1) | QSISRY (서열번호 4) |
CDR-2 | ISGSGGST (서열번호 2) | AAS (서열번호 5) |
CDR-3 | AKLVLEWQYFSMDH (서열번호 3) | QQSYSFPWT (서열번호 6) |
실험예 1.
3F2 항체의 정제 및 순도 확인
상기 실시예에서 선별된 3F2 항체의 물성 및 정제 순도를 SDS-PAGE(Sodium Dodecyl Sulfate Poly Acrylamide Gel Electrophoresis) 분석 및 SEC-HPLC(Size exclusion chromatography-High Performance Liquid Chromatography) 분석을 통해 확인하였다.
도 2a 및 2b에서 나타난 바와 같이, 순도 약 99% 이상의 3F2 항체를 확인할 수 있었다.
실험예 2.
3F2 항체의 API5 단백질과의 결합 확인
상기 실시예에서 선별된 3F2 항체의 농도 3.125 nM부터 200 nM까지 단계 희석(serial dilution) 한 7 개의 포인트와 0 nM를 포함한 총 8 개의 포인트에서 ELISA를 이용해 Kd value를 분석하였다.
도 3a에 나타난 바와 같이, Kd(M) = 1.201x10-9 값의 결합력을 확인할 수 있었다.
다음으로, 상기 실시예에서 선별된 3F2 항체의 농도 3.125 nM부터 100 nM까지 단계 희석한 6 개의 포인트와 0 nM를 포함한 총 7 개의 포인트에서 SPR(Surface plasmon resonance, Biacore) Biacore T200 장비를 이용해 Kd value를 분석하였다.
도 3b에 나타난 바와 같이, Kd(M) = 4.620x10-9 값의 결합력을 확인할 수 있었다.
실험예 3.
(
in vitro
) 3F2 항체 처리에 따른 내성 유도 기전(ERK)의 활성(ERK 인산화) 감소 확인
상기 실시예에서 선별된 3F2 항체(0, 0.2, 1, 5 및 25 ng/ml)를 PD-1/PD-L1 항체치료 내성암 모델인 CT26 P3(대장암) 혹은 TC-1 LP3(폐암) 암세포주에 처리 후, 웨스턴 블롯 실험을 통해 ERK 인산화 수준을 확인하였다.
도 4a 및 4b에 나타난 바와 같이, 3F2 항체 처리 시 농도 의존적으로 ERK 인산화가 감소하였으며, 25 ng/ml 농도에서 0 ng/ml 대비 CT26 P3 세포에서는 약 5배, TC-1 LP3 세포에서는 약 10배 감소함을 확인할 수 있었다.
실험예 4.
(
in vitro
) 3F2 항체 처리에 따른 내성암 세포의 T 세포 매개 세포사멸 증가 확인
항암 면역치료 내성 표현형인 T 세포 매개 세포사멸에 대한 저항성 억제 효능을 확인하기 위하여, CT26 P3 또는 TC-1 LP3 세포주에 상기 실시예에서 선별된 3F2 항체를 10 ng/ml 농도로 24 시간 처리하였다. 그 다음, T 세포 매개 세포사멸 유도의 주요 기능 단백질인 Granzyme B를 BioPORTER lipid 기반 전달기법을 이용하여 상기 CT26 P3 또는 TC-1 LP3 세포주에 전달하였다. 약 4~6시간 후 flow cytometry 장비를 통한 세포 내 active-caspase-3 수준 분석을 통하여 암세포의 세포사멸 정도를 확인하였다.
도 5a 및 5b에 나타난 바와 같이, 3F2 항체 처리 시 CT25 P3 또는 TC-1 LP0 세포의 세포사멸이 IgG 처리 세포 대비 약 3배 증가함을 확인할 수 있었다.
실험예 5.
(
in vivo
) 3F2 항체 투여를 통한 내성암 치료 효과 확인
먼저, balb/c 마우스(오리엔트바이오)에 피하로 마우스 1 두당 1x105의 CT26 P3 종양세포를 접종하고, 8 일차부터 3 일 간격으로 상기 실시예에서 선별된 3F2 항체(200 ug/100 ul) 200 ug를 4 회 복강주사 하였다(도 6a 참조).
다음으로, C57bl/6 마우스(오리엔트바이오)의 폐에 마우스 1 두당 5x104의 TC-1 LP3 종양세포를 주입하고, 3 일차부터 2 일 간격으로 상기 실시예에서 선별된 3F2 항체(200 ug/100 ul) 200 ug를 4 회 복강주사 하였다(도 6b 참조).
도 6a 및 6b에 나타난 바와 같이, CT26 P3 종양세포 주입 20 일 후 3F2 항체 처리군은 IgG 대조군 대비 종양의 체적이 약 10배 가까이 감소함을 확인할 수 있었다. 또한, TC-1 LP3 종양세포 주입 15 일 후 3F2 항체 처리 시 4 마리 중 3 마리의 종양이 치료되었음을 확인할 수 있었다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다.
Claims (12)
- Apoptosis inhibitor protein 5(API5)에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 다음을 포함하는 것인, 항체 또는 이의 항원 결합 단편:a) 서열번호 1의 아미노산 서열을 포함하는 CDR(complementarity determining region)-H(Heavy chain)1, 서열번호 2의 아미노산 서열을 포함하는 CDR-H2, 및 서열번호 3의 아미노산 서열을 포함하는 CDR-H3를 포함하는 중쇄 가변영역; 및b) 서열번호 4의 아미노산 서열을 포함하는 CDR-L(Light chain)1, 서열번호 5의 아미노산 서열을 포함하는 CDR-L2, 및 서열번호 6의 아미노산 서열을 포함하는 CDR-L3를 포함하는 경쇄 가변영역.
- 제1항에 있어서, 서열번호 7의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는, 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 API5는 인간 유래 API5 단백질 또는 마우스 유래 API5 단백질인, 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 가변영역의 프레임워크 서열은 인간 유래 프레임워크(framework) 서열로부터 유래하는 것인, 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 상기 중쇄 가변영역 및 상기 경쇄 가변영역을 포함하는 모노클로날 항체, 폴리클로날 항체, scFv, Fab, F(ab), F(ab)2, scFv-Fc, 미니바디, 다이아바디, 트리아바디, 테트라바디, 이중항체, 다중특이적 항체, 인간항체, 인간화 항체, 키메라 항체 또는 이들의 항원 결합 단편인, 항체 또는 이의 항원 결합 단편.
- 제1항 내지 제6항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
- 제7항의 핵산 분자를 포함하는 재조합 벡터.
- 제8항의 재조합 벡터를 포함하는, 분리된 숙주세포.
- 제1항 내지 제6항 중 어느 한 항의 API5에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편; 및 약제학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료용 약제학적 조성물.
- 제10항에 있어서, 상기 암은 항암 면역 내성암인, 약제학적 조성물.
- 제10항에 있어서, 상기 암은 뇌종양, 척수종양, 망막 세포종, 구강암, 비강암, 부비동암, 인두암, 후두암, 경부암, 피부암, 유방암, 갑상선암, 악성 부신 종양, 폐암, 흉막 종양, 식도암, 위암, 소장의 악성종양, 대장암, 항문암, 간암, 담도암, 췌장암, 신장암, 방광암, 전립선암, 고환암, 음경암, 자궁경부암, 자궁체부암, 융모상피암, 난소암, 급성 또는 만성 백혈병, 악성림프종, 다발성 골수증, 흑색종, 기저세포암, 편평상피세포암, 소아 백혈병 또는 소아 고형 종양으로 이루어진 군으로부터 선택되는 1종 이상의 암인, 약제학적 조성물.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2021-0103495 | 2021-08-05 | ||
KR1020210103495A KR102665886B1 (ko) | 2021-08-05 | 2021-08-05 | Api5에 특이적으로 결합하는 항체 및 이의 용도 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2023014128A1 true WO2023014128A1 (ko) | 2023-02-09 |
Family
ID=85155898
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/011593 WO2023014128A1 (ko) | 2021-08-05 | 2022-08-04 | Api5에 특이적으로 결합하는 항체 및 이의 용도 |
Country Status (2)
Country | Link |
---|---|
KR (1) | KR102665886B1 (ko) |
WO (1) | WO2023014128A1 (ko) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130210648A1 (en) * | 2009-01-14 | 2013-08-15 | The United States of America, as Represented by the Secretary, Department of Health and Human Services | Ratio based biomarkers and methods of use thereof |
KR20130102990A (ko) * | 2012-03-09 | 2013-09-23 | 고려대학교 산학협력단 | 항암면역우회암의 표시인자 및 무력화 표적으로서의 api5의 용도 |
KR20170096056A (ko) * | 2014-12-26 | 2017-08-23 | 닛토덴코 가부시키가이샤 | 세포사 유도제, 세포 증식 억제제 및 세포의 증식 이상에서 기인하는 질환의 치료용 의약 조성물 |
-
2021
- 2021-08-05 KR KR1020210103495A patent/KR102665886B1/ko active IP Right Grant
-
2022
- 2022-08-04 WO PCT/KR2022/011593 patent/WO2023014128A1/ko unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130210648A1 (en) * | 2009-01-14 | 2013-08-15 | The United States of America, as Represented by the Secretary, Department of Health and Human Services | Ratio based biomarkers and methods of use thereof |
KR20130102990A (ko) * | 2012-03-09 | 2013-09-23 | 고려대학교 산학협력단 | 항암면역우회암의 표시인자 및 무력화 표적으로서의 api5의 용도 |
KR20170096056A (ko) * | 2014-12-26 | 2017-08-23 | 닛토덴코 가부시키가이샤 | 세포사 유도제, 세포 증식 억제제 및 세포의 증식 이상에서 기인하는 질환의 치료용 의약 조성물 |
Non-Patent Citations (2)
Title |
---|
BOUSQUET GUILHEM, FEUGEAS JEAN-PAUL, GU YUCHEN, LEBOEUF CHRISTOPHE, BOUCHTAOUI MORAD EL, LU HE, ESPIÉ MARC, JANIN ANNE, BENEDETTO : "High expression of apoptosis protein (Api-5) in chemoresistant triple-negative breast cancers: an innovative target", ONCOTARGET, vol. 10, no. 61, 12 November 2019 (2019-11-12), pages 6577 - 6588, XP093032001, DOI: 10.18632/oncotarget.27312 * |
SONG K-H, CHO H, KIM S, LEE H-J, OH S J, WOO S R, HONG S-O, JANG H S, NOH K H, CHOI C H, CHUNG J-Y, HEWITT S M, KIM J-H, SON M, KI: "API5 confers cancer stem cell-like properties through the FGF2-NANOG axis", ONCOGENESIS, vol. 6, no. 1, pages e285 - e285, XP093032003, DOI: 10.1038/oncsis.2016.87 * |
Also Published As
Publication number | Publication date |
---|---|
KR20230022334A (ko) | 2023-02-15 |
KR102665886B1 (ko) | 2024-05-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2019098682A1 (ko) | 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체 | |
KR102340832B1 (ko) | 항 pd-1 항체 및 그의 용도 | |
CN113227146B (zh) | 密蛋白18.2结合部分和其用途 | |
WO2020111913A1 (en) | Anti-4-1bb antibody and use thereof | |
WO2014119969A1 (ko) | 보체 관련 질환의 예방 및 치료를 위한 c5 항체 및 방법 | |
JP7089806B2 (ja) | 悪性b細胞を特異的に認知する抗体またはその抗原結合断片、これを含むキメラ抗原受容体及びその用途 | |
CN110799546B (zh) | 重组双特异性抗体 | |
JP2022549639A (ja) | Cd39に対する高親和性抗体およびその使用 | |
WO2021107566A1 (ko) | C-kit에 대한 항체 및 이의 용도 | |
WO2019132533A1 (ko) | 항-pd-l1 항체 및 이의 용도 | |
WO2021091359A1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
WO2017074013A1 (ko) | 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도 | |
WO2023014128A1 (ko) | Api5에 특이적으로 결합하는 항체 및 이의 용도 | |
WO2019216675A1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
JP2021531821A (ja) | 効率的に発現されるegfr及びpd−l1二重特異性結合タンパク質 | |
WO2022025585A1 (ko) | 항-lilrb1 항체 및 그의 용도 | |
AU2021324738B2 (en) | Fusion protein comprising IL-12 and anti-fap antibody, and use thereof | |
CN116178561A (zh) | 包含SIRPα突变体的融合蛋白 | |
WO2023182866A1 (ko) | Hla-g 특이적 항체 및 이의 용도 | |
WO2017142294A1 (ko) | EGFRvIII에 대한 항체 및 이의 용도 | |
WO2024051223A1 (zh) | 药物组合及用途 | |
WO2024017281A1 (zh) | 多特异性抗体及其用途 | |
US20240117051A1 (en) | Therapeutic combination and use thereof | |
WO2020209559A1 (ko) | Gpnmb 및 cd3에 특이적으로 결합하는 이중특이적 항체 및 이의 용도 | |
WO2023167560A1 (ko) | Vegf-grab 및 pd-1 또는 pd-l1 길항제를 포함하는 병용 투여용 조성물 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22853503 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |