WO2023182866A1 - Hla-g 특이적 항체 및 이의 용도 - Google Patents

Hla-g 특이적 항체 및 이의 용도 Download PDF

Info

Publication number
WO2023182866A1
WO2023182866A1 PCT/KR2023/003977 KR2023003977W WO2023182866A1 WO 2023182866 A1 WO2023182866 A1 WO 2023182866A1 KR 2023003977 W KR2023003977 W KR 2023003977W WO 2023182866 A1 WO2023182866 A1 WO 2023182866A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
antibody
hla
Prior art date
Application number
PCT/KR2023/003977
Other languages
English (en)
French (fr)
Inventor
변성현
김착희
윤다슬
이종현
정승희
강현주
이정민
하경식
윤선하
김수영
박범찬
Original Assignee
에이치케이이노엔 주식회사
주식회사 와이바이오로직스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 에이치케이이노엔 주식회사, 주식회사 와이바이오로직스 filed Critical 에이치케이이노엔 주식회사
Publication of WO2023182866A1 publication Critical patent/WO2023182866A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70539—MHC-molecules, e.g. HLA-molecules
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to antibodies that specifically bind to HLA-G and their use in cancer treatment.
  • cancer is still a leading cause of death worldwide.
  • Many cancer treatment methods have been developed, and methods such as surgery, chemotherapy, and radiation therapy have continued to be used from the past to the present.
  • these existing cancer treatment methods are mostly effective only in the early stage when the cancer has not metastasized, and in a state where the cancer has already metastasized, there is a problem that there is a high possibility of recurrence in the future even if surgery is performed, for example. Accordingly, for more effective cancer treatment, research on immuno-anticancer drugs that utilize immune responses is continuing.
  • Anticancer immunotherapy is a treatment that prevents cancer cells from evading the body's immune system, allowing immune cells to better recognize and attack cancer cells.
  • cancer immunotherapy agents can induce the death of cancer cells through non-specific activation of immune cells, or induce an immune response against the tumor in the cancer patient's immune cells using tumor-specific antigens.
  • HLA-G human leukocyte antigen-G
  • ILT2 Ig-like transcript 2
  • ILT4 KIR2DL4
  • ITIM motif Immunoreceptor tyrosine- based inhibition motif
  • HLA-G Human Leukocyte AntigenG
  • the present inventors tried to develop HLA-G specific antibodies to increase the targeting ability of immune cells to cancer cells by inhibiting the function of HLA-G.
  • the present invention was completed by developing an HLA-G specific antibody that can bind to both HLA-G monomers and dimers.
  • the purpose of the present invention is to provide an HLA-G specific antibody or antigen-binding fragment thereof.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating cancer that provides an HLA-G specific antibody or antigen-binding fragment thereof as an active ingredient.
  • an anti-HLA-G antibody or antigen-binding fragment thereof comprising:
  • CDR1 heavy chain complementarity determining region 1 (CDR1) containing the amino acid sequence of SEQ ID NO: 1, heavy chain CDR2 containing the amino acid sequence of SEQ ID NO: 2, and heavy chain CDR3 containing the amino acid sequence of SEQ ID NO: 3; and
  • light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 5
  • light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 6
  • light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 7;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 9
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 10
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 11;
  • light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 13
  • light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 14
  • light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 15;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 17
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 18
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 19
  • a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 23;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 25
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 26
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 27;
  • a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 30, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 31.
  • the anti-HLA-G antibody or antigen-binding fragment thereof may include the following sequence:
  • a heavy chain variable region containing an amino acid sequence of SEQ ID NO: 4 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 4 and an amino acid sequence of SEQ ID NO: 8 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 8 A light chain variable region containing an amino acid sequence having homology;
  • a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 20 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 20, and an amino acid sequence of SEQ ID NO: 24 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 24 A light chain variable region containing an amino acid sequence having homology; or
  • a heavy chain variable region containing an amino acid sequence of SEQ ID NO: 28 or an amino acid sequence that is 80% or more homologous to the amino acid sequence of SEQ ID NO: 28, and an amino acid sequence of SEQ ID NO: 32 or an amino acid sequence that is 80% or more homologous to the amino acid sequence of SEQ ID NO: 32 A light chain variable region containing an amino acid sequence having homology.
  • the anti-HLA-G antibody or antigen-binding fragment thereof may include the following sequence:
  • antibody refers to a protein molecule that acts as a receptor that specifically recognizes an antigen, including immunoglobulin molecules that are immunologically reactive with a specific antigen.
  • the antibodies include monoclonal antibodies, polyclonal antibodies, mixtures of monoclonal and/or polyclonal antibodies, full-length antibodies, and antibody fragments.
  • Full-length antibody or intact antibody is used interchangeably to refer to an antibody that has a structure substantially similar to the native antibody structure or has heavy chains containing an Fc region as defined herein.
  • antibodies may include bivalent or bispecific molecules (e.g., bispecific antibodies). Additionally, the antibody may be a human antibody, humanized antibody, or chimeric antibody depending on the origin of the sequence.
  • the term “monoclonal antibody” refers to an antibody molecule of single molecular composition obtained from a population of substantially identical antibodies, and unlike polyclonal antibodies, which can bind to multiple epitopes, such monoclonal antibodies have a specific It exhibits single binding and affinity for the epitope.
  • full-length antibody is a structure having two full-length light chains and two full-length heavy chains, and each light chain is connected to the heavy chain by a disulfide bond.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types and is subclassed as gamma1 ( ⁇ 1), gamma2 ( ⁇ 2), and gamma3 ( ⁇ 3). ), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1), and alpha 2 ( ⁇ 2).
  • the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
  • IgG subtypes include IgG1, IgG2, IgG3, and IgG4.
  • the term “heavy chain” refers to a full-length heavy chain and fragments thereof comprising a variable region VH and three constant regions CH1, CH2, and CH3, including an amino acid sequence having a sufficient variable region sequence to confer specificity to an antigen. All can be included. Additionally, in the present invention, the term “light chain” may include both a full-length light chain including a variable region VL and a constant region CL containing an amino acid sequence having a sufficient variable region sequence to confer specificity to an antigen, and fragments thereof. there is.
  • chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remaining portion of the heavy and/or light chain is derived from a different source or species.
  • a chimeric antibody in which the variable region of a mouse antibody and the constant region of a human antibody are recombined, and the immune response is greatly improved compared to the mouse antibody.
  • the term “humanized antibody” refers to an antibody whose protein sequence has been modified to be similar to an antibody naturally produced in humans derived from a non-human species.
  • the humanized antibody can be manufactured by recombining mouse-derived CDRs with a human antibody-derived FR (framework region) to prepare a humanized variable region, and then recombining this with the constant region of a desired human antibody.
  • the affinity of the humanized antibody decreases, so the affinity of the original mouse antibody is increased by affinityizing several important FR amino acid residues that are thought to affect the three-dimensional structure of the CDR to those of the mouse antibody. It can be raised to the same level.
  • the present invention also provides an antigen-binding fragment of the anti-HLA-G antibody.
  • Antibody binding fragments include Fab (fragment antigen binding), Fab', F(ab')2, Fv (variable fragment), dsFv (disulfide-stabilized Fv fragments), scFv (single chain Fv), diabody, and tria. It may be selected from the group consisting of a triabody and a tetrabody.
  • fragment In the present invention, the terms “fragment”, “antibody fragment”, “antigen-binding fragment” or “antigen-binding domain” are used interchangeably to refer to any fragment of an antibody of the present invention that retains the antigen-binding function of the antibody. do.
  • exemplary antigen binding fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv.
  • the Fab has a structure that includes variable regions of the light and heavy chains, a constant region of the light chain, and the first constant region (CH1 domain) of the heavy chain, and has one antigen binding site.
  • Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C terminus of the heavy chain CH1 domain.
  • F(ab')2 antibody is produced when cysteine residues in the hinge region of Fab' form a disulfide bond.
  • Fv is a minimal antibody fragment containing only the heavy chain variable region and the light chain variable region, and the recombinant technology for generating the Fv fragment is described in PCT International Publication Patent Applications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 and It is disclosed in WO 88/09344, etc.
  • a two-chain Fv has the heavy chain variable region and a light chain variable region connected by a non-covalent bond, while a single-chain Fv (single-chain Fv) generally connects the heavy chain variable region and the short chain variable region through a peptide linker.
  • antibody fragments can be covalently linked or linked directly at the C-terminus to form a dimer-like structure, such as double-chain Fv.
  • Such antibody fragments can be obtained using proteolytic enzymes (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab')2 fragments can be obtained by digestion with pepsin), and are preferred. It can be produced through genetic recombination technology.
  • the diabody is a small bivalent antibody composed of two heavy chain variable domains and two light chain variable domains, and each light chain variable domain is connected to the heavy chain variable domain by a short linker.
  • the light chain variable domain can be linked to the heavy chain variable domain by a much shorter linker to form a triabody or tetrabody.
  • the antibody or antigen-binding fragment thereof of the present invention may include not only the sequence of the anti-HLA-G antibody described herein, but also its biological equivalent, to the extent that it can exhibit HLA-G binding ability.
  • additional changes can be made to the amino acid sequence of the antibody to further improve the binding affinity and/or other biological properties of the antibody.
  • Such modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the antibody. These amino acid mutations are made based on the relative similarity of amino acid side chain substitutions, such as hydrophobicity, hydrophilicity, charge, size, etc.
  • arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. So, based on the benefits, arginine, lysine and histidine; Alanine, glycine and serine; And phenylalanine, tryptophan, and tyrosine can be said to be biologically equivalent in function.
  • Another aspect of the invention is an isolated nucleic acid encoding the antibody or antigen-binding fragment thereof.
  • the antibodies and antigen-binding fragments thereof are as described above.
  • nucleic acid is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic structural units in nucleic acid molecules, are not only natural nucleotides, but also have sugars or base sites modified. Also includes analogues (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews (1990) 90:543-584). The sequences of the nucleic acid molecules encoding the heavy and light chain variable regions of the invention may be modified, including additions, deletions, or non-conservative or conservative substitutions of nucleotides.
  • the isolated nucleic acid may include the following sequence:
  • the isolated nucleic acid may include the following sequence:
  • Another aspect of the present invention is a recombinant vector containing the above nucleic acid molecule.
  • the term “vector” refers to a means for expressing a gene of interest in a host cell, including a plasmid vector; cosmid vector; And it includes viral vectors such as bacteriophage vectors, adenovirus vectors, retroviral vectors, and adeno-associated virus vectors, preferably plasmid vectors, but is not limited thereto.
  • the recombinant vector containing the nucleic acid molecule of the present invention contains the following CDRs, or is a nucleic acid molecule encoding a sequence comprising a heavy chain and/or light chain variable region containing the following CDRs. May include:
  • CDR1 heavy chain complementarity determining region 1 (CDR1) containing the amino acid sequence of SEQ ID NO: 1, heavy chain CDR2 containing the amino acid sequence of SEQ ID NO: 2, and heavy chain CDR3 containing the amino acid sequence of SEQ ID NO: 3; and
  • light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 5
  • light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 6
  • light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 7;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 9
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 10
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 11;
  • light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 13
  • light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 14
  • light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 15;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 17
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 18
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 19
  • a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 23;
  • heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 25
  • heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 26
  • heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 27;
  • a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 30, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 31.
  • the nucleic acid molecule encoding the light chain variable region and the nucleic acid molecule encoding the heavy chain variable region may be operatively linked to a promoter.
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence (e.g., a promoter, signal sequence, or array of transcriptional factor binding sites) and another nucleic acid sequence, thereby The regulatory sequences regulate transcription and/or translation of the other nucleic acid sequences.
  • a nucleic acid expression control sequence e.g., a promoter, signal sequence, or array of transcriptional factor binding sites
  • the recombinant vector system of the present invention can be constructed through various methods known in the related art, and the specific method is disclosed in Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press (2001) and this document is incorporated herein by reference.
  • the vector of the present invention can typically be constructed as a vector for cloning or as a vector for expression.
  • the recombinant vector of the present invention is preferably an expression vector. Additionally, the vector of the present invention can be constructed using prokaryotic cells or eukaryotic cells as hosts.
  • the vector of the present invention is an expression vector and a prokaryotic cell is used as a host
  • a strong promoter capable of advancing transcription e.g., tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter
  • rac5 promoter amp promoter
  • recA promoter recA promoter
  • SP6 promoter trp promoter
  • T7 promoter a transcription/translation termination sequence.
  • E. coli e.g., HB101, BL21, DH5 ⁇ , etc.
  • the promoter and operator region of the E e.g., HB101, BL21, DH5 ⁇ , etc.
  • coli tryptophan biosynthetic pathway (Yanofsky, C., J. Bacteriol., (1984) 158:1018- 1024) and the left-handed promoter of phage ⁇ (pL ⁇ promoter, Herskowitz, I. and Hagen, D., Ann. Rev. Genet., (1980) 14:399-445) can be used as a control region.
  • the promoter of the toxin protein gene of Bacillus thuringiensis Appl. Environ. Microbiol. (1998) 64:3932-3938; Mol. Gen. Genet. (1996) 250:734-741 ) or any promoter that can be expressed in Bacillus bacteria can be used as a control region.
  • the recombinant vector of the present invention is a plasmid often used in the related technical field (e.g., pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14 , pGEX series, pET series, and pUC19, etc.), phages (e.g., ⁇ gt4 ⁇ B, ⁇ -Charon, ⁇ z1, and M13, etc.), or viruses (e.g., SV40, etc.).
  • phages e.g., ⁇ gt4 ⁇ B, ⁇ -Charon, ⁇ z1, and M13, etc.
  • viruses e.g., SV40, etc.
  • promoters derived from the genome of mammalian cells e.g., metallothionein promoter, ⁇ -actin promoter, human heroglobin promoter, and human muscle creatine promoter
  • promoters derived from mammalian viruses e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, tk promoter of HSV, mouse mammary tumor virus (MMTV) promoter , the LTR promoter of HIV, the promoter of Moloney virus, the promoter of Epstein-Barr virus (EBV), and the promoter of Rouss sarcoma virus (RSV))
  • the recombinant vector of the present invention may contain a CMV promoter.
  • the recombinant vector of the present invention can be fused with other sequences to facilitate purification of the antibody expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA), and 6x His (hexahistidine; Quiagen, USA).
  • the protein expressed by the vector of the present invention is an antibody, the expressed antibody can be easily purified through a protein A column, etc., without additional sequences for purification.
  • the recombinant vector of the present invention contains an antibiotic resistance gene commonly used in the related technical field as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neo. May contain resistance genes for mycin and tetracycline.
  • the anti-HLA-G expression vector may include an ampicillin resistance gene.
  • the vector expressing the antibody of the present invention can be either a vector system in which the light and heavy chains are simultaneously expressed in one vector, or a system in which the light and heavy chains are expressed in separate vectors. In the latter case, the two vectors are introduced into the host cell through co-transformation and targeted transformation.
  • Simultaneous transformation is a method of simultaneously introducing vector DNA encoding light and heavy chains into a host cell and then selecting cells that express both light and heavy chains.
  • Targeted transformation selects cells transformed with a vector containing a light chain (or heavy chain) and transforms the selected cells expressing the light chain again with a vector containing a heavy chain (or light chain) to express both light and heavy chains. This is the final method of selecting cells.
  • Nucleic acids encoding the heavy and light chains of the antibody of the present invention are inserted into an expression vector encoding the heavy chain constant regions and light chain constant regions of human IgG1, IgG2, and IgG4.
  • the light and heavy chains can be cloned in the same or different expression vectors.
  • DNA sequences encoding immunoglobulin chains are operably linked to control sequences in expression vector(s) that ensure expression of the immunoglobulin polypeptides.
  • control sequences include signal sequences, promoters, enhancers, and transcription termination sequences.
  • An expression vector is an essential part of the host chromosomal DNA or an episome that can be replicated in the host organism.
  • expression vectors encoding the heavy and light chains allow for expression of the two chains, which can be assembled to form an intact antibody in vivo or in vitro. Can be co-transfected into one host cell.
  • an expression vector encoding the heavy chain and an expression vector encoding the light chain can be introduced into different host cells for expression of the heavy and light chains respectively, which can then be purified to form intact antibodies in vitro. and can be assembled.
  • Antibodies or fragments thereof as described herein can be produced in prokaryotic or eukaryotic expression systems, such as bacterial, yeast, filamentous fungi, insects, and mammalian cells. Recombinant antibodies of the invention do not necessarily need to be glycosylated or expressed in eukaryotic cells, but expression in mammalian cells is generally preferred.
  • HEK 293 cells human embryonic kidney cell line
  • BHK cells baby hamster kidney cells
  • BHK cells baby hamster kidney cells
  • CHO-S Chinese hamster ovary cells/- or + DHFR
  • CHO-S Chinese hamster ovary cells/- or + DHFR
  • CHO-DG44 Chinese hamster ovary cells/- or + DHFR
  • VEO cells African green monkey kidney cells
  • Hep G2 cells human liver cells
  • Expression vectors for such cells can include origins of replication, expression control sequences such as promoters and enhancers, and necessary processing information sites such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcription terminator sequences.
  • Preferred expression control sequences are promoters derived from immunoglobulin genes, SV40, adenovirus, bovine papillomavirus, cytomegalovirus, etc.
  • Vectors containing plasmid sequences that produce antibodies can be transferred into host cells by well-known methods, which may vary depending on the type of host cell.
  • Another aspect of the present invention is a host cell containing the above recombinant vector.
  • the host cell of the present invention is a host cell transformed with a recombinant vector.
  • the host cell capable of stably and continuously cloning and expressing the vector of the present invention may be any host cell known in the art, such as Escherichia coli , Bacillus subtilis and Bacillus chew.
  • Bacillus genus strains such as Lingensis, Streptomyces , Pseudomonas (e.g. Pseudomonas putida ), Proteus mirabilis or Staphylococcus ( Examples include, but are not limited to, prokaryotic host cells such as Staphylocus carnosus .
  • Suitable eukaryotic host cells transformed with the vector include fungi such as Aspergillus species, Pichia pastoris , Saccharomyces cerevisiae , and Schizosaccharoma. They may be cells of yeast such as Schizosaccharomyces and Neurospora crassa , other lower eukaryotic cells, higher eukaryotic cells such as insect-derived cells, and cells derived from plants or mammals. It is not limited.
  • the host cells include monkey kidney cells (COS7), NSO cells, SP2/0, Chinese hamster ovary (CHO) cells, W138, and baby hamster kidney (BHK) cells. , MDCK (Mardin Darby canine kidney) cells, myeloma cell lines, HuT 78 cells or 293 cells.
  • COS7 monkey kidney cells
  • NSO cells NSO cells
  • SP2/0 Chinese hamster ovary
  • CHO Chinese hamster ovary
  • W138 Chinese hamster ovary
  • BHK baby hamster kidney
  • MDCK Mardin Darby canine kidney
  • myeloma cell lines HuT 78 cells or 293 cells.
  • Mammalian host cell cultures are preferred for expressing and producing anti-HLA-G antibodies or antigen-binding fragments thereof, as many suitable host cell lines have been developed in the art that are capable of secreting intact immunoglobulins.
  • “transformation” and/or “transfection” into a host cell includes any method of introducing a nucleic acid into an organism, cell, tissue or organ, and as known in the art, is suitable for the host cell. This can be done by selecting standard techniques. The above methods include electroporation, protoplast fusion, calcium phosphate (CaPO 4 ) precipitation, calcium chloride (CaCl 2 ) precipitation, stirring using silicon carbide fibers, agrobacteria-mediated transformation, PEG, and dextran sulfate. , lipofectamine, and desiccation/inhibition mediated transformation methods, etc., but are not limited thereto.
  • Another aspect of the present invention is a method for producing an anti-HLA-G antibody or antigen-binding fragment thereof, comprising culturing the transformed host cell of the present invention.
  • the method for producing an anti-HLA-G antibody or antigen-binding fragment thereof of the present invention may further include the step of expressing the anti-HLA-G antibody or antigen-binding fragment thereof in cultured transformed host cells.
  • the transformed cells can be cultured according to appropriate media and culture conditions known in the related art. This culture process can be easily adjusted and used by a person skilled in the art according to the selected strain.
  • These various culture methods are disclosed in various literature (e.g., James M. Lee, Biochemical Engineering, Prentice-Hall International Editions, 138-176). Cell culture is divided into suspension culture and adherent culture depending on the growth method of the cells, and batch, fed-batch, and continuous culture depending on the culture method. The medium used for culture must appropriately meet the requirements of the specific strain.
  • the medium contains various carbon sources, nitrogen sources, and trace element components.
  • carbon sources that can be used include carbohydrates such as glucose, sucrose, lactose, fructose, maltose, starch and cellulose, fats such as soybean oil, sunflower oil, castor oil and coconut oil, fatty acids such as palmitic acid, stearic acid and linoleic acid, It may include alcohols such as glycerol and ethanol, and organic acids such as acetic acid, and these carbon sources may be used alone or in combination.
  • Nitrogen sources that can be used in the present invention include organic nitrogen sources such as peptone, yeast extract, broth, malt extract, corn steep liquor (CSL) and soybean wheat, and urea, ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate.
  • organic nitrogen sources such as peptone, yeast extract, broth, malt extract, corn steep liquor (CSL) and soybean wheat
  • urea ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate.
  • the medium may include, as ingredients, potassium dihydrogen phosphate, dipotassium hydrogen phosphate and the corresponding sodium-containing salts. Additionally, it may contain metal salts such as magnesium sulfate or iron sulfate.
  • amino acids, vitamins, and appropriate precursors may be included.
  • compounds such as ammonium hydroxide, potassium hydroxide, ammonia, phosphoric acid, and sulfuric acid can be added to the culture in an appropriate manner to adjust the pH of the culture. Additionally, during culturing, foam generation can be suppressed by using an antifoaming agent such as fatty acid polyglycol ester. Additionally, in order to maintain the aerobic state of the culture, oxygen or oxygen-containing gas (eg, air) is injected into the culture.
  • the temperature of the culture is usually 20°C to 45°C, preferably 25°C to 40°C, but is not limited thereto.
  • Antibodies obtained by culturing transformed host cells can be used in an unpurified state and can be further purified to high purity using various conventional methods, such as dialysis, salt precipitation, and chromatography.
  • various conventional methods such as dialysis, salt precipitation, and chromatography.
  • the method using chromatography is the most widely used, and the type and order of columns can be selected from ion exchange chromatography, size exclusion chromatography, affinity chromatography, etc., depending on the characteristics of the antibody, culture method, etc.
  • the anti-HLA-G antibody according to the present invention is produced using the multimeric structure of HLA-G as an antigen and is characterized by being able to bind to both HLA-G monomers and multimers. Since it is known that HLA-G suppresses the activation of immune cells and is overexpressed in cancer cells, the present inventors confirmed the anti-cancer ability of anti-HLA-G antibodies.
  • anti-HLA-G antibody inhibits the binding of HLA-G and CD8a (Table 4).
  • PBMC effector cells
  • target cells treated with anti-HLA-G antibodies were mixed and co-cultured with cancer cells, cancer cells were killed ( Figure 3) and tumor growth was suppressed in tumor-induced mice (Table 6).
  • another aspect of the present invention provides a pharmaceutical composition for use in the prevention or treatment of cancer containing the antibody or antigen-binding fragment thereof of the present invention as an active ingredient.
  • the pharmaceutical composition can be used for the treatment of cancer overexpressing HLA-G, but is not limited thereto.
  • the above cancers include pancreatic cancer, breast cancer, ovarian cancer, glioma, cervical cancer, endometrial cancer, esophageal cancer, stomach cancer, liver cancer, lung cancer, colon cancer, nasopharyngeal cancer, oral cancer, thyroid cancer, prostate cancer, kidney cancer, gallbladder cancer, bile duct cancer, and blood cancer. and melanoma.
  • the blood cancer is acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), chronic myelogenous leukemia (CML), multiple myeloma (MM), or lymphoma ( Lymphoma).
  • AML acute myeloid leukemia
  • ALL acute lymphoblastic leukemia
  • CML chronic myelogenous leukemia
  • MM multiple myeloma
  • Lymphoma lymphoma
  • prevention refers to any action that suppresses or delays the progression of a disease by administering the composition of the present invention
  • treatment refers to suppressing, alleviating, or eliminating the development of a disease.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, and the pharmaceutically acceptable carrier is one commonly used in formulations, such as lactose, dextrose, sucrose, sorbitol, mannitol, starch. , acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methylcellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, stear. Includes, but is not limited to, magnesium acid and mineral oil.
  • composition for preventing or treating cancer of the present invention may further include lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc. in addition to the above components.
  • lubricants wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc.
  • suitable pharmaceutically acceptable carriers and agents are described in detail in Remington's Pharmaceutical Sciences (19th ed., 1995).
  • the pharmaceutical composition of the present invention can be administered orally or parenterally, and in the case of parenteral administration, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc. It can be administered.
  • parenteral administration intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc. It can be administered.
  • proteins or peptides are digested, so oral compositions can be formulated to coat the active agent or protect it from degradation in the stomach, and the composition of the present invention can be used in any device through which the active agent can move to target cells. It can be administered by.
  • the appropriate dosage of the pharmaceutical composition of the present invention varies depending on factors such as formulation method, administration method, patient's age, weight, gender, pathological condition, food, administration time, administration route, excretion rate, and reaction sensitivity, and is usually A skilled doctor can easily determine and prescribe an effective dosage for desired treatment or prevention.
  • the daily dosage of the pharmaceutical composition of the present invention may be 0.1-100 mg/kg, preferably 0.1-10 mg/kg, and more preferably 0.1-2 mg/kg.
  • the term “pharmaceutically effective amount” refers to an amount sufficient to treat, prevent, and diagnose a disease.
  • the pharmaceutical composition of the present invention is prepared in unit dosage form by formulating using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by a person skilled in the art to which the present invention pertains. Alternatively, it can be manufactured by placing it in a multi-capacity container. At this time, the formulation may be in the form of a solution, suspension, or emulsion in an oil or aqueous medium, or may be in the form of an extract, powder, suppository, powder, granule, tablet, or capsule, and may additionally contain a dispersant or stabilizer.
  • composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents.
  • the antibody or antigen-binding fragment thereof of the present invention can be used to treat cancer by being administered into the body in the form of an antibody-therapeutic agent (functional molecule) or bispecific antibody-therapeutic agent (functional molecule) conjugate.
  • an antibody-therapeutic agent functional molecule
  • bispecific antibody-therapeutic agent functional molecule
  • the antibody or antigen-binding fragment thereof of the present invention can be additionally combined with a functional molecule or administered in combination and used for the prevention, treatment, and diagnosis of diseases related to HLA-G overexpression.
  • the functional molecules may include chemicals, radionuclides, immunotherapeutics, cytokines, chemokines, toxins, biological agents, and enzyme inhibitors.
  • Another aspect of the present invention is a disease related to HLA-G overexpression, comprising administering the antibody or antigen-binding fragment thereof of the present invention, or the pharmaceutical composition in a pharmaceutically effective amount to a subject, such as a human or non-human mammal,
  • a subject such as a human or non-human mammal
  • the present invention also provides a method for diagnosing diseases related to HLA-G overexpression, such as cancer, comprising the step of administering the antibody or antigen-binding fragment thereof of the present invention to an individual in need, such as a human or a non-human mammal. provides.
  • the term "individual” refers to monkeys, cows, horses, sheep, pigs, chickens, turkeys, quail, cats, dogs, mice, rats, including humans who have or may develop diseases related to HLA-G overexpression. This means any animal, including rabbits or guinea pigs.
  • the inventors of the present invention confirmed the binding site between the antibody and HLA-G, and as a result, amino acids 339 - 344 (DYEATL), amino acids 390 - 402 (VVVPSGEEQRYTC), and amino acid 323 of the amino acid sequence of the antigen (SEQ ID NO: 33) used for antibody screening. -338 (QRADPPKTHVTHHPVF) was confirmed to be an epitope.
  • HLA-G epitope consisting of a sequence selected from the group consisting of SEQ ID NOs: 34 to 36.
  • epitope refers to a localized site of an antigen to which an antibody or fragment thereof can specifically bind.
  • Epitopes generally consist of surface groups of molecules such as amino acids or sugar side chains, and generally have specific three-dimensional structural characteristics and specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that in the presence of a denaturing solvent, binding is lost to the conformational epitope but not to the non-conformational epitope.
  • Epitopes include amino acid residues directly involved in binding (also referred to as immunodominant components of the epitope) and other amino acid residues not directly involved in binding, such as amino acid residues that are effectively blocked by specific antigen-binding peptides (i.e., amino acid residues that are effectively blocked by a specific antigen-binding peptide). present within the footprint of a specific antigen binding peptide).
  • the present invention also provides an antibody that specifically binds to the HLA-G epitope, and specific examples of the antibody are the same as described above, but are not limited thereto.
  • the anti-HLA-G antibody according to the present invention can bind to both monomers and multimers of HLA-G and thus can effectively block the binding of HLA-G to its receptor.
  • Figure 1 shows a schematic diagram for producing a b2m-HLA-G antigen according to an example of the present invention.
  • Figure 2 shows the vector structure used to produce anti-HLA-G antibodies.
  • Figure 3 shows the degree of cancer cell death after mixing HLA-G overexpressing target cells treated with anti-HLA-G antibody with PBMC and co-culturing the mixed cells with SK-OV-3 cells or MDA-MB-231 cells. This is the result of checking.
  • Figure 4 shows that 4T-1 cells overexpressing human HLA-G were transplanted into mice to induce tumors, and after administering anti-HLA-G antibodies, the tumors were isolated and the levels of cytotoxic T cells/regulatory T cells were confirmed. It is a result.
  • Figure 5 shows the results of confirming the epitope sequence to which anti-HLA-G antibody binds to HLA-G.
  • HLA-G-specific antibodies and suppress the action mechanism of HLA-G an antigen similar to the multimer structure of b2m-HLA-G, the activated form of HLA-G, was produced.
  • a protein sequence was designed linking signal peptide-b2m-HLA-G-6X His.
  • a DNA sequence was designed using this protein sequence ( Figure 1).
  • the DNA sequence was introduced into animal cells, the protein was expressed, and then purified. Specifically, the cell culture medium containing the signal peptide-b2m-HLA-G-6X His antigen was first purified using an NI-NTA column. Afterwards, monomers and dimers were separated from the result of the first purification using size exclusion chromatography.
  • Antigen production is not limited to the animal cells, and expression and purification in, for example, E. coli is also possible.
  • SEQ ID NO: 33 Antigen sequence
  • the above signal increase indicates that the selected phage is rich in HLA-G antigen-specific binders.
  • phagemid DNA of the phages selected from the library was extracted. 96 clones were isolated and cultured on 24 well plates. The supernatant containing phage particles was tested by phage-ELISA method, and the DNA of clones showing HLA-G specific binding was isolated and sequenced.
  • HLA-G-specific antibodies For the maturation of HLA-G-specific antibodies, mutations were introduced into CDR1, 2, and 3 of the heavy and light chains to obtain various heavy and light chain products. The products were combined, and HLA-G-specific mature antibodies were obtained through ELISA analysis using HLA-A, HLA-B, HLA-C, and HLA-G to select HLA-G-specific antibodies.
  • an antibody was produced using the vector structure in Figure 2.
  • the vector includes a human cytomegalovirus promoter (CMV promotor) for animal cell expression, a Kozak sequence to enhance expression, a signal sequence for extracellular movement of the expressed protein, a variable region cloning site, and an IgG1 light chain or Heavy chain constant region coding sequence, Woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), ampicillin resistance gene and pUC for amplification of the plasmid in E. coli are included.
  • CMV promotor human cytomegalovirus promoter
  • WPRE Woodchuck hepatitis virus posttranscriptional regulatory element
  • ampicillin resistance gene and pUC for amplification of the plasmid in E. coli are included.
  • variable region cloning site contained HindIII and EcoR1 restriction enzymes, so the expression vector was treated with the restriction enzymes, and then the PCR product of the heavy or light chain variable region was inserted into the vector using an infusion enzyme (TAKARA).
  • TAKARA infusion enzyme
  • the heavy chain constant domains of IgG2, IgG3 and IgG4 may also be used.
  • the light chain expression vector and the heavy chain expression vector were transduced into Expi 293 cells using a transduction kit (Thermo), and the cells were cultured. Cell culture was harvested 4 to 6 days later, cells were removed, and only the supernatant was recovered. The recovered supernatant was filtered through a 0.45 um filter, and the filtered culture fluid was purified using a Mabselect (Cytiva) purification column in an AKTA purifier to obtain an antibody that specifically binds to human HLA-G.
  • Anti-HLAG antibody (SEQ ID of complementarity determining region (CDR)) Anti-HLAG antibody CDR-H1 CDR-H2 CDR-H3 VH CDR-L1 CDR-L2 CDR-L3 V.L.
  • antibody 1 sequence number One sequence number 2 sequence number 3 sequence number 4 sequence number 5 sequence number 6 sequence number 7 sequence number 8 antibody 2 sequence number 9 sequence number 10 sequence number 11 sequence number 12 sequence number 13 sequence number 14 sequence number 15 sequence number 16 antibody 3 sequence number 17 sequence number 18 sequence number 19 sequence number 20 sequence number 21 sequence number 22 sequence number 23 sequence number 24 antibody 4 sequence number 25 sequence number 26 sequence number 27 sequence number 28 sequence number 29 sequence number 30 sequence number 31 sequence number 32
  • Example 2 The anti-HLA-G specific antibody obtained in Example 2 was screened for binding characteristics to the HLA-G antigen prepared in Example 1. The analysis results are summarized in Table 3 below.
  • anti-HLA-G specific antibodies showed nanomolar KD values for HLA-G multimers and had high affinity to the antigen.
  • anti-HLA-G specific antibodies were obtained from HLA-G multimers and showed higher affinity for multimers than monomers.
  • anti-HLA-G specific antibodies have high affinity for HLA-G multimers, it was confirmed whether the antibodies could inhibit the binding between ILT2 (Ig-like transcript 2) and HLA-G multimers.
  • Receptor Binding Inhibition 1 Inhibition of ILT2 binding to HLA-G by anti-HLA-G antibodies
  • ILT-2-Fc was diluted in 1x DPBS to a concentration of 1.5 ⁇ g/mL.
  • 150 ng/100 uL of diluted ILT-2 protein was dispensed into each well of a 96-well immune plate.
  • the immune plate was stored overnight at 4°C to immobilize the ILT-2 protein on the surface of the well.
  • the ILT-2 protein solution was completely removed, and each well was washed with 200 uL of 1x PBS-T. 200 ul of blocking solution was dispensed into each well, and then reacted at 37°C for 1 hour to block non-specific protein binding.
  • the antigen prepared in Example 1 was diluted in blocking solution to 1,200 nM, which is twice the concentration to be treated.
  • the anti-HLA-G single antibody was diluted in blocking solution to 2,000 nM, which is twice the concentration to be treated, and serially diluted three times to 0.914 nM.
  • Example 1 The prepared antigen of Example 1 and the anti-HLA-G single antibody diluted by concentration were mixed in a 1:1 ratio and 120 ul was dispensed into each well, followed by pre-incubation at 37°C for 30 minutes. . After completely removing the blocking solution from each well, the cells were washed with PBS-T.
  • Table 4 shows the results of confirming by ELISA analysis the concentration of antibody that inhibits the interaction between HLA-G:ILT2 by more than 50% when treating the interaction between unblocked HLA-G:ILT2 with different concentrations of antibodies. am.
  • the antibody obtained in Example 2 was shown to inhibit HLA-G:ILT2 binding by more than 50% at the 150nM level.
  • HLA-G expressing cells were seeded 3.0 in a 96-well microplate on day 0 (D0) of the experiment. E+05 cells were distributed and cultured at a concentration of cells/well. On the first day of the experiment, the supernatant of the cells was removed.
  • the anti-HLA-G single antibody was diluted in blocking solution to 200 nM, which is twice the concentration to be treated, and serially diluted 6 times to 0.714 pM. This diluted solution was dispensed into the well from which the supernatant was removed and reacted for 30 minutes.
  • ILT2-mFc protein was diluted to 100 ug/mL and then dispensed into the antibody-cell reaction solution and reacted for 1 hour.
  • the negative control group, IgG1 treatment did not inhibit the binding of HLA-G and ILT2 even at high concentrations, but the antibody obtained in Example 2 inhibited the binding of HLA-G and ILT2 in a concentration-dependent manner.
  • the antibody concentration (EC50) at which HLA-G expressing cell:ILT2 binding was less than 50% was confirmed, and the obtained antibody effectively inhibits the binding of IHLA-G and LT2 on the cell surface at the nanomolar level. It was found that (Table 4).
  • Receptor binding inhibition 2 Inhibition of binding of CD8a to HLA-G by anti-HLA-G antibodies
  • the dimeric antigen prepared in Example 1 was diluted in PBS solution to a concentration of 5 ug/mL. 100 ul of the diluted antigen was dispensed into a 96-well microplate, and the wells were coated with the antigen for 24 hours.
  • Blocking was performed by dispensing 100 ⁇ L of blocking solution into each well of a streptavidin 96 well plate.
  • the blocking solution was prepared by dissolving skim milk at a concentration of 4% in PBS containing 1% Tween-20.
  • Each well of the streptavidin 96 well plate was washed three times with 100 ⁇ l of PBS containing 0.1% Tween-20.
  • the anti-HLA-G antibody was diluted in blocking solution to a final concentration of 0.391 nM.
  • the diluted anti-HLA-G antibody was dispensed into 96 wells and reacted for 1 hour.
  • CD8a-His at a concentration of 100 nM diluted in blocking solution was dispensed into each well and reacted for 1 hour.
  • each well was washed with PBS-T.
  • Anti-CD8a-HRP a CD8a detection antibody, was diluted in blocking solution and dispensed into each well. After reacting for 1 hour, each well was washed with PBS-T, and TMB solution was added to each well to develop color. The reaction was terminated by adding 1N sulfuric acid, and the absorbance was measured at 450 nM with a microplate reader.
  • Example 5 Confirmation of cancer cell death using PBMC (peripheral blood mononuclear cell)
  • SK-OV-3 cells or MDA-MB-231 cells overexpressing HLA-G were cultured in an incubator at 37°C for 24 hours. After culturing, the HLA-G overexpressing cells (target cells) were pretreated with anti-HLA-G antibody at a concentration of 100 nM for 1 hour at 37°C. PBMC (effector cells) and antibody-treated target cells were mixed at a ratio of 5:1 and co-cultured with SK-OV-3 cells or MDA-MB-231 cells for 48 hours.
  • the cell culture medium was recovered.
  • the level of LDH (lactate dehydrogenase) from the recovered cell culture was measured using a cytotoxicity assay kit (cytotox96 non-radioactive cytotoxicity assay, Promega) according to the manufacturer's protocol. Since the LDH is released during cell death, the degree of cell death can be determined by measuring the LDH level.
  • anti-HLA-G antibody 2 As a result of the measurement, it was confirmed that anti-HLA-G antibody 2, antibody 1, and antibody 3 increased the cancer cell killing ability of PBMC compared to the negative control group (IgG1 pretreatment) that did not specifically bind to HLA-G ( Figure 3 ).
  • mice 4T-1 cells overexpressing human HLA-G were transplanted into the right abdominal cavity of Balb/c mice. Tumor growth was observed 7 to 14 days after transplantation, and mice were grown until the tumor size grew above a certain level (100 mm3). When the tumor size reached the desired size, the tumor-implanted mice were randomly grouped according to the test groups in Table 5.
  • mg/kg mpk
  • BIW fetal calf serum
  • TGI Tumor Growth Inhibition
  • Antibody 4 showed a tumor growth inhibition effect of 24.9% when 10 mpk was administered, and Antibody 1, Antibody 2, and Antibody 3 showed a tumor growth inhibition effect of more than 20% even when 1 mpk was administered (Table 6).
  • tumor tissues were isolated from mice treated with anti-HLA-G antibodies, and immune cells that had infiltrated into the tumors were analyzed.
  • the action of cancer immunotherapy drugs changes the pool of immune cells in tumor tissue, and cancer cells are killed due to activation of immune cells.
  • Cytotoxic T cells are representative immune cells with the function of killing cancer cells, and regulatory T (Treg) cells are representative immune suppressors.
  • the quenching buffer contains 100mM potassium phosphate, 1M urea, and 500mM TCEP (Tris(2-carboxyethyl)phosphine hydrochloride) (pH 2.5).
  • Epitope mapping used hydrogen deuterium exchange mass spectrometry (HDX-MS) technology, ⁇ 2M-HLA-G was used as the antigen, and anti-HLA-G antibody 1 or 2 was used as the antibody.
  • HDX-MS hydrogen deuterium exchange mass spectrometry

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 HLA-G에 특이적으로 결합하는 항체 및 이의 암 치료 용도에 관한 것으로 상기 항체는 HLA-G 단량체 및 다량체 모두에 결합하여 HLA-G가 이의 수용체에 결합하는 것을 방지할 수 있으므로 암 치료 용도로 유용하게 사용될 수 있다.

Description

HLA-G 특이적 항체 및 이의 용도
본 발명은 HLA-G에 특이적으로 결합하는 항체 및 이의 암 치료 용도에 관한 것이다.
지난 수십 년간 암에 대한 집중적인 연구가 이루어졌음에도 불구하고 여전히 암은 전세계적으로 주요한 사망 원인이다. 다수의 암 치료 방법들이 개발되었으며, 외과적 수술, 화학요법, 방사선 요법 등의 방법은 예전부터 현재까지 계속 이용되고 있다. 그러나 이러한 기존의 암 치료 방법들은 암이 전이되지 않은 초기 상태에만 효과가 있는 경우가 대부분이며, 이미 전이가 진행된 상태에서는 예컨대 외과적 수술을 하더라도 추후 재발의 가능성이 높다는 문제점이 있다. 이에 보다 효과적인 암 치료를 위해 최근에는 면역 반응을 이용하는 면역항암제에 대한 연구가 계속되고 있다.
면역항암제는 암세포가 인체의 면역체계를 회피하지 못하게 함으로서 면역세포가 암세포를 더 잘 인식해 공격하도록 하는 치료제이다. 구체적으로 면역항암제는 비특이적인 면역세포 활성화를 통해 암세포의 사멸을 유도하거나, 종양 특이적 항원을 이용하여 암 환자의 면역세포에서 종양에 대한 면역 반응을 유도할 수 있다.
한편, 인간 주요 조직적합성 복합체 클래스 I, G는 인간 백혈구 항원 G (Human leukocyte antigen-G, HLA-G)로도 알려져 있는 면역관문인자로 T 세포, NK 세포, 세포독성 (cytotoxic) T 세포 등의 활성 및 분열을 억제한다. HLA-G의 면역세포 수용체는 ILT2 (Ig-like transcript 2), ILT4, KIR2DL4 (Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long cytoplasmic tail 4)로 알려져 있으며, 이 수용체들은 모두 ITIM 모티프 (immunoreceptor tyrosine-based inhibitory motif)를 가지고 있다. HLA-G가 수용체에 결합하면 이 모티프로 인해 면역세포를 억제하는 신호전달체계가 활성화된다.
일반세포에서 HLA-G의 발현은 제한적이나, 많은 종류의 암세포에서 HLA-G가 발현되는 것으로 보고되었다 (Lin A, Yan WH. Human Leukocyte AntigenG (HLA-G) Expression in Cancers: Roles in Immune Evasion, Metastasis and Target for Therapy. Mol Med. 21(1), 782-791 (2015)). 또한, 다수의 암환자의 암세포에서 HLA-G의 발현량과 암 질병의 기수와 연관성이 나타난다는 보고가 있으며, HLA-G 발현 환자는 생존률이 낮다는 보고도 있다 (Ye, Sr., Yang, H., Li, K. et al. Human leukocyte antigen G expression: as a significant prognostic indicator for patients with colorectal cancer. Mod Pathol 20, 375-383 (2007)).
상기와 같은 상황에서 본 발명자들은 HLA-G의 기능을 억제함으로써 암세포에 대한 면역세포의 표적 능력을 높이기 위해 HLA-G 특이적 항체를 개발하기 위해 노력하였다. 그 결과, HLA-G 단량체 및 이량체 모두에 결합할 수 있는 HLA-G 특이적 항체를 개발하여 본 발명을 완성하였다.
따라서 본 발명의 목적은 HLA-G 특이적 항체 또는 이의 항원 결합 단편을 제공하는 것이다.
또한, 본 발명의 다른 목적은 HLA-G 특이적 항체 또는 이의 항원 결합 단편을 유효성분으로 제공하는 암의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
상기 목적을 달성하기 위하여 본 발명의 일 양상은 하기를 포함하는 항-HLA-G 항체 또는 이의 항원 결합 단편을 제공한다:
(a) 서열번호 1의 아미노산 서열을 포함하는 중쇄 상보성 결정 부위 1 (complementarity determining region 1, CDR1), 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR3;
(b) 서열번호 9의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 10의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 11의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 13의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 14의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 15의 아미노산 서열을 포함하는 경쇄 CDR3;
(c) 서열번호 17의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 18의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 19의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 21의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 22의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 23의 아미노산 서열을 포함하는 경쇄 CDR3; 또는
(d) 서열번호 25의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3.
본 발명에서, 상기 항-HLA-G 항체 또는 이의 항원 결합 단편은 하기 서열을 포함할 수 있다:
(a) 서열번호 4의 아미노산 서열 또는 서열번호 4의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8의 아미노산 서열 또는 서열번호 8의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변영역;
(b) 서열번호 12의 아미노산 서열 또는 서열번호 14의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 16의 아미노산 서열 또는 서열번호 16의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변영역;
(c) 서열번호 20의 아미노산 서열 또는 서열번호 20의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 24의 아미노산 서열 또는 서열번호 24의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변영역; 또는
(d) 서열번호 28의 아미노산 서열 또는 서열번호 28의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 32의 아미노산 서열 또는 서열번호 32의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변영역.
보다 구체적으로 본 발명의 일 구체예에서, 상기 항-HLA-G 항체 또는 이의 항원 결합 단편은 하기 서열을 포함할 수 있다:
(a) 서열번호 4의 아미노산 서열로 이루어지는 중쇄 가변영역 및 서열번호 8의 아미노산 서열로 이루어지는 경쇄 가변영역;
(b) 서열번호 12의 아미노산 서열로 이루어지는 중쇄 가변영역 및 서열번호 16의 아미노산 서열로 이루어지는 경쇄 가변영역;
(c) 서열번호 20의 아미노산 서열로 이루어지는 중쇄 가변영역 및 서열번호 24의 아미노산 서열로 이루어지는 경쇄 가변영역; 또는
(d) 서열번호 28의 아미노산 서열로 이루어지는 중쇄 가변영역 및 서열번호 32의 아미노산 서열로 이루어지는 경쇄 가변영역.
본 발명에서 용어, "항체"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미한다. 상기 항체에는 단일 클론 항체, 다클론 항체, 단일클론 및/또는 다중클론 항체의 혼합물, 전장 항체(full-length antibody) 및 항체 단편이 모두 포함된다. 전장 항체 또는 온전한 항체(intact antibody)는 천연 항체 구조와 실질적으로 유사한 구조를 가지거나, 본원에서 정의된 바와 같은 Fc 영역을 함유하는 중쇄를 갖는 항체를 언급하기 위해 상호 교환적으로 사용된다.
또한, 항체는 이가 (bivalent) 또는 이중 특이성 분자(예컨대, 이중특이성 항체)를 포함할 수 있다. 아울러, 항체는 서열의 유래에 따라 인간 항체, 인간화 항체, 또는 키메라 항체일 수 있다.
본 발명에서 용어, "단일 클론 항체"는 실질적으로 동일한 항체 집단에서 수득한 단일 분자 조성의 항체 분자를 지칭하고, 이러한 단일 클론 항체는 다클론 항체가 여러 개의 에피토프에 결합할 수 있는 것과 달리, 특정 에피토프에 대해 단일 결합성 및 친화도를 나타낸다. 본 발명에서 용어, "전장 항체"는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1 (γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(κ) 및 람다(λ) 타입을 가진다. IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다.
본 발명에서 용어, "중쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 VH 및 3 개의 불변 영역 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 포함할 수 있다. 또한, 본 발명에서 용어, "경쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 VL 및 불변 영역 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 포함할 수 있다.
본 발명에서 용어, "키메라 항체 (chimeric antibody)"는 중쇄 및/또는 경쇄의 일부가 특정 공급원 또는 종으로부터 유래되는 반면, 중쇄 및/또는 경쇄의 나머지 부분은 상이한 공급원 또는 종으로부터 유래되는 항체를 말한다. 예를 들어, 생쥐 항체의 가변영역 및 인간 항체의 불변영역을 재조합 시킨 키메라 항체가 있으며, 생쥐 항체에 비하여 면역 반응이 크게 개선된 항체이다.
본 발명에서 용어, "인간화 항체"는 인간이 아닌 종에서 유래한 항체의 단백질 서열을 인간에서 자연적으로 생산된 항체와 유사하도록 변형시킨 항체를 의미한다. 그 예로 상기 인간화 항체는 생쥐 유래의 CDR을 인간 항체 유래의 FR(framework region)과 재조합시켜 인간화 가변 영역을 제조하고 이를 바람직한 인간 항체의 불변 영역과 재조합시켜 인간화 항체를 제조할 수 있다. 다만, 단순히 CDR 그래프팅만을 할 경우, 인간화 항체의 친화도가 떨어지게 되므로, CDR의 3차원 구조에 영향을 줄 것으로 생각되는 몇 개의 중요한 FR 아미노산 잔기를 생쥐 항체의 것으로 친화시킴으로써 원래 생쥐 항체의 친화도와 같은 수준으로 올릴 수 있다.
본 발명은 또한, 상기 항-HLA-G 항체의 항원 결합 단편을 제공한다. 항체 결합 단편은 Fab (fragment antigen binding), Fab', F(ab')2, Fv (variable fragment), dsFv (disulfide-stabilized Fv fragments), scFv (single chain Fv), 디아바디 (diabody), 트리아바디 (triabody) 및 테트라바디 (tetrabody)로 이루어진 군으로부터 선택될 수 있다.
본 발명에서 용어, "단편", "항체 단편", "항원 결합 단편" 또는 "항원 결합 도메인"은 항체의 항원결합 기능을 보유하는 본 발명의 항체의 임의의 단편을 지칭하는 것으로 호환적으로 사용된다. 예시적인 항원 결합 단편은 Fab, Fab', F(ab')2 및 Fv 등을 포함하나, 이에 제한되지 않는다.
상기 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변 영역(CH1 도메인)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변영역 및 경쇄 가변영역만을 가지고 있는 최소의 항체 조각으로 Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344 등에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변영역과 경쇄 가변영역이 연결되어 있고, 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 단쇄의 가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있음), 바람직하게는 유전자 재조합 기술을 통하여 제작할 수 있다.
상기 디아바디는 2개의 중쇄 가변 및 2개의 경쇄 가변 도메인으로 구성된 작은 2가 항체로 각 경쇄 가변 도메인은 짧은 링커에 의해 중쇄 가변 도메인과 연결된다. 경쇄 가변 도메인이 훨씬 짧은 링커에 의해 중쇄 가변 도메인과 연결되면 트리아바디 또는 테트라바디를 형성할 수 있다.
또한, 본 발명의 항체 또는 그의 항원 결합 단편은 HLA-G에 결합능력을 나타낼 수 있는 범위 내에서, 본 명세서에 기재된 항 HLA-G항체의 서열뿐만 아니라, 이의 생물학적 균등물도 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 보다 더 개선시키기 위하여 항체의 아미노산 서열에 추가적인 변화를 줄 수 있다. 이러한 변형은 예를 들어, 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다. 이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 리신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글리신과 세린은 유사한 크기를 가지며; 페닐알라닌, 트립토판과 티로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서, 이점에 기초하여, 아르기닌, 리신과 히스티딘; 알라닌, 글리신과 세린; 그리고 페닐알라닌, 트립토판과 티로신은 생물학적으로 기능 균등물이라 할 수 있다.
본 발명의 또 다른 양태는 상기 항체 또는 그의 항원 결합 단편을 암호화하는 단리된 핵산이다. 상기 항체 및 그의 항원 결합 단편은 위에서 설명한 바와 같다.
본 명세서에서 사용되는 용어, "핵산"은 DNA (gDNA 및 cDNA) 및 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오티드는 자연의 뉴클레오티드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다 (Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews(1990) 90:543-584). 본 발명의 중쇄 및 경쇄 가변 영역을 암호화하는 핵산 분자의 서열은 변형될 수 있으며, 상기 변형은 뉴클레오티드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명에서, 상기 단리된 핵산은 하기 서열을 포함할 수 있다:
(a) 서열번호 37의 뉴클레오티드 서열 또는 서열번호 37의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열 및 서열번호 38의 뉴클레오티드 서열 또는 서열번호 38의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열;
(b) 서열번호 39의 뉴클레오티드 서열 또는 서열번호 39의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열 및 서열번호 40의 뉴클레오티드 서열 또는 서열번호 40의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열;
(c) 서열번호 41의 뉴클레오티드 서열 또는 서열번호 41의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열 및 서열번호 42의 뉴클레오티드 서열 또는 서열번호 42의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열; 또는
(d) 서열번호 43의 뉴클레오티드 서열 또는 서열번호 43의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열 및 서열번호 44의 뉴클레오티드 서열 또는 서열번호 44의 뉴클레오티드 서열에 80% 이상의 상동성을 가지는 뉴클레오티드 서열.
보다 구체적으로 본 발명의 일 구체예에서, 상기 단리된 핵산은 하기 서열을 포함할 수 있다:
(a) 서열번호 37의 뉴클레오티드 서열 및 서열번호 38의 뉴클레오티드 서열;
(b) 서열번호 39의 뉴클레오티드 서열 및 서열번호 40의 뉴클레오티드 서열;
(c) 서열번호 41의 뉴클레오티드 서열 및 서열번호 42의 뉴클레오티드 서열; 또는
(d) 서열번호 43의 뉴클레오티드 서열 및 서열번호 44의 뉴클레오티드 서열.
본 발명의 또 다른 양태는 상기 핵산 분자를 포함하는 재조합 벡터이다.
본 명세서에서 사용되는 용어, "벡터"는 숙주세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터 등을 포함하며, 바람직하게는 플라스미드 벡터일 수 있으나, 이에 제한되지 않는다.
본 발명의 일 구현예에 따르면, 본 발명의 핵산 분자를 포함하는 재조합 벡터는 하기의 CDR들을 포함하거나, 또는 하기의 CDR들을 포함하는 중쇄 및/또는 경쇄 가변 영역을 포함하는 서열을 암호화하는 핵산 분자를 포함할 수 있다:
(a) 서열번호 1의 아미노산 서열을 포함하는 중쇄 상보성 결정 부위 1 (complementarity determining region 1, CDR1), 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR3;
(b) 서열번호 9의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 10의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 11의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 13의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 14의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 15의 아미노산 서열을 포함하는 경쇄 CDR3;
(c) 서열번호 17의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 18의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 19의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 21의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 22의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 23의 아미노산 서열을 포함하는 경쇄 CDR3; 또는
(d) 서열번호 25의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3.
본 발명의 벡터에서 경쇄 가변 영역을 암호화하는 핵산 분자 및 중쇄 가변 영역을 암호화하는 핵산 분자는 프로모터와 작동가능하게 연결(operatively linked)된 것일 수 있다.
본 명세서에서 사용되는 용어, "작동가능하게 연결된"은 핵산 발현조절서열(예컨대, 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 관련 기술 분야에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 본 발명의 재조합 벡터는 바람직하게는 발현 벡터이다. 또한, 본 발명의 벡터는 원핵세포 또는 진핵세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 원핵세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터(예컨대, tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ 프로모터, pRλ 프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 숙주세포로서 E. coli (예컨대, HB101, BL21, DH5α 등)가 이용되는 경우, E. coli 트립토판 생합성 경로의 프로모터 및 오퍼레이터 부위 (Yanofsky, C., J. Bacteriol., (1984) 158:1018-1024) 그리고 파지 λ의 좌향 프로모터 (pLλ 프로모터, Herskowitz, I. and Hagen, D., Ann. Rev. Genet., (1980) 14:399-445)가 조절부위로서 이용될 수 있다. 숙주세포로서 바실러스 균이 이용되는 경우, 바실러스 츄린겐시스의 독소단백질 유전자의 프로모터(Appl. Environ. Microbiol. (1998) 64:3932-3938; Mol. Gen. Genet. (1996) 250:734-741) 또는 바실러스균에서 발현 가능한 어떠한 프로모터라도 조절부위로 이용될 수 있다.
한편, 본 발명의 재조합 벡터는 관련 기술 분야에서 종종 사용되는 플라스미드 (예: pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지(예: λgt4·λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(예: SV40 등)를 조작하여 제작될 수 있다.
한편, 본 발명의 벡터가 발현 벡터이고, 진핵세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터 (예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터 (예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 (CMV) 프로모터, HSV의 tk 프로모터, 마우스 유방종양 바이러스 (MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인바 바이러스 (EBV)의 프로모터 및 로우스 사코마 바이러스 (RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다. 구체적으로, 본 발명의 재조합 벡터는 CMV 프로모터를 포함할 수 있다.
본 발명의 재조합 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여 다른 서열과 융합될 수 있다. 융합되는 서열은, 예컨대 글루타티온 S-트랜스퍼라제 (Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His (hexahistidine; Quiagen, USA) 등이 있다. 또한, 본 발명의 벡터에 의해 발현되는 단백질이 항체이기 때문에 정제를 위한 추가적인 서열 없이도 발현된 항체는 단백질 A 컬럼 등을 통하여 용이하게 정제할 수 있다.
한편, 본 발명의 재조합 벡터는 선택표지로서 관련 기술 분야에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자를 포함할 수 있다. 본 발명의 일 구체예에 따르면, 항 HLA-G 발현 벡터는 암피실린 내성 유전자를 포함할 수 있다.
본 발명의 항체를 발현하는 벡터는, 경쇄와 중쇄가 하나의 벡터에서 동시에 발현되는 벡터 시스템이거나 또는 경쇄와 중쇄를 각각 별도의 벡터에서 발현시키는 시스템 모두 가능하다. 후자의 경우, 두 벡터는 동시 형질전환 (co-transfomation) 및 표적 형질전환(targeted transformation)을 통하여 숙주세포로 도입된다. 동시 형질전환은 경쇄 및 중쇄를 암호화하는 각각의 벡터 DNA를 동시에 숙주세포로 도입한 뒤 경쇄와 중쇄를 모두 발현하는 세포를 선별하는 방법이다. 표적 형질전환은 경쇄(또는 중쇄)를 포함하는 벡터로 형질전환 된 세포를 선별하고 경쇄를 발현하는 선별된 세포를 중쇄(또는 경쇄)를 포함하는 벡터로 다시 형질전환 하여 경쇄 및 중쇄 모두를 발현하는 세포를 최종적으로 선별하는 방법이다.
본 발명의 항체의 중쇄 및 경쇄를 암호화하는 핵산은 인간 IgG1, IgG2, IgG4의 중쇄 불변영역 및 경쇄의 불변영역이 인코딩된 발현 벡터에 삽입된다. 경쇄 및 중쇄는 동일하거나 상이한 발현 벡터에서 클로닝될 수 있다. 면역글로불린 사슬을 암호화하는 DNA 서열은, 면역글로불린 폴리펩티드의 발현을 보장하는 발현벡터(들)에서 제어 서열에 작동 가능하게 연결된다. 상기와 같은 제어 서열에는, 신호 서열, 프로모터, 인핸서 (enhancer) 및 전사 종결 서열이 포함된다. 발현벡터는 숙주 염색체 DNA의 필수적 부분 또는 에피솜으로서 숙주 유기체에서 복제 가능하다.
항체의 중쇄 및 경쇄가 각각 개별 벡터에 클로닝되는 경우 중쇄 및 경쇄를 암호화하는 발현 벡터는, 생체내 또는 시험관내에서 손상되지 않은 항체를 형성하기 위해 어셈블링될 수 있는, 두 개의 사슬의 발현을 위해 하나의 숙주 세포에 동시-트랜스펙션 (co-transfection) 될 수 있다.
대안적으로, 중쇄를 암호화하는 발현 벡터 및 경쇄를 암호화하는 발현 벡터가, 중쇄 및 경쇄 각각의 발현을 위한 상이한 숙주 세포에 도입될 수 있고, 이는 이어서 시험관내에서 손상되지 않은 항체를 형성하기 위해 정제 및 어셈블링될 수 있다. 본원에 기재된 바와 같은 항체 또는 이의 단편은, 박테리아, 이스트, 사상균류, 곤충 및 포유류 세포와 같은, 원핵 생물 또는 진핵 생물 발현 시스템에서 생산될 수 있다. 본 발명의 재조합 항체가 반드시 진핵 생물 세포에서 글리코실화 또는 발현될 필요는 없지만 포유류 세포에서의 발현이 일반적으로 바람직하다. 유용한 포유류 숙주세포주의 예는, 인간 배아 신장 세포주 (HEK 293 세포), 아기 햄스터 신장 세포 (BHK 세포), 중국 햄스터 난소 세포/- 또는 + DHFR (CHO, CHO-S, CHO-DG44, Flp-in CHO 세포), 아프리카 녹색 원숭이 신장 세포 (VERO 세포), 및 인간 간 세포 (Hep G2 세포)이다.
이러한 세포에 대한 발현 벡터는, 복제 기점, 프로모터 및 인핸서와 같은 발현 제어 서열, 및 리보솜 결합부위, RNA 스플라이스 부위, 폴리아데닐화 부위 및 전사 터미네이터 서열과 같은 필요한 프로세싱 정보 부위를 포함할 수 있다. 바람직한 발현 제어 서열은 면역글로불린 유전자, SV40, 아데노바이러스, 소 유두종 바이러스, 거대세포 바이러스 등에서 유도된 프로모터이다. 항체를 생산하는 플라스미드 서열을 함유하는 벡터는 숙주 세포의 유형에 따라 달라질 수 있는, 널리 공지된 방법에 의해 숙주 세포 내로 전달될 수 있다.
본 발명의 또 다른 양태는 상기 재조합 벡터를 포함하는 숙주 세포이다. 바람직하게는, 본 발명의 숙주 세포는 재조합 벡터로 형질전환된 숙주 세포이다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 관련 기술 분야에 공지된 임의의 숙주 세포일 수 있으며, 예컨대, 에스케리치아 콜라이 (Escherichia coli), 바실러스 서브틸리스 및 바실러스 츄린겐시스와 같은 바실러스 속 균주, 스트렙토마이세스 (Streptomyces), 슈도모나스 (Pseudomonas) (예를 들면, 슈도모나스 푸티다 (Pseudomonas putida)), 프로테우스 미라빌리스 (Proteus mirabilis) 또는 스타필로코쿠스 (Staphylococcus) (예를 들면, 스타필로코쿠스 카르노수스(Staphylocus carnosus))와 같은 원핵 숙주 세포를 포함하나, 이에 제한되는 것은 아니다.
상기 벡터로 형질전환된 적합한 진핵세포 숙주 세포는 아스페르길러스 속 (Aspergillus species)과 같은 진균, 피치아 파스토리스 (Pichia pastoris), 사카로마이세스 세르비시아 (Saccharomyces cerevisiae), 쉬조사카로마세스 (Schizosaccharomyces) 및 뉴로스포라 크라사 (Neurospora crassa)와 같은 효모, 그 밖의 하등 진핵세포, 곤충-유래 세포와 같은 고등 진핵생물의 세포, 그리고 식물 또는 포유동물로부터 유래한 세포일 수 있으나, 이에 제한되는 것은 아니다.
구체적으로, 숙주세포는 원숭이 신장 세포7 (COS7: monkey kidney cells), NSO 세포, SP2/0, 중국 햄스터 난소 (CHO: Chinese hamster ovary) 세포, W138, 어린 햄스터 신장 (BHK: baby hamster kidney) 세포, MDCK (Mardin Darby canine kidney) 세포, 골수종 세포주, HuT 78 세포 또는 293 세포일 수 있다.
포유류 숙주세포 배양이 항-HLA-G 항체 또는 이의 항원 결합 단편을 발현시키고 생산하는데 바람직한데, 이는 손상되지 않은 면역글로불린을 분비할 수 있는 다수의 적합한 숙주 세포주가 당업계에서 개발되었기 때문이다.
본 발명에서, 숙주세포로의 "형질전환" 및/또는 "형질감염"은 핵산을 유기체, 세포, 조직 또는 기관에 도입하는 어떤 방법도 포함되며, 당 분야에서 공지된 바와 같이 숙주 세포에 따라 적합한 표준 기술을 선택하여 수행할 수 있다. 상기와 같은 방법에는 전기충격유전자전달법 (electroporation), 원형질 융합, 인산칼슘 (CaPO4) 침전, 염화칼슘 (CaCl2) 침전, 실리콘 카바이드 섬유 이용한 교반, 아그로 박테리아 매개된 형질전환, PEG, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 포함되나, 이로 제한되지 않는다.
본 발명의 또 다른 양태는 본 발명의 형질전환 숙주세포를 배양하는 단계를 포함하는 항-HLA-G 항체 또는 이의 항원 결합 단편의 제조 방법이다. 바람직하게는 본 발명의 항-HLA-G 항체 또는 그의 항원 결합 단편의 제조 방법은 배양된 형질전환 숙주세포에서 항-HLA-G 항체 또는 그의 항원 결합 단편을 발현시키는 단계를 더 포함할 수 있다.
상기 항체 또는 그의 항원 결합 단편의 제조 방법에서 형질전환 세포의 배양은 관련 기술 분야에 공지된 적당한 배지와 배양조건에 따라 이루어질 수 있다. 이러한 배양과정은 통상의 기술자라면 선택되는 균주에 따라 용이하게 조정하여 사용할 수 있다. 이러한 다양한 배양 방법은 다양한 문헌 (예를 들면, James M. Lee, Biochemical Engineering, Prentice-Hall International Editions, 138-176)에 개시되어 있다. 세포 배양은, 세포의 성장 방식에 따라 현탁배양과 부착배양, 배양방법에 따라 회분식, 유가식 및 연속배양식의 방법으로 구분된다. 배양에 사용되는 배지는 특정한 균주의 요구조건을 적절하게 만족시켜야 한다.
동물 세포 배양에 있어, 상기 배지는 다양한 탄소원, 질소원 및 미량원소 성분을 포함한다. 사용될 수 있는 탄소원의 예는, 포도당, 자당, 유당, 과당, 말토오스, 전분 및 셀룰로오스와 같은 탄수화물, 대두유, 해바라기유, 피마자유 및 코코넛유와 같은 지방, 팔미트산, 스테아린산 및 리놀레산과 같은 지방산, 글라이세롤 및 에탄올과 같은 알코올, 그리고 아세트산과 같은 유기산을 포함할 수 있으며, 이들 탄소원은 단독 또는 조합되어 사용될 수 있다.
본 발명에서 사용될 수 있는 질소원은, 예컨대 펩톤, 효모 추출물, 육즙, 맥아 추출물, 옥수수 침지액 (CSL) 및 대두밀과 같은 유기 질소원 및 요소, 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄과 같은 무기 질소원을 포함할 수 있으며, 이들 질소원은 단독 또는 조합되어 사용될 수 있다. 상기 배지에는 인원으로서, 인산이수소칼륨, 인산수소이칼륨 및 대응되는 소듐-함유 염이 포함될 수 있다. 또한, 황산마그네슘 또는 황산철과 같은 금속염을 포함할 수 있다. 그 외에 아미노산, 비타민, 및 적절한 전구체 등이 포함될 수 있다.
배양 중에 수산화암모늄, 수산화칼륨, 암모니아, 인산 및 황산과 같은 화합물을 배양물에 적절한 방식으로 첨가하여, 배양물의 pH를 조정할 수 있다. 또한, 배양 중에는 지방산 폴리글리콜 에스테르와 같은 소포제를 사용하여 기포 생성을 억제할 수 있다. 또한, 배양물의 호기상태를 유지하기 위하여, 배양물 내로 산소 또는 산소-함유 기체(예, 공기)를 주입한다. 배양물의 온도는 보통 20℃ 내지 45℃, 바람직하게는 25℃내지 40℃일 수 있으나, 이에 제한되지 않는다.
형질전환된 숙주세포를 배양하여 수득한 항체는 정제하지 않은 상태로 사용될 수 있으며 추가로 다양한 통상의 방법, 예를 들면 투석, 염 침전 및 크로마토그래피 등을 이용하여 고순도로 정제될 수 있다. 그 중에서 크로마토그래피를 이용하는 방법이 가장 많이 사용되며, 컬럼의 종류와 순서는 항체의 특성, 배양방법 등에 따라 이온교환 크로마토그래피, 크기배제 크로마토그래피, 친화성 크로마토그래피 등으로부터 선택될 수 있다.
본 발명에 따른 항-HLA-G 항체는 HLA-G의 다량체 구조를 항원으로 하여 제작된 것으로 HLA-G 단량체 및 다량체 모두에 결합할 수 있는 것이 특징이다. HLA-G가 면역세포의 활성화를 억제하고, 암세포에서 과발현하는 것이 알려져 있으므로 본 발명자들은 항-HLA-G 항체의 항암 능력을 확인하였다.
그 결과, 항-HLA-G 항체가 HLA-G와 CD8a의 결합을 억제하는 것을 확인하였다 (표 4). 또한, PBMC (효력세포)와 항-HLA-G 항체로 처리된 표적세포를 혼합하여 암세포와 공동배양하면 암세포가 사멸되고 (도 3), 종양 유도 마우스에서 종양 생장을 억제하는 것을 확인하였다 (표 6).
이에 본 발명의 또 다른 하나의 양태는 본 발명의 항체 또는 그의 항원 결합 단편을 유효성분으로 포함하는 암의 예방 또는 치료에서의 사용을 위한 약학적 조성물을 제공한다.
본 발명에서, 상기 약학적 조성물은 HLA-G를 과발현하는 암의 치료에 사용될 수 있으나 이에 제한되지 아니한다. 상기 암은 췌장암, 유방암, 난소암, 신경교종, 자궁경부암, 자궁내막암, 식도암, 위암, 간암, 폐암, 대장암, 비인두암, 구강암, 갑상선암, 전립선암, 신장암, 담낭암, 담관암, 혈액암 및 흑색종 등으로 이루어진 군에서 선택될 수 있다.
상기 혈액암은 급성 골수성 백혈병 (Acute Myeloid Leukemia, AML), 급성 림프모구 백혈병 (Acute Lymphoblastic Leukemia, ALL), 만성 골수성 백혈병 (Chronic Myelogenous Leukemia, CML), 다발골수종 (Multiple Myeloma, MM), 또는 림프종 (Lymphoma)일 수 있다.
본 명세서에서 사용되는 용어, "예방"은 본 발명의 조성물의 투여로 질환을 억제시키거나 진행을 지연시키는 모든 행위를 의미하며, "치료"는 질환의 발전의 억제, 경감 또는 제거를 의미한다.
본 발명의 약학 조성물은 약제학적으로 허용되는 담체를 추가로 포함할 수 있으며, 상기 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산칼슘, 알기네이트, 젤라틴, 규산칼슘, 미세결정성 셀룰로오스, 폴리비닐피롤리돈, 셀룰로오스, 물, 시럽, 메틸셀룰로오스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 암 예방 또는 치료용 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)]에 상세히 기재되어 있다.
본 발명의 약학 조성물은 경구 또는 비경구로 투여할 수 있고, 비경구 투여인 경우에는 정맥내 주입, 피하주입, 근육 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장 내 투여 등으로 투여할 수 있다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화될 수 있으며, 본 발명의 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
본 발명의 약학 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성별, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 일 구현예에 따르면, 본 발명의 약학 조성물의 1일 투여량은 0.1-100 ㎎/㎏, 바람직하게는 0.1-10 mg/kg, 보다 바람직하게는 0.1-2 mg/kg일 수 있다. 본 명세서에서 용어 "약제학적 유효량"은 질환의 치료, 예방 및 진단하는 데 충분한 양을 의미한다.
본 발명의 약학 조성물은 당해 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화하여 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다.
본 발명의 항체 또는 그의 항원 결합 단편은 항체-치료제 (기능성 분자) 및 이중특이성항체-치료제 (기능성 분자) 결합체 형태로 생체 내로 투입하여 암의 치료에 이용될 수 있다. 약제를 특이적 표적 부위로 표적화 하는데 적당하고 바람직한 여러 가지 조건은 예를 들어 문헌 [Trouet et al., Plenum Press, New York and London, (1982) 19-30]에 보고되어 있다.
본 발명의 항체 또는 그의 항원 결합 단편에 기능성 분자를 추가적으로 결합하거나 병용 투여하여 HLA-G 과발현과 관련된 질환의 예방, 치료 및 진단에 이용할 수 있다. 상기 기능성 분자는 화학물질, 방사성핵종, 면역치료제, 사 이토킨, 케모킨, 독소, 생물작용제 및 효소 저해물질 등을 포함할 수 있다.
본 발명의 또 다른 양태는 본 발명의 항체 또는 그의 항원 결합 단편, 또는 상기 약학적 조성물을 약제학적 유효량으로 대상체, 예컨대 인간 또는 인간을 제외한 포유류에게 투여하는 것을 포함하는, HLA-G 과발현 관련 질환, 예를 들어 암의 진단, 예방 또는 치료 방법을 제공한다. 본 발명은 또한, 본 발명의 항체 또는 그의 항원 결합 단편을 이를 필요로 하는 개체, 예컨대 인간 또는 인간을 제외한 포유류에게 투여하는 단계를 포함하는, HLA-G 과발현 관련 질환, 예를 들어 암의 진단 방법을 제공한다.
본 발명에서, 용어 "개체"란, HLA-G 과발현 관련 질환이 발병하였거나 발병할 수 있는 인간을 포함한 원숭이, 소, 말, 양, 돼지, 닭, 칠면조, 메추라기, 고양이, 개, 마우스, 쥐, 토끼 또는 기니아 피그를 포함한 모든 동물을 의미한다.
한편, 본 발명의 발명자들은 항체와 HLA-G의 결합 위치를 확인한 결과 항체 스크리닝에 사용한 항원의 아미노산 서열 (서열번호 33) 중에서 아미노산 339 - 344 (DYEATL), 아미노산 390 - 402 (VVVPSGEEQRYTC) 및 아미노산 323 - 338 (QRADPPKTHVTHHPVF) 부분이 에피토프임을 확인하였다.
따라서, 본 발명의 또 다른 양태는 서열번호 34 내지 36으로 이루어진 군에서 선택되는 서열로 이루어진 HLA-G 에피토프 (epitope)를 제공한다.
본 발명에서, 용어 "에피토프"라 함은 항체 또는 이의 단편이 특이적으로 결합할 수 있는 항원의 국소화된 (localized) 부위를 의미한다. 에피토프는 대체로 아미노산 또는 당 측쇄와 같은 분자의 표면기로 이루어지고, 일반적으로 특이적인 3차원 구조 특성 및 특이적 전하 특성을 갖는다. 입체형태적 및 비-입체형태적 에피토프는 변성 용매의 존재 하에서 입체형태적 에피토프에 대한 결합은 손실되지만 비-입체형태적 에피토프에 대해서는 손실되지 않는다는 점에서 구별된다. 에피토프는 결합에 직접 관련되는 아미노산 잔기 (에피토프의 면역우성 성분으로도 칭해짐) 및 결합에 직접 관련되지 않는 기타 아미노산 잔기, 예컨대 특이적 항원 결합 펩티드에 의해 효과적으로 차단되는 아미노산 잔기 (즉, 아미노산 잔기가 특이적 항원 결합 펩티드의 풋프린트(footprint) 내에 존재함)를 포함할 수 있다.
본 발명은 또한 상기 HLA-G 에피토프에 특이적으로 결합하는 항체를 제공하며, 항체의 구체적인 예는 상기에서 설명한 바와 동일하나 이에 제한되지 않는다.
본 발명에 따른 항-HLA-G 항체는 HLA-G의 단량체 및 다량체 모두에 결합할 수 있어 HLA-G와 이의 수용체와의 결합을 효과적으로 차단할 수 있다.
도 1은 본 발명의 일 예에 따른 b2m-HLA-G 항원을 제작하기 위한 개략도를 보여준다.
도 2는 항-HLA-G 항체 생산에 사용한 벡터 구조를 보여준다.
도 3은 항-HLA-G 항체로 처리된 HLA-G 과발현 표적세포를 PBMC와 혼합하고, 이 혼합 세포를 SK-OV-3 세포 또는 MDA-MB-231 세포와 공동배양한 후 암세포의 사멸 정도를 확인한 결과이다.
도 4는 인간 HLA-G를 과발현하는 4T-1 세포를 마우스에 이식하여 종양을 유도하고, 항-HLA-G 항체를 투여한 후 종양을 분리하여 세포독성 T 세포/조절 T 세포의 수치를 확인한 결과이다.
도 5는 항-HLA-G 항체와 HLA-G가 결합하는 에피토프 서열을 확인한 결과이다.
이하 하나 이상의 구체예를 실시예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1: 항원 설계
HLA-G 특이적 항체를 발굴하고, HLA-G의 작용 기작을 억제하기 위하여 HLA-G의 활성화 형태인 b2m-HLA-G 다량체 구조와 유사한 항원을 제작하였다. 항원을 용이하게 생산하기 위해 신호 펩티드-b2m-HLA-G-6X His를 연결한 단백질 서열을 디자인하였다. 이 단백질 서열을 이용하여 DNA 서열을 디자인하였다 (도 1). 이어서, 상기 DNA 서열을 동물세포에 도입시키고, 단백질을 발현시킨 후 정제하였다. 구체적으로 신호 펩티드-b2m-HLA-G-6X His 항원이 포함된 세포 배양액을 NI-NTA 칼럼을 이용하여 1차로 정제하였다. 이후 1차 정제의 결과물로부터 크기 배제 크로마토그래피 (size exclusion chromatography)를 이용하여 단량체(monomer)와 이량체(dimer)를 분리하였다. 항원 생산은 상기 동물세포에 제한되지 않으며, 예를 들면, E.coli 등에서 발현 및 정제하는 것도 가능하다.
서열번호 33: 항원서열
MSRSVALAVLALLSLSGLEARIIPRHLQLGCGGSGGGGSGGGGSIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSGGGGSGGGGSGGGGSGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGCYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWGSGLNDIFEAQKIEWHEHHHHHH
실시예 2: 항체 제작
2-1. 라이브러리 스크리닝
파지/scFv 라이브러리의 스크리닝을 HLA-G 항원이 코팅된 Immunotube (15501, Piece)를 사용하여 수행하였다. 파지/scFv 라이브러리의 항원 결합 특이성을 증가시키기 위해 패닝은 4회 수행하였다. 선택된 파지의 회수 및 증폭을 위해, 기하급수적으로 성장하는 E.coli 배양물을 각 차례의 패닝 후에 용리된 파지 현탁액으로 감염시켰다. 패닝 완료 후 선별된 파지의 항원 반응성을 평가하기 위해, HLA-G 항원을 이용하여 펩 파지-ELISA를 수행하였다. 제4차 패닝 후 파지의 항원 반응 신호는 백그라운드의 3배까지 증가하였다. 파지 디스플레이 기술에 의하면 상기와 같은 신호 증가는 선별된 파지에 HLA-G 항원 특이적인 결합체가 풍부하다는 것을 나타낸다. 제4차 패닝 후 라이브러리로부터 선별된 파지의 파지미드 DNA를 추출하였다. 96개의 클론을 단리하고, 24웰 플레이트상에서 배양하였다. 파지 입자를 함유하는 상청액을 파지-ELISA 방법으로 시험하고 HLA-G 특이적 결합을 나타내는 클론의 DNA를 분리하여 시퀀싱하였다.
2-2. 항체 성숙
HLA-G 특이적 항체의 성숙화를 위해 중쇄 및 경쇄의 CDR1, 2, 3에 대하여 돌연변이를 도입하여 다양한 중쇄 및 경쇄 산출물을 얻었다. 해당 산출물을 조합하고, HLA-G 특이적 항체를 선별하기 위하여 HLA-A, HLA-B, HLA-C, HLA-G를 사용한 ELISA 분석을 통해 HLA-G 특이적 성숙 항체를 확보하였다.
2-3. 항체의 재조합 생산
본 실시예에서는 도 2의 벡터 구조를 사용하여 항체를 제작하였다. 상기 벡터에는 동물세포 발현을 위해 인간 사이토메갈로바이러스 프로모터 (CMV promotor), 발현 강화를 위해 코작 서열, 발현된 단백질의 세포외 이동을 위한 신호 서열 (signal sequence), 가변 영역 클로닝 부위, IgG1의 경쇄 또는 중쇄 불변 영역 코딩 서열, Woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), 암피실린 저항성 유전자 및 E.coli 내에서 플라스미드를 증폭하기 위한 pUC가 포함되어 있다. 가변 영역 클로닝 부위에는 HindIII, EcoR1 제한효소가 있어 발현벡터에 상기 제한효소를 처리한 후 중쇄 또는 경쇄 가변 영역의 PCR 산물을 infusion 효소 (TAKARA)를 이용하여 벡터에 삽입하였다. IgG2, IgG3 및 IgG4의 중쇄 불변 도메인 또한 사용될 수 있다.
상기 경쇄 발현 벡터 및 중쇄 발현 벡터를 Expi 293세포에 형질도입 키트 (Thermo)를 이용하여 형질도입시킨 후 세포를 배양하였다. 세포 배양액을 4~6일 뒤에 수확하고, 세포를 제거하여 상층액만 회수하였다. 회수한 상층액을 0.45 um 필터로 여과하고, 여과한 배양액을 AKTA 정제기기에서 Mabselect (Cytiva) 정제칼럼으로 정제하여 인간 HLA-G에 특이적으로 결합하는 항체를 수득하였다.
2-4. 항체 분석
수득한 항체를 분석하고 CDR 및 가변 부위 서열을 아래의 표 1 및 표 2에 정리하였다.
항-HLAG 항체 (상보성 결정부위 (CDR)의 서열번호)
항-HLAG항 체 CDR-H1 CDR-H2 CDR-H3 VH CDR-L1 CDR-L2 CDR-L3 VL
항체 1 서열번호
1		 서열번호
2		 서열번호
3		 서열번호
4		 서열번호
5		 서열번호
6		 서열번호
7		 서열번호
8
항체 2 서열번호
9		 서열번호
10		 서열번호
11		 서열번호
12		 서열번호
13		 서열번호
14		 서열번호
15		 서열번호
16
항체 3 서열번호
17		 서열번호
18		 서열번호
19		 서열번호
20		 서열번호
21		 서열번호
22		 서열번호
23		 서열번호
24
항체 4 서열번호
25		 서열번호
26		 서열번호
27		 서열번호
28		 서열번호
29		 서열번호
30		 서열번호
31		 서열번호
32
항체 1 VH
CDR1 서열번호1 DYAMS
CDR2 서열번호2 VISHDGDRVYYADSVKG
CDR3 서열번호3 GPRRIANAIFDY
VH full 서열번호4 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGDRVYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSS
항체 1 VL
CDR1 서열번호5 SGSSSNIGHSYVS
CDR2 서열번호6 GDNNRPS
CDR3 서열번호7 QSYDSSLSGYV
VL full 서열번호8 QLVLTQPPSVSGAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGDNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL
항체 2 VH
CDR1 서열번호9 DYAMS
CDR2 서열번호10 VISHDGGSIYYADSVKG
CDR3 서열번호11 GPRRIANAIFDY
VH full 서열번호12 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSS
항체 2 VL
CDR1 서열번호13 SGSNSNIGNSYVS
CDR2 서열번호14 GSTNRPS
CDR3 서열번호15 QSYDSSLSGYV
VL full 서열번호16 QFVLTQPPSVSAAPGQKVTISCSGSNSNIGNSYVSWYQQVPGAAPRLLIYGSTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQ SYDSSLSGYVFGTGTKVTVL
항체 3 VH
CDR1 서열번호17 DYSMS
CDR2 서열번호18 AISPDRSLEYYADSVKG
CDR3 서열번호19 GPRHLTNNIFDY
VH full 서열번호20 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLEWVSAISPDRSLEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRHLTNNIFDYWGQGTLVTVSS
항체 3 VL
CDR1 서열번호21 SGSSSNIGHSYVS
CDR2 서열번호22 GNIHRPS
CDR3 서열번호23 GVWDSSLSAVV
VL full 서열번호24 QFVLTQPPSVSAAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGNIHRPSGVPDRFSGSTSGTSASLAITGLQADDEADYYCG VWDSSLSAVVFGGGTKLTVL
항체 4 VH
CDR1 서열번호25 DYSMS
CDR2 서열번호26 AISPDSGSKYYADSVKG
CDR3 서열번호27 GPRHLTNNIFDY
VH full 서열번호28 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLEWVSAISPDSGSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRHLTNNIFDYWGQGTLVTVSS
항체 4 VL
CDR1 서열번호29 TGSSSNIGSNYVS
CDR2 서열번호30 ADSNRPS
CDR3 서열번호31 ASWDYSLSGYV
VL full 서열번호32 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVSWYQQLPGTAPKLLIYADSNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCASWDYSLSGYVFGGGTKLTVL
실시예 3: 항체의 항원 결합능 평가
실시예 2에서 수득한 항-HLA-G 특이적 항체의 실시예 1에서 제작한 HLA-G 항원에 대한 결합 특성에 대해 스크리닝하였다. 분석 결과를 아래 표 3에 요약하였다.
항-HLA-G항체 SPR KD (M) Octet KD (M)
HLA-G 단량체 HLA-G 이량체
항체 1 1.5 E-08 1.11 E-09 2.84 E-10
항체 2 9.30 E-09 8.41 E-10 5.49 E-10
항체 3 2.81 E-08 3.98 E-09 1.06 E-9
항체 4 - 4.88 E-09 1.45 E-9
표면자기공명법(SPR)과 옥텟분석을 통해 항-HLA-G 특이적 항체들이 HLA-G 다량체에 대해 나노몰(nanomolar) 수준의 KD 값을 보여, 항원에 높은 친화성을 가지는 것을 확인하였다. 또한, 항-HLA-G 특이적 항체들은 HLA-G 다량체로 수득한 항체로서 단량체보다 다량체에 대해 더 높은 친화성을 보였다.
실시예 4: HLA-G 특이적 항체의 결합 억제능 확인
항-HLA-G 특이적 항체들이 HLA-G 다량체에 대해 높은 친화성을 가지므로 상기 항체들이 ILT2 (Ig-like transcript 2)와 HLA-G 다량체 간의 결합을 억제할 수 있는지 확인하였다.
4-1. 수용체 결합 억제1: 항-HLA-G 항체에 의한 HLA-G에 대한 ILT2 결합의 억제
a. ILT2 Block ELISA
분석을 위해, ILT-2-Fc를 1x DPBS에 1.5 μg/mL의 농도로 희석하였다. 96-웰 면역 플레이트(immune plate)의 각 웰에 희석한 ILT-2 단백질을 150 ng/100 uL씩 분주하였다. 면역 플레이트를 4℃에서 하룻밤 보관하여 ILT-2 단백질을 웰의 표면에 고정시켰다. 다음날 ILT-2 단백질 용액을 완전히 제거하고, 각 웰당 200 uL의 1x PBS-T로 세척하였다. 차단 용액(blocking solution)을 각 웰에 200 ul씩 분주한 후, 37℃에서 1시간 동안 반응시켜 비특이적인 단백질 결합을 차단하였다.
실시예 1에서 제작한 항원을 처리하고자 하는 농도의 2배인 1,200 nM이 되도록 차단 용액에 희석하였다. 또한, 항-HLA-G 단일 항체를 처리하고자 하는 농도의 2배인 2,000 nM이 되도록 차단 용액에 희석하고, 0.914 nM까지 3배 연속 희석하였다.
준비한 실시예 1의 항원과 농도별로 희석한 항-HLA-G 단일 항체를 1:1 비율로 혼합하여 각 웰마다 120 ul씩 분주한 후, 37℃에서 30분 동안 전반응(pre-incubation)시켰다. 각 웰에서 차단 용액을 완전히 제거한 후, PBS-T로 세척하였다.
실시예 1의 항원과 항-HLA-G 단일 항체의 1:1 혼합물을 각 웰마다 100 ul씩 첨가한 후, 37℃에서 1시간 동안 반응시켰다. 실시예 1의 항원에 대한 검출 항체인 항-His-HRP를 1:10,000의 비율로 희석하여 각 웰에 100 ul씩 분주하고, 37℃에서 1시간 동안 반응시켰다. 각 웰을 200 ul의 1x PBS-T로 3회 세척한 후 Multi-mode Microplate Reader를 이용하여 450 nm에서 흡광도를 측정하였다.
측정 결과는 표 4에 기재하였다. 하기 표 4는 차단되지 않은 HLA-G:ILT2 간의 상호작용에 항체의 농도를 다르게 하여 처리했을 때 HLA-G:ILT2 간의 상호작용의 억제가 50% 이상으로 나타나는 항체의 농도를 ELISA 분석으로 확인한 결과이다. 실시예 2에서 수득한 항체는 150nM 수준에서 HLA-G:ILT2 결합을 50%이상 억제하는 것으로 나타났다.
항-HLA-G항체 ILT2 Block EIA
(nM)		 ILT-2 Block Cell
(nM)		 CD8a Block EIA
(%)
항체 1 154.6 0.3204 39.5
항체 2 146.4 0.2156 39
항체 3 163.7 2.743 37.7
항체 4 143.5 2.837 32.1
b. ILT-2 Block Cell
HLA-G 발현세포를 실험 0일차(D0)에 96웰 마이크로플레이트에 3.0. E+05 세포/웰 농도로 분주하여 배양하였다. 실험 1일차에 세포의 상층액을 제거하였다. 항-HLA-G 단일 항체를 처리하고자 하는 농도의 2배인 200 nM이 되도록 차단 용액에 희석하고, 0.714 pM까지 6배 연속 희석하였다. 이 희석액을 상층액을 제거한 웰에 분주하여 30분간 반응시켰다. ILT2-mFc 단백질을 100 ug/mL로 희석한 후 항체-세포 반응액에 분주하여 1시간 동안 반응시켰다. 반응이 완료되면 상층액을 제거하고, ILT2-mFC를 검출할 수 있는 항-마우스 IgG-FITC를 희석하여 분주하였다. 2시간 동안 반응시킨 다음, 유세포분석기를 이용하여 ILT2-mFc의 잔여량을 확인하였다.
확인 결과, 음성대조군인 IgG1 처리군은 고농도에서도 HLA-G와 ILT2의 결합을 억제하지 못했으나 실시예 2에서 수득한 항체는 농도 의존적으로 HLA-G와 ILT2의 결합을 억제하였다. 또한, HLA-G 발현세포:ILT2 결합이 50% 이하가 되는 항체 농도(EC50)를 확인하였고, 수득한 항체는 나노몰 (nanomolar) 수준에서 세포 표면의 IHLA-G와 LT2의 결합을 효과적으로 억제하는 것으로 나타났다 (표 4).
2-2. 수용체 결합 억제 2: 항-HLA-G 항체에 의한 HLA-G에 대한 CD8a의 결합의 억제
면역세포에서 발현되는 CD8a에 HLA-G 항원이 결합하면 면역세포의 억제가 나타나므로 HLA-G와 CD8a의 결합을 억제하는 것이 면역세포의 활성화에 중요하다. 이에 실시예 2에서 수득한 항체의 CD8a 차단효과를 다음과 같이 확인하였다.
실시예 1에서 제작한 이량체 항원을 PBS 용액에 5 ug/mL 농도로 희석하였다. 희석한 항원을 96 웰 마이크로플레이트에 100 ul씩 분주하여 24시간 동안 웰에 항원을 코팅시켰다.
스트렙타비딘 96 웰 플레이트의 각 웰에 차단 용액을 100 μL씩 분주하여 차단하였다. 차단 용액은 1% Tween-20이 포함된 PBS에 스킴밀크를 4% 농도로 용해시켜 제조하였다. 스트렙타비딘 96 웰 플레이트의 각 웰을 100 μl의 0.1% Tween-20을 함유하는 PBS로 3회 세척하였다.
이후 항 HLA-G 항체를 최종 농도가 0.391 nM이 되도록 차단 용액에 희석하였다. 희석한 항 HLA-G 항체를 96 웰에 분주하여 1시간 동안 반응시켰다. 차단 용액에 희석한 100 nM 농도의 CD8a-His를 각 웰에 분주하고 1시간 동안 반응시켰다. 반응이 끝나면 PBS-T로 각 웰을 세척하였다. CD8a 검출 항체인 항-CD8a-HRP를 차단 용액에 희석한 후 각 웰에 분주하였다. 1시간 동안 반응시킨 후 PBS-T로 각 웰을 세척하고, TMB 용액을 각 웰에 첨가하여 발색시켰다. 1N 황산(sulfuric acid)을 첨가하여 반응을 종료시키고, 마이크로플레이트 리더로 450 nM에서 흡광도를 측정하였다.
측정 결과, 본 발명의 항체가 종래의 HLA-G와 유사하거나 더 높은 수준으로 HLA-G와 CD8a의 결합을 차단하는 것을 알 수 있었다 (표 4). 이러한 결과는 항-HLA-G 항체가 HLA-G와 CD8a의 결합을 억제하여 면역세포를 활성화 시킬 수 있음을 암시한다.
실시예 5: PBMC(peripheral blood mononuclear cell)를 사용한 암세포 사멸 확인
SK-OV-3 세포 또는 MDA-MB-231 세포에 HLA-G를 과발현한 세포 (표적세포)를 37℃배양기에서 24시간 동안 배양하였다. 배양 후 상기 HLA-G 과발현 세포 (표적세포)에 100 nM 농도의 항-HLA-G 항체를 37℃에서 1시간 동안 전처리하였다. PBMC (효력세포)와 항체 처리된 표적세포를 5:1의 비율로 혼합하여 SK-OV-3 세포 또는 MDA-MB-231 세포와 48시간 동안 공동배양하였다.
배양이 끝나면 세포 배양액을 회수하였다. 회수한 세포 배양액으로부터 LDH (lactate dehydrogenase)의 수준을 cytotoxicity assay kit (cytotox96 non-radioactive cytotoxicity assay, Promega)를 이용하여 제조사의 프로토콜에 따라 측정하였다. 상기 LDH는 세포 사멸 시 방출되므로 LDH 수준을 측정하여 세포 사멸 정도를 알 수 있다.
측정 결과, HLA-G와 특이적 결합을 하지 않는 음성대조군 (IgG1 전처리)과 비교하여 항-HLA-G 항체 2, 항체 1 및 항체 3이 PBMC의 암세포 사멸 능력을 높임을 확인할 수 있었다 (도 3).
실시예 6: HLA-G 항체의 종양 성장 억제 효과 확인
Balb/c 마우스의 우측 복강에 인간 HLA-G를 과발현하는 4T-1 세포를 이식하였다. 이식 7~14일 후 종양 성장을 관찰하여 종양 크기가 일정 수준 이상(100 ㎣)으로 성장할 때까지 마우스를 생육하였다. 종양 크기가 원하는 크기에 도달하면 종양 이식 마우스를 표 5의 시험 그룹에 따라 무작위로 그룹화하였다.
시험 그룹 투여 물질 투여량 (mpk)
그룹 1 IgG1 10
그룹 2 항-HLA-G 항체 4 1
그룹 3 항-HLA-G 항체 4 10
그룹 4 항-HLA-G 항체 1 1
그룹 5 항-HLA-G 항체 1 10
그룹 6 항-HLA-G 항체 2 1
그룹 7 항-HLA-G 항체 2 10
그룹 8 항-HLA-G 항체 3 1
그룹 9 항-HLA-G 항체 3 10
각 시험 그룹에 항-HLA-G 항체를 각각 1 mg/kg (mg/kg=mpk) 또는 10 mg/kg 용량으로 일주일에 두 번씩(twice weekly, BIW), 2주 동안 총 4회 복강 투여하였다. 실험 시작 12일 차에 마우스 피하에서 보이는 종양의 부피를 측정하고 하기 식 1에 따라 종양 성장 억제율을 산출하였다.
[식 1]
종양 성장 억제율(TGI, Tumor Growth Inhibition) (%) = (음성 대조군의 종양 부피 (IgG)-시험군의 종양 부피)/음성 대조군의 종양 부피
종양 성장 억제율 산출 결과를 하기 표 6에 기재하였다.
그룹 항-HLA-G항체 TGI(%) (BIW 투여량)
그룹 4 항체 1 20.1 (1 mpk)
그룹 5 항체 1 28.5 (10 mpk)
그룹 6 항체 2 34.4 (1 mpk)
그룹 7 항체 2 23.0 (10 mpk)
그룹 8 항체 3 22.4 (1 mpk)
그룹 9 항체 3 39.7 (10 mpk)
그룹 3 항체 4 24.9 (10 mpk)
음성 대조군인 IgG1 투여군은 종양 성장을 억제하지 못한 반면 항-HLA-G 항체 처리군은 모두 종양 성장을 억제하였다. 항체 4는 10 mpk를 투여했을 때 24.9%의 종양 성장 억제 효과를 보였으며, 항체 1, 항체 2 및 항체 3은 1 mpk를 투여해도 20% 이상의 종양 성장 억제 효과를 보였다 (표 6).
또한, 항-HLA-G 항체를 처리한 마우스에서 종양 조직을 분리하여 종양 내로 침투한 면역세포를 분석하였다. 면역항암제의 작용은 종양 조직 내 면역세포의 풀(pool)을 변화시키며, 면역세포의 활성화로 인해 암세포가 사멸된다. 세포독성 T 세포 (cytotoxic T cell)는 암세포 사멸기능을 가진 대표적인 면역세포이고, 조절 T (Treg) 세포는 대표적인 면역 억제인자이다.
종양 조직에서 세포독성 T 세포/조절 T 세포의 수치를 확인한 결과, 음성대조군(mock)과 비교하여 항-HLA-G 항체를 투여한 실험군 모두에서 세포독성 T 세포/조절 T 세포의 수치가 높게 나타나는 것을 알 수 있었다 (도 5). 이 결과는 항-HLA-G 항체가 세포독성 T 세포의 기능을 증가시킨다는 것을 의미한다.
실시예 7: 항체와 HLA-G의 결합 위치 확인
예비 실험을 통하여 항원에 퀀칭 버퍼(quench buffer)를 사용하고, 펩신 (pepsin) 용액 (1:1 w/w)을 저온에서 5분 동안 처리했을 때 95.5%의 가장 높은 전체 서열 커버리지(coverage)가 나오는 것을 확인하였다. 이에 이 조건으로 에피토프 맵핑(epitope mapping) 실험을 진행하였다. 상기 퀀칭 버퍼는 100 mM 인산칼륨 (potassium phosphate), 1 M 요소 (urea) 및 500 mM TCEP (Tris(2-carboxyethyl)phosphine hydrochloride) (pH 2.5)를 포함한다.
에피토프 맵핑은 수소-중수소교환 질량분석법 (hydrogen deuterium exchange mass spectrometry, HDX-MS) 기술을 사용하였고, 항원은 β2M-HLA-G, 항체는 항-HLA-G 항체 1 또는 2를 사용하였다.
항원 단독 상태와 항원-항체 복합체 상태의 시료 각각을 D2O 버퍼로 라벨링하였다 (3반복 시료 사용). 이후 0분, 0.33분 (20초), 10분, 60분 및 240분의 5개 시점 (time points)에서 질량 분석을 수행하였고, 스펙트라(spectra)를 통해 얻은 분자량 값을 비교하여 항원 단독 대비 복합체의 중수소 교환 (deuterium uptake)이 감소하는 부분을 확인하였다.
그 결과, 항원이 2종의 항체와 각각 결합했을 때 항원의 아미노산 서열 339 - 344 (DYEATL)와 390 - 402 (VVVPSGEEQRYTC) 부분이 동일한 에피토프로 작용하는 것을 확인할 수 있었다. 또한, 항체 1에 대해서는 323 - 338 (QRADPPKTHVTHHPVF) 부분도 339 - 344에 인접한 에피토프임을 알 수 있었다 (도 5).

Claims (12)

  1. 하기를 포함하는 항-HLA-G 항체 또는 이의 항원 결합 단편:
    (a) 서열번호 1의 아미노산 서열을 포함하는 중쇄 상보성 결정 부위 1 (complementarity determining region 1, CDR1), 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및
    서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR3;
    (b) 서열번호 9의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 10의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 11의 아미노산 서열을 포함하는 중쇄 CDR3; 및
    서열번호 13의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 14의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 15의 아미노산 서열을 포함하는 경쇄 CDR3;
    (c) 서열번호 17의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 18의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 19의 아미노산 서열을 포함하는 중쇄 CDR3; 및
    서열번호 21의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 22의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 23의 아미노산 서열을 포함하는 경쇄 CDR3; 또는
    (d) 서열번호 25의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR3; 및
    서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3.
  2. 제1항에 있어서, 상기 항-HLA-G 항체 또는 이의 항원 결합 단편은
    (a) 서열번호 4의 아미노산 서열로 이루어지는 중쇄 가변영역; 및 서열번호 8의 아미노산 서열로 이루어지는 경쇄 가변영역;
    (b) 서열번호 12의 아미노산 서열로 이루어지는 중쇄 가변영역; 및 서열번호 16의 아미노산 서열로 이루어지는 경쇄 가변영역;
    (c) 서열번호 20의 아미노산 서열로 이루어지는 중쇄 가변영역; 및 서열번호 24의 아미노산 서열로 이루어지는 경쇄 가변영역; 또는
    (d) 서열번호 28의 아미노산 서열로 이루어지는 중쇄 가변영역; 및 서열번호 32의 아미노산 서열로 이루어지는 경쇄 가변영역;을 포함하는,
    항-HLA-G 항체 또는 이의 항원 결합 단편.
  3. 제1항에 있어서, 상기 항-HLA-G 항체는 재조합 항체, 단일클론 항체, 다중클론 항체, 단일클론 및/또는 다중클론 항체의 혼합물, 인간 항체, 인간화 항체, 또는 키메라 항체인, 항-HLA-G 항체 또는 이의 항원 결합 단편.
  4. 제1항에 있어서, 상기 항원 결합 단편은 Fab (fragment antigen binding), Fab', F(ab')2, Fv (variable fragment), dsFv (disulfide-stabilized Fv fragments), scFv (single chain Fv), 디아바디, 트리아바디 및 테트라바디로 이루어진 군으로부터 선택되는, 항-HLA-G 항체 또는 이의 항원 결합 단편.
  5. 제1항에 따른 항-HLA-G 항체 또는 이의 항원 결합 단편을 암호화하는 뉴클레오티드 서열을 포함하는 단리된 핵산.
  6. 제5항에 따른 단리된 핵산을 포함하는 벡터.
  7. 제6항에 따른 벡터를 포함하는 숙주 세포.
  8. 하기로 이루어진 군에서 선택되는 하나 이상의 유효성분 및 약학적으로 허용가능한 담체를 포함하는 암의 예방 또는 치료에서의 사용을 위한 약학적 조성물:
    (a) 제1항에 따른 항-HLA-G 결합 항체 또는 이의 항원 결합 단편;
    (b) 제5항에 따른 단리된 핵산;
    (c) 제6항에 따른 벡터; 또는
    (d) 제7항에 따른 세포.
  9. 제8항에 있어서, 상기 암은 췌장암, 유방암, 난소암, 신경교종, 자궁경부암, 자궁내막암, 식도암, 위암, 간암, 폐암, 대장암, 비인두암, 구강암, 갑상선암, 전립선암, 신장암, 담낭암, 담관암, 혈액암 및 흑색종으로 이루어진 군으로부터 선택되는, 약학적 조성물.
  10. 제1항에 따른 항-HLA-G 결합 항체 또는 이의 항원 결합 단편, 또는 제8항의 약학적 조성물을 이를 필요로 하는 대상체에 투여하는 것을 포함하는 암의 예방 또는 치료 방법.
  11. 서열번호 34 내지 36으로 이루어진 군에서 선택되는 서열로 이루어진 HLA-G 에피토프.
  12. 서열번호 34 내지 36으로 이루어진 군에서 선택되는 서열로 이루어진 HLA-G 에피토프에 결합하는 항체.
PCT/KR2023/003977 2022-03-25 2023-03-24 Hla-g 특이적 항체 및 이의 용도 WO2023182866A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20220037683 2022-03-25
KR10-2022-0037683 2022-03-25

Publications (1)

Publication Number Publication Date
WO2023182866A1 true WO2023182866A1 (ko) 2023-09-28

Family

ID=88101861

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/003977 WO2023182866A1 (ko) 2022-03-25 2023-03-24 Hla-g 특이적 항체 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20230140409A (ko)
WO (1) WO2023182866A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20210005080A (ko) * 2018-04-18 2021-01-13 에프. 호프만-라 로슈 아게 항-hla-g 항체 및 이의 용도
KR20210098956A (ko) * 2018-09-27 2021-08-11 티조나 테라퓨틱스 항-hla-g 항체들, 항-hla-g 항체들을 포함하는 조성물들 및 항-hla-g 항체들을 이용하는 방법들
US11111302B2 (en) * 2016-06-03 2021-09-07 Invectys SA Anti HLA-G specific antibodies

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11111302B2 (en) * 2016-06-03 2021-09-07 Invectys SA Anti HLA-G specific antibodies
KR20210005080A (ko) * 2018-04-18 2021-01-13 에프. 호프만-라 로슈 아게 항-hla-g 항체 및 이의 용도
KR20210098956A (ko) * 2018-09-27 2021-08-11 티조나 테라퓨틱스 항-hla-g 항체들, 항-hla-g 항체들을 포함하는 조성물들 및 항-hla-g 항체들을 이용하는 방법들

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE PROTEIN ANONYMOUS : "immunoglobulin mu heavy chain variable region, partial [Homo sapiens]", XP093095616, retrieved from NCBI *
KRIJGSMAN DANIËLLE, ROELANDS JESSICA, HENDRICKX WOUTER, BEDOGNETTI DAVIDE, KUPPEN PETER J. K.: "HLA-G: A New Immune Checkpoint in Cancer?", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 21, no. 12, pages 4528, XP093039278, DOI: 10.3390/ijms21124528 *

Also Published As

Publication number Publication date
KR20230140409A (ko) 2023-10-06

Similar Documents

Publication Publication Date Title
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
WO2019225777A1 (ko) 항-ror1 항체 및 그 용도
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
AU2018271751B2 (en) Anti-human interleukin-2 antibodies and uses thereof
WO2017074074A1 (en) Novel anti-glypican 3 antibody and pharmaceutical composition containing the same
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2019132533A1 (ko) 항-pd-l1 항체 및 이의 용도
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2021107566A1 (ko) C-kit에 대한 항체 및 이의 용도
WO2019078699A2 (ko) 항-vista 항체 및 이의 용도
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2022030730A1 (ko) 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2020004934A1 (ko) 항-bcma 항체 및 그 용도
WO2023182866A1 (ko) Hla-g 특이적 항체 및 이의 용도
WO2019216675A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2022216014A1 (ko) 항-cntn4 항체 및 그의 용도
WO2021112640A1 (ko) 항-tm4sf4 항체 및 이의 용도
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2018182266A1 (ko) 항-emap ii 항체 및 이의 용도
WO2017142294A1 (ko) EGFRvIII에 대한 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23775361

Country of ref document: EP

Kind code of ref document: A1