WO2022020652A2 - Stapled peptides and methods thereof - Google Patents
Stapled peptides and methods thereof Download PDFInfo
- Publication number
- WO2022020652A2 WO2022020652A2 PCT/US2021/042856 US2021042856W WO2022020652A2 WO 2022020652 A2 WO2022020652 A2 WO 2022020652A2 US 2021042856 W US2021042856 W US 2021042856W WO 2022020652 A2 WO2022020652 A2 WO 2022020652A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- agent
- independently
- group
- optionally substituted
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCN(C[C@](C(C)=O)(*#C)NC)C(OCCCCCCCC(CCCCC[C@@]1NCCC1)(C(C)=O)N)=O Chemical compound CCN(C[C@](C(C)=O)(*#C)NC)C(OCCCCCCCC(CCCCC[C@@]1NCCC1)(C(C)=O)N)=O 0.000 description 25
- JWTDHXIUJLWBEQ-LURJTMIESA-N CCNC[C@@H](C(C)=O)N Chemical compound CCNC[C@@H](C(C)=O)N JWTDHXIUJLWBEQ-LURJTMIESA-N 0.000 description 2
- FXEOWMXUVAUAAQ-SSDOTTSWSA-N C[C@@]1(CNCC1)C(C)=O Chemical compound C[C@@]1(CNCC1)C(C)=O FXEOWMXUVAUAAQ-SSDOTTSWSA-N 0.000 description 2
- XVRIHSOVBZSEFS-INIZCTEOSA-N C=C([C@@H](C(OCc1ccccc1)=O)NOC(c1ccccc1)=O)N Chemical compound C=C([C@@H](C(OCc1ccccc1)=O)NOC(c1ccccc1)=O)N XVRIHSOVBZSEFS-INIZCTEOSA-N 0.000 description 1
- IDDXVVAAGWZVGU-LSLKUGRBSA-N CC(C(CCCCCCC[C@@H](CCC1)N1I)N)=O Chemical compound CC(C(CCCCCCC[C@@H](CCC1)N1I)N)=O IDDXVVAAGWZVGU-LSLKUGRBSA-N 0.000 description 1
- AHVRMIJHKCUMFA-UHFFFAOYSA-N CC(C)(C)OC(C1CN(CCC(O)=O)CCC1)=O Chemical compound CC(C)(C)OC(C1CN(CCC(O)=O)CCC1)=O AHVRMIJHKCUMFA-UHFFFAOYSA-N 0.000 description 1
- PRWBXJQQJGMNQI-UHFFFAOYSA-N CC(C)(C)OC(C1N(CCC(O)=O)CCCC1)=O Chemical compound CC(C)(C)OC(C1N(CCC(O)=O)CCCC1)=O PRWBXJQQJGMNQI-UHFFFAOYSA-N 0.000 description 1
- ZEUHENVZXXXIHR-UHFFFAOYSA-N CC(C)(C)OC(C1N(CC[SiH2]C(O)=O)CCCC1)=O Chemical compound CC(C)(C)OC(C1N(CC[SiH2]C(O)=O)CCCC1)=O ZEUHENVZXXXIHR-UHFFFAOYSA-N 0.000 description 1
- KIMYDGKQJLGJCU-YTTGMZPUSA-N CC(C)(C)OC(c1ccccc1C[C@@H](C(OCc1ccccc1)=O)N(Cc1ccccc1)Cc1ccccc1)=O Chemical compound CC(C)(C)OC(c1ccccc1C[C@@H](C(OCc1ccccc1)=O)N(Cc1ccccc1)Cc1ccccc1)=O KIMYDGKQJLGJCU-YTTGMZPUSA-N 0.000 description 1
- LKYHXOSXKIBLFW-UHFFFAOYSA-N CC(C)COC(c1cc(CCC(O)=O)ccc1)=O Chemical compound CC(C)COC(c1cc(CCC(O)=O)ccc1)=O LKYHXOSXKIBLFW-UHFFFAOYSA-N 0.000 description 1
- AIYWRXHLMWJMJO-UHFFFAOYSA-N CC(C1CNCC1)=O Chemical compound CC(C1CNCC1)=O AIYWRXHLMWJMJO-UHFFFAOYSA-N 0.000 description 1
- KUCHRBMVOJFBEG-NSHDSACASA-N CC([C@H](Cc1cccc(C(O)=O)c1)NC)=O Chemical compound CC([C@H](Cc1cccc(C(O)=O)c1)NC)=O KUCHRBMVOJFBEG-NSHDSACASA-N 0.000 description 1
- ACDDBVDQFBGAHT-AXDSSHIGSA-N CCCN(CC1)C1[C@@H](O)OC(C)(C)C Chemical compound CCCN(CC1)C1[C@@H](O)OC(C)(C)C ACDDBVDQFBGAHT-AXDSSHIGSA-N 0.000 description 1
- DTMGVXRYUYYCJT-YFKPBYRVSA-N CCN(C[C@@H](C(O)=O)N)CC(O)=O Chemical compound CCN(C[C@@H](C(O)=O)N)CC(O)=O DTMGVXRYUYYCJT-YFKPBYRVSA-N 0.000 description 1
- YPMCHOLFBDWSHI-LURJTMIESA-N CN(CC1)C[C@@]1(C(O)=O)I Chemical compound CN(CC1)C[C@@]1(C(O)=O)I YPMCHOLFBDWSHI-LURJTMIESA-N 0.000 description 1
- FJOOJFXCKIPSLU-JTQLQIEISA-N CN[C@@H](Cc1ccccc1)CO Chemical compound CN[C@@H](Cc1ccccc1)CO FJOOJFXCKIPSLU-JTQLQIEISA-N 0.000 description 1
- WHFZWAPFRLAWNV-JTQLQIEISA-N COc1cc(OC)c(CSC(C[C@@H](C(O)=O)N)=O)c(OC)c1 Chemical compound COc1cc(OC)c(CSC(C[C@@H](C(O)=O)N)=O)c(OC)c1 WHFZWAPFRLAWNV-JTQLQIEISA-N 0.000 description 1
- NLJHFLQSGGLCHW-UHFFFAOYSA-N CSCC(Nc1cc(NC(CS)=O)ccc1)=O Chemical compound CSCC(Nc1cc(NC(CS)=O)ccc1)=O NLJHFLQSGGLCHW-UHFFFAOYSA-N 0.000 description 1
- JKGHGIJRYMJVPN-VKHMYHEASA-N N[C@@H](CCC(S)=O)C(O)=O Chemical compound N[C@@H](CCC(S)=O)C(O)=O JKGHGIJRYMJVPN-VKHMYHEASA-N 0.000 description 1
- JANONUPBHGWOBP-QMMMGPOBSA-N N[C@@H](Cc1cc(C(O)=O)ccc1)C(O)=O Chemical compound N[C@@H](Cc1cc(C(O)=O)ccc1)C(O)=O JANONUPBHGWOBP-QMMMGPOBSA-N 0.000 description 1
- FLANAULFKJSHFY-LJAQVGFWSA-N OC(c1c(C[C@@H](C(OCc2ccccc2)=O)N(Cc2ccccc2)Cc2ccccc2)cccc1)=O Chemical compound OC(c1c(C[C@@H](C(OCc2ccccc2)=O)N(Cc2ccccc2)Cc2ccccc2)cccc1)=O FLANAULFKJSHFY-LJAQVGFWSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Stapled peptides are useful for various applications. For example, as biologically active agents, they can be utilized to modulate various biological functions.
- the present disclosure provides powerful technologies (e.g., agents (e.g., those that are or comprise peptides, in many embodiments, stapled peptides), compositions, methods, etc.) for modulating various biological functions.
- provided technologies comprise designed structural features, e.g., novel amino acid residues, that can provide significantly improved properties and/or activities compared to comparable reference technologies that do not contain such designed structural features.
- the present disclosure provides designed amino acids as described herein, whose incorporation into peptide agents, including stapled peptides, can provide significantly improved properties and/or activities such as improved lipophilicity and/or delivery into cells compared to reference amino acids (e.g., Asp).
- the present disclosure provides technologies including peptides comprising such designed amino acid residues.
- the present disclosure provides stapled peptides comprise such designed amino acid residues.
- the present disclosure provides technologies for modulating one or more functions of beta-catenin.
- the present disclosure provides various peptides, in many instances stapled peptides, that can bind to beta-catenin.
- the present disclosure provides various agents, e.g., peptides, in many instances stapled peptides, that can bind to beta-catenin and modulate its functions.
- the present disclosure binds agents that can interact with beta-catenin at a unique set of residues.
- a binding site comprises one or more or all of the set of residues.
- provided agents interact with one or more of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, R376, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419.
- provided agents interact with one or more of amino acid residue that are or correspond to A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- provided agents interact with one or more of amino acid residues that are or correspond to A305, Y306, G307, N308, Q309, K312, K345, V346, V349, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- provided agents interact with one or more of amino acid residues that are or correspond to G307, K312, K345, W383, N387,
- provided agents interact with one or more of amino acid residues that are or correspond to K312, K345, R386 and W383 of SEQ ID NO: 1. In some embodiments, provided agents interact with one or more of amino acid residues that are or correspond to K312, K345 and W383 of SEQ ID NO: 1.
- provided technologies can modulate one or more biological processes associated with beta-catenin.
- provided agents compete with a ligand for a particular binding site (e.g., with a member of the T cell factor/lymphoid enhancer factor (TCF/LEF) family of transcription factors at the TCF site on beta-catenin).
- TCF/LEF T cell factor/lymphoid enhancer factor
- provided technologies compete with TCF for interactions with beta-catenin.
- binding of provided agents to a beta-catenin site decreases, suppresses and/or blocks binding to beta-catenin by another binding partner (e.g., a kinase).
- binding of provided agents blocks binding of beta-catenin by a TCF/LEF family member.
- the present disclosure provides agents that can bind to a site of beta-catenin, e.g., a TCF binding site of beta-catenin, selectively over one of more other potential binding sites of beta-catenin (e.g., for other ligands such as peptides, proteins, etc.; in some embodiments, a ligand is Axin; in some embodiments, a ligand is Bcl9).
- provided technologies modulate one or more beta-catenin functions associated with its interactions with TCF.
- provided technologies selectively modulate beta- catenin functions, e.g., functions associated with TCF interactions. In some embodiments, provided technologies selectively modulate beta-catenin functions and do not significantly impact functions that are not associated with beta-catenin (e.g., various functions and/or processes in the Wnt pathway that are not associated with beta-catenin). In some embodiments, provided technologies are useful for inhibiting beta- catenin functions. In some embodiments, provided technologies are usefully for promoting and/or enhancing immune activities, e.g., anti-tumor adaptive immunity.
- provided technologies are useful for preventing or treating various conditions, disorders or diseases including cancer.
- the present disclosure provides methods for treating or preventing a condition, disorder or disease associated with beta-catenin, comprising administering to a subject suffered therefrom or susceptible thereto an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- a condition, disorder or disease is associated with beta-catenin’s interactions with TCF.
- an agent e.g., a staple peptide
- the present disclosure provides pharmaceutical compositions which comprise or deliver a provided agent or a pharmaceutically acceptable salt thereof.
- a pharmaceutical composition further comprises a lipid.
- a suitable lipid can promote delivery/activities.
- an agent is or comprises a peptide.
- an agent is or comprises a stapled peptides.
- provided agents that can bind beta- catenin comprise one or more designed amino acid residues. [0007]
- the present disclosure provides agents that bind to a polypeptide comprising or consisting of SEQ ID NO: 1 (Uniprot ID P35222), or residues 250-450 of SEQ ID NO: 1, or residues 305-419 of SEQ ID NO: 1: Uniprot No.
- provided agents specifically bind to a motif (e.g., a portion of a polypeptide, a domain of a polypeptide, etc.) that comprise one or more residues corresponding to Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419 of SEQ ID NO: 1.
- a motif e.g., a portion of a polypeptide, a domain of a polypeptide, etc.
- provided agents specifically bind to a motif (e.g., a portion of a polypeptide, a domain of a polypeptide, etc.) that comprise one or more residues corresponding to Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419 of SEQ ID NO: 1.
- a motif e.g., a portion of a polypeptide, a domain of a polypeptide, etc.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- an agent specifically binds to a motif comprising one or more of the following residues within SEQ ID NO:
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gin 375, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Lys345, Val346, Val349, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- provided technologies bind to a motif comprising at least 2, 3, 4, 5, 6, or 7 of G307, K312, K345, W383, N387, D413, and N415.
- provided agents specifically bind to such motifs.
- a motif may be referred to as a binding site.
- provided technologies selectively bind to such a binding site over an Axin binding site.
- provided technologies selectively bind to such a binding site over a Bcl9 binding site.
- provided technologies selectively bind to such a binding site over a TCF binding site.
- provided technology binds to such a binding site in a reverse N to C direction compared to TCF.
- provided technologies do not bind to Axin binding site of beta-catenin.
- provided technologies do not bind to Bcl9 binding site of beta-catenin.
- Various technologies e.g., crystallography, NMR, biochemical assays, etc., may be utilized to assess interactions with beta-catenin in accordance with the present disclosure.
- a staple there are two amino acid residues between two amino acid residues bonded to the same staple.
- Such a staple may be referred to as a (i, i+3) staple.
- a staple is (i, i+3).
- a staple is (i, i+4). In some embodiments, a staple is (i, i+7). In some embodiments, there are two staples in a provided agent. In some embodiments, one staple is (i, i+3) and the other is (i, i+7).
- the present disclosure provides an agent of formula I: R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein each variable is independently as described herein.
- the present disclosure provides an agent which is or comprises: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 , wherein: each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic or polar group; X 9 comprises a side chain comprising an optionally substituted aromatic group; X 12 comprises a side chain comprising an optionally substituted aromatic group; and X 13 comprises a side chain comprising an optionally substituted aromatic group.
- the present disclosure provides an agent which is or comprises: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic or polar group; X 9
- the present disclosure provides an agent which is or comprises: [X]pX 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X]p’; wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of p and p’ is independently 0-10; each of X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or
- an agent is [X]pX 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X]p’.
- an agent is R N ⁇ [X]pX 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X]p’ ⁇ R C .
- the present disclosure provides an agent which is or comprises: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 ,
- an agent is or comprises a peptide. In some embodiments, an agent is or comprises a stapled peptide. In some embodiments, X 1 and X 4 , and/or X 4 and X 11 are independently amino acid residues suitable for stapling, or are stapled, X 3 and X 10 independently amino acid residues suitable for stapling, or are stapled, X 1 and X 4 , and/or X 10 and X 14 are independently amino acid residues suitable for stapling, or are stapled, or X 1 and X 4 , and/or X 7 and X 14 are independently amino acid residues suitable for stapling, or are stapled.
- X 1 and X 4 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are stapled. In some embodiments, X 4 and X 11 are independently amino acid residues suitable for stapling. In some embodiments, X 4 and X 11 are stapled. In some embodiments, X 10 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 10 and X 14 are stapled. In some embodiments, X 7 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 7 and X 14 are stapled.
- X 1 and X 4 , and X 10 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are stapled, and X 10 and X 14 are stapled. In some embodiments, X 1 and X 4 , and X 7 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are stapled, and X 7 and X 14 are stapled. In some embodiments, X 1 and X 4 , and X 4 and X 11 are independently amino acid residues suitable for stapling.
- a stapled peptide is a stitched peptide comprising two or more staples, some of which may bond to the same backbone atom.
- X 1 and X 4 are stapled, and X 4 and X 11 are stapled.
- a staple connecting X 1 and X 4 and a staple connecting X 4 and X 11 are bonded to a common backbone atom of X 4 .
- a common backbone atom is the alpha-carbon of X 4 .
- X 3 and X 10 are independently amino acid residues suitable for stapling. In some embodiments, X 3 and X 10 are stapled.
- an agent has a molecular mass of no more than about 5000 Daltons. In some embodiments, it is no more than about 2500, 3000, 3500, 4000, 4500 or 5000 Daltons. In some embodiments, it is no more than about 2500 Daltons. In some embodiments, it is no more than about 3000 Daltons. In some embodiments, it is no more than about 3500 Daltons. In some embodiments, it is no more than about 4000 Daltons. In some embodiments, it is no more than about 500 Daltons.
- the present disclosure provides various reagents and methods associated with provided agents including, for example, reagents and/or systems for identifying, characterizing and/or assessing them, strategies for preparing them, and various diagnostic and therapeutic methods relating to them.
- the present disclosure provides pharmaceutical compositions comprising or delivering a provided agent and a pharmaceutical acceptable carrier.
- a provided agent is a pharmaceutically acceptable salt form.
- a provided composition comprises a pharmaceutically acceptable salt form an agent.
- agents are provided as pharmaceutically acceptable salt forms.
- the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin, comprising contacting beta-catenin with a provided agent. In some embodiments, the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin in a system comprising beta-catenin, comprising administering to a system an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin in a system expressing beta-catenin, comprising administering or delivering to a system an effective amount of a provided agent. In some embodiments, an activity of beta-catenin is inhibited or reduced. In some embodiments, a function of beta-catenin is inhibited or reduced. In some embodiments, a property, activity and/or function is associated with beta-catenin/TCF interaction.
- the present disclosure provides methods for modulating beta- catenin/TCF interaction. In some embodiments, the present disclosure provides methods for modulating beta-catenin/TCF interaction, comprising contacting beta-catenin with a provided agent. In some embodiments, the present disclosure provides methods for modulating beta-catenin/TCF interaction in a system comprising beta-catenin and TCF, comprising administering or delivering to the system an effective amount a provided agent. In some embodiments, the present disclosure provides methods for modulating beta-catenin/TCF interaction in a system expressing beta-catenin and TCF, comprising administering or delivering to the system an effective amount a provided agent. In some embodiments, interactions between beta-catenin and TCF is reduced. In some embodiments, interactions between beta- catenin and TCF is inhibited.
- the present disclosure provides methods for inhibiting cell proliferation, comprising administering or delivering to a population of cells an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell proliferation in a system, comprising administering or delivering to the system an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell growth, comprising administering or delivering to a population of cells an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell growth in a system, comprising administering or delivering to the system an effective amount of a provided agent. In some embodiments, such cell proliferation is beta-catenin dependent. In some embodiments, such cell growth is beta-catenin dependent. In some embodiments, such proliferation or growth is dependent on beta-catenin interactions with TCF.
- the present disclosure provides methods for reducing or preventing activation of a WNT pathway. In some embodiments, the present disclosure provides methods for reducing or preventing activation of a WNT pathway in a system, comprising administering or delivering to the system an effective amount of a provided agent.
- a system is in vitro. In some embodiments, a system is ex vivo. In some embodiments, a system is in vivo. In some embodiments, a system is or comprise a cell. In some embodiments, a system is or comprises a tissue. In some embodiments, a system is or comprises an organ. In some embodiments, a system is or comprises an organism. In some embodiments, a system is an animal. In some embodiments, a system is human. In some embodiments, a system is or comprises cells, tissues or organs associated with a condition, disorder or disease. In some embodiments, a system is or comprises cancer cells.
- the present disclosure provides methods for preventing conditions, disorders or diseases. In some embodiments, the present disclosure provides methods for reducing risks of conditions, disorders or diseases. In some embodiments, the present disclosure provides methods for preventing a condition, disorder or disease, comprising administering or delivering to a subject susceptible thereto an effective amount of an agent of the present disclosure. In some embodiments, the present disclosure provides methods for reducing risk of a condition, disorder or disease, comprising administering or delivering to a subject susceptible thereto an effective amount of an agent of the present disclosure. In some embodiments, the present disclosure provides methods for reducing risks of a condition, disorder or disease in a population, comprising administering or delivering to a population of subjects susceptible thereto an effective amount of an agent of the present disclosure.
- the present disclosure provides methods for treating conditions, disorders or diseases.
- the present disclosure provides methods for treating a condition, disorder or disease, comprising administering or delivering to a subject suffering therefrom an effective amount of an agent of the present disclosure.
- a symptom is reduced, removed or prevented.
- one or more parameters for assessing a condition, disorder or disease are improved.
- survival of subjects are extended.
- prevention, reduced risks, and/or effects of treatment may be assessed through clinical trials and may be observed in subject populations.
- a condition, disorder or disease is cancer.
- a condition, disorder or disease is associated with beta-catenin.
- a condition, disorder or disease is associated with beta-catenin interaction with TCF.
- a condition, disorder or disease is bladder cancer.
- a condition, disorder or disease is endometrial cancer.
- a condition, disorder or disease is adrenocortical carcinoma.
- a condition, disorder or disease is gastric cancer.
- a condition, disorder or disease is lung cancer.
- a condition, disorder or disease is melanoma.
- a condition, disorder or disease is esophageal cancer.
- a condition, disorder or disease is colorectal cancer.
- a cancer is liver cancer.
- a cancer is prostate cancer.
- a cancer is breast cancer.
- a cancer is endometrial cancer.
- agents are administered as pharmaceutically compositions that comprise or deliver such agents.
- agents are provided and/or delivered in pharmaceutically acceptable salt forms.
- a composition e.g., a liquid composition of certain pH
- an agent may exist in various forms including various pharmaceutically acceptable salt forms.
- a provided agent is utilized in combination with a second therapy.
- a provided agent is utilized in combination with a second therapeutic agent.
- a second therapy or therapeutic agent is administered prior to an administration or delivery of a provided agent.
- a second therapy or therapeutic agent is administered at about the same time as an administration or delivery of a provided agent.
- a second therapy or therapeutic agent is administered subsequently to an administration or delivery of a provided agent.
- a subject is exposed to both a provided agent and a second therapeutic agent.
- a subject is exposed to a therapeutic effect of a provided agent and a therapeutic effect of a second therapeutic agent.
- a second therapy is or comprises surgery. In some embodiments, a second therapy is or comprises radiation therapy. In some embodiments, a second therapy is or comprises immunotherapy. In some embodiments, a second therapeutic agent is or comprises a drug. In some embodiments, a second therapeutic agent is or comprises a cancer drug. In some embodiments, a second therapeutic agent is or comprises a chemotherapeutic agent. In some embodiments, a second therapeutic agent is or comprises a hormone therapy agent. In some embodiments, a second therapeutic agent is or comprises a kinase inhibitor. In some embodiments, a second therapeutic agent is or comprises a checkpoint inhibitor (e.g., antibodies against PD1-, PD-L1, CTLA-4, etc.).
- a checkpoint inhibitor e.g., antibodies against PD1-, PD-L1, CTLA-4, etc.
- a provide agent can be administered with lower unit dose and/or total dose compared to being used alone.
- a second agent can be administered with lower unit dose and/or total dose compared to being used alone.
- one or more side effects associated with administration of a provided agent and/or a second therapy or therapeutic agent are reduced.
- a combination therapy provides improved results, e.g., when compared to each agent utilized individually.
- a combination therapy achieves one or more better results, e.g., when compared to each agent utilized individually.
- Fig. 1 Provided agents can modulate gene expression in cells. As demonstrated herein, provided peptides can effectivley reduce expression of various nucleic acids such as Axin2 and Myc. For each gene, from left to right: 1-796, 1-849, and 1-922.
- Fig. 2 Provided technologies do not significantly impact expression of various beta-catenin- independent genes including various beta-catenin-independent WNT target genes such as PLOD2 and LCOR. For each gene, from left to right: 1-796, 1-849, and 1-922.
- Fig. 3. Provided technologies can effectively modulate expression. As shown in a report assay (1-849: square; 1-922: triangle), provided peptides can effectively reduce expression compared to a control peptide 1-796 (circle).
- Administration typically refers to the administration of a composition to a subject or system.
- routes that may, in appropriate circumstances, be utilized for administration to a subject, for example a human.
- administration may be ocular, oral, parenteral, topical, etc.
- administration may be bronchial (e.g., by bronchial instillation), buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc), enteral, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e. g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
- bronchial e.g., by bronchial instillation
- buccal which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc
- enteral intra-arterial, intradermal, intragastric
- administration may involve dosing that is intermittent (e.g., a plurality of doses separated in time) and/or periodic (e.g., individual doses separated by a common period of time) dosing. In some embodiments, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time.
- affinity is a measure of the tightness with a particular ligand (e.g., an agent) binds to its partner (e.g., beta-catenin or a portion thereof). Affinities can be measured in different ways. In some embodiments, affinity is measured by a quantitative assay. In some such embodiments, binding partner concentration may be fixed to be in excess of ligand concentration so as to mimic physiological conditions. Alternatively or additionally, in some embodiments, binding partner concentration and/or ligand concentration may be varied. In some such embodiments, affinity may be compared to a reference under comparable conditions (e.g., concentrations).
- agent in general, the term “agent”, as used herein, may be used to refer to a compound or entity of any chemical class including, for example, a polypeptide, nucleic acid, saccharide, lipid, small molecule, metal, or combination or complex thereof.
- the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
- the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
- the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
- an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
- potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
- the term “agent” may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
- the term “agent” may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties. In some embodiments, the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety. In some embodiments, an agent is a compound. In some embodiments, an agent is a stapled peptide.
- Aliphatic means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a substituted or unsubstituted monocyclic, bicyclic, or polycyclic hydrocarbon ring that is completely saturated or that contains one or more units of unsaturation (but not aromatic), or combinations thereof.
- aliphatic groups contain 1-50 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-20 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-10 aliphatic carbon atoms.
- aliphatic groups contain 1-9 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-8 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-7 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-6 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1, 2, 3, or 4 aliphatic carbon atoms.
- Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
- Alkenyl As used herein, the term “alkenyl” refers to an aliphatic group, as defined herein, having one or more double bonds.
- Alkyl As used herein, the term “alkyl” is given its ordinary meaning in the art and may include saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl substituted cycloalkyl groups, and cycloalkyl substituted alkyl groups. In some embodiments, alkyl has 1-100 carbon atoms. In certain embodiments, a straight chain or branched chain alkyl has about 1-20 carbon atoms in its backbone (e.g., C 1 -C 20 for straight chain, C 2 -C 20 for branched chain), and alternatively, about 1-10.
- cycloalkyl rings have from about 3-10 carbon atoms in their ring structure where such rings are monocyclic, bicyclic, or polycyclic, and alternatively about 5, 6 or 7 carbons in the ring structure.
- an alkyl group may be a lower alkyl group, wherein a lower alkyl group comprises 1-4 carbon atoms (e.g., C 1 -C 4 for straight chain lower alkyls).
- Alkylene refers to a bivalent alkyl group.
- Amino acid In its broadest sense, as used herein, refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g., through formation of one or more peptide bonds.
- an amino acid comprising an amino group and an a carboxylic acid group.
- an amino acid has the structure of NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH, wherein each variable is independently as described in the present disclosure.
- an amino acid has the general structure NH(R’)–C(R’) 2 –COOH, wherein each R’ is independently as described in the present disclosure.
- an amino acid has the general structure H 2 N–C(R’) 2 – COOH, wherein R’ is as described in the present disclosure. In some embodiments, an amino acid has the general structure H 2 N–C(H)(R’)–COOH, wherein R’ is as described in the present disclosure. In some embodiments, an amino acid is a naturally-occurring amino acid. In some embodiments, an amino acid is a non-natural amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid. “Standard amino acid” refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides.
- Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
- an amino acid including a carboxy- and/or amino-terminal amino acid in a polypeptide, can contain a structural modification as compared with the general structure above.
- an amino acid may be modified by methylation, amidation, acetylation, pegylation, glycosylation, phosphorylation, and/or substitution (e.g., of the amino group, the carboxylic acid group, one or more protons, one or more hydrogens, and/or the hydroxyl group) as compared with the general structure.
- such modification may, for example, alter the circulating half-life of a polypeptide containing the modified amino acid as compared with one containing an otherwise identical unmodified amino acid. In some embodiments, such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared with one containing an otherwise identical unmodified amino acid.
- amino acid may be used to refer to a free amino acid; in some embodiments it may be used to refer to an amino acid residue of a polypeptide.
- an analog refers to a substance that shares one or more particular structural features, elements, components, or moieties with a reference substance. Typically, an “analog” shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in certain discrete ways.
- an analog is a substance that can be generated from the reference substance, e.g., by chemical manipulation of the reference substance. In some embodiments, an analog is a substance that can be generated through performance of a synthetic process substantially similar to (e.g. , sharing a plurality of steps with) one that generates the reference substance. In some embodiments, an analog is or can be generated through performance of a synthetic process different from that used to generate the reference substance.
- Animal ⁇ As used herein refers to any member of the animal kingdom. In some embodiments, "animal” refers to humans, of either sex and at any stage of development. In some embodiments,
- animal refers to non-human animals, at any stage of development.
- the non human animal is a mammal (e.g. , a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig).
- animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms.
- an animal may be a transgenic animal, genetically engineered animal, and/or a clone.
- aryl used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” “aryloxyalkyl,” etc. refers to monocyclic, bicyclic or polycyclic ring systems having a total of five to thirty ring members, wherein at least one ring in the system is aromatic.
- an aryl group is a monocyclic, bicyclic or polycyclic ring system having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic, and wherein each ring in the system contains 3 to 7 ring members.
- an aryl group is a biaryl group.
- aryl may be used interchangeably with the term “aryl ring.”
- aryl refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, binaphthyl, anthracyl and the like, which may bear one or more substituents.
- aryl is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like, where a radical or point of attachment is on an aryl ring.
- Two events or entities are “associated” with one another, as that term is used herein, if the presence, level and/or form of one is correlated with that of the other.
- a particular entity e.g., nucleic acid (e.g., genomic DNA, transcripts, mR A, etc.), polypeptide, genetic signature, metabolite, microbe, etc..
- nucleic acid e.g., genomic DNA, transcripts, mR A, etc.
- polypeptide e.g., polypeptide
- genetic signature e.g., metabolite, microbe, etc.
- binding typically refers to a non-covalent association between or among agents. In many embodiments herein, binding is addressed with respect to particular agents and beta-catenin. It will be appreciated by those of ordinary skill in the art that such binding may be assessed in any of a variety of contexts. In some embodiments, binding is assessed with respect to beta-catenin. In some embodiments, binding is assessed with respect to one or more amino acid residues of beta-catenin. In some embodiments, binding is assessed with respect to one or more amino acid residues corresponding to (e.g., similarly positioned in three dimensional space and/or having certain similar properties and/or functions) those of beta-catenin.
- Binding site refers to a region of a target polypeptide, formed in three-dimensional space, that includes one or more or all interaction residues of the target polypeptide.
- binding site may refer to one or more amino acid residues which comprise or are one or more or all interaction amino acid residues of a target polypeptide.
- a binding site may include residues that are adjacent to one another on a linear chain, and/or that are distal to one another on a linear chain but near to one another in three-dimensional space when a target polypeptide is folded.
- a binding site may comprise amino acid residues and/or saccharide residues.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which a composition is administered.
- carriers can include sterile liquids, such as, for example, water and oils, including oils of petroleum, animal, vegetable or synthetic origin, such as, for example, peanut oil, soybean oil, mineral oil, sesame oil and the like.
- carriers are or include one or more solid components.
- Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
- comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
- composition may be used to refer to a discrete physical entity that comprises one or more specified components.
- a composition may be of any form – e.g., gas, gel, liquid, solid, etc.
- Cycloaliphatic refers to saturated or partially unsaturated aliphatic monocyclic, bicyclic, or polycyclic ring systems having, e.g., from 3 to 30, members, wherein the aliphatic ring system is optionally substituted.
- Cycloaliphatic groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, norbornyl, adamantyl, and cyclooctadienyl.
- the cycloalkyl has 3–6 carbons.
- cycloaliphatic may also include aliphatic rings that are fused to one or more aromatic or nonaromatic rings, such as decahydronaphthyl or tetrahydronaphthyl, where a radical or point of attachment is on an aliphatic ring.
- a carbocyclic group is bicyclic.
- a carbocyclic group is tricyclic.
- a carbocyclic group is polycyclic.
- cycloaliphatic refers to a monocyclic C 3 -C 6 hydrocarbon, or a C 8 -C 10 bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, or a C 9 -C 16 tricyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic.
- Derivative refers to a structural analogue of a reference substance.
- a “derivative” is a substance that shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in certain discrete ways.
- a derivative is a substance that can be generated from the reference substance by chemical manipulation.
- a derivative is a substance that can be generated through performance of a synthetic process substantially similar to (e.g., sharing a plurality of steps with) one that generates the reference substance.
- Dosage form or unit dosage form may be used to refer to a physically discrete unit of an active agent (e.g., a therapeutic or diagnostic agent) for administration to a subject.
- each such unit contains a predetermined quantity of active agent.
- such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
- a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
- the total amount of a therapeutic composition or agent administered to a particular subject is determined by one or more attending physicians and may involve administration of multiple dosage forms.
- Dosing regimen may be used to refer to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
- a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
- a dosing regimen comprises a plurality of doses each of which is separated in time from other doses.
- individual doses are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
- all doses within a dosing regimen are of the same unit dose amount. In some embodiments, different doses within a dosing regimen are of different amounts.
- a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some embodiments, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (i.e. is a therapeutic dosing regimen).
- Engineered refers to the aspect of having been manipulated by the hand of man.
- a peptide may be considered to be engineered if its amino acid sequence has been selected by man.
- an engineered agent has an amino acid sequence that was selected based on preferences for corresponding amino acids at particular sites of protein-protein interactions.
- an engineered sequence has an amino acid sequence that differs from the amino acid sequence of polypeptides included in the NCBI database that binds to a TCF site of beta-catenin.
- provided agents are engineered agents.
- engineered agents are peptide agents comprising non-natural amino acid residues, non-natural amino acid sequences, and/or peptide staples.
- provided agents comprise or are engineered peptide agents which comprise engineered sequences.
- Halogen means F, Cl, Br, or I.
- heteroaliphatic is given its ordinary meaning in the art and refers to aliphatic groups as described herein in which one or more carbon atoms are replaced with one or more heteroatoms (e.g ., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
- heteroalkyl is given its ordinary meaning in the art and refers to alkyl groups as described herein in which one or more carbon atoms is replaced with a heteroatom (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
- heteroalkyl groups include, but are not limited to, alkoxy, polyethylene glycol)-, alkyl-substituted amino, tetrahydrofuranyl, piperidinyl, morpholinyl, etc.
- Heteroaryl The terms “heteroaryl” and “heteroar-,” used alone or as part of a larger moiety, e.g., “heteroaralkyl,” or “heteroaralkoxy,” refer to monocyclic, bicyclic or polycyclic ring systems having, for example, atotal of five to thirty, e.g., 5, 6, 9, 10, 14, etc., ring members, wherein at least one ring in the system is aromatic and at least one aromatic ring atom is a heteroatom.
- a heteroatom is nitrogen, oxygen or sulfur.
- a heteroaryl group is a group having 5 to 10 ring atoms (i.e., monocyclic, bicyclic or polycyclic), in some embodiments 5, 6, 9, or 10 ring atoms. In some embodiments, a heteroaryl group has 6, 10, or 14 p electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms.
- Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
- a heteroaryl is a heterobiaryl group, such as bipyridyl and the like.
- heteroaryl and “heteroar-”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where a radical or point of attachment is on a heteroaromatic ring.
- Non-limiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H quinolizinyl.
- heteroaryl group may be monocyclic, bicyclic or polycyclic.
- heteroaryl may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted.
- heterooaralkyl refers to an alkyl group substituted by a heteroaryl group, wherein the alkyl and heteroaryl portions independently are optionally substituted.
- Heteroatom means an atom that is not carbon and is not hydrogen.
- a heteroatom is oxygen, sulfur, nitrogen, phosphorus, boron or silicon (including any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quatemized form of any basic nitrogen or a substitutable nitrogen of a heterocyclic ring (for example, N as in 3.4-dihydro-2 /-pyrrolyl). NH (as in pyrrolidinyl) or NR + (as in N-substituted pyrrolidinyl); etc.).
- a heteroatom is boron, nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen or sulfur.
- Heterocyclyl As used herein, the terms “heterocycle,” “heterocyclyl,” “heterocyclic radical,” and “heterocyclic ring” are used interchangeably and refer to a monocyclic, bicyclic or polycyclic ring moiety (e.g. , 3-30 membered) that is saturated or partially unsaturated and has one or more heteroatom ring atoms.
- a heteroatom is boron, nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen or sulfur.
- a heterocyclyl group is a stable 5– to 7– membered monocyclic or 7– to 10–membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
- nitrogen includes substituted nitrogen.
- the nitrogen may be N (as in 3,4–dihydro–2H– pyrrolyl), NH (as in pyrrolidinyl), or + NR (as in N–substituted pyrrolidinyl).
- a heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
- saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
- heterocycle used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H– indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl, where a radical or point of attachment is on a heteroaliphatic ring.
- a heterocyclyl group may be monocyclic, bicyclic or polycyclic.
- heterocyclylalkyl refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
- homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
- certain amino acids are typically classified as similar to one another as “hydrophobic” or “hydrophilic” amino acids, and/or as having “polar” or “non-polar” side chains. Substitution of one amino acid for another of the same type may often be considered a “homologous” substitution.
- Typical amino acid categorizations are summarized below (hydrophobicity scale of Kyte and Doolittle, 1982: A simple method for displaying the hydropathic character of a protein. J. Mol. Biol. 157:105-132):
- the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence.
- the nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position; when a position in the first sequence is occupied by a similar nucleotide as the corresponding position in the second sequence, then the molecules are similar at that position.
- the percent homology between the two sequences is a function of the number of identical and similar positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
- Representative algorithms and computer programs useful in determining the percent homology between two nucleotide sequences include, for example, the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent homology between two nucleotide sequences can, alternatively, be determined for example using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
- Interaction residues refers to, with respect to an agent, residues or motifs in an agent that are designed to interact with particular target residues in a target polypeptide, or with respect to a target polypeptide, residues in a target polypeptide that interact with particular motifs (e.g., aromatic groups, amino acid residues, etc.) of an agent.
- interaction residues and motifs of various agents are selected and arranged within the agents so that they will be displayed in three dimensional space within a predetermined distance (or volume) of identified target residues (e.g., upon binding, docking or other interaction assays).
- interaction residues are direct-binding residues.
- an assessed value achieved in a subject or system of interest may be “improved” relative to that obtained in the same subject or system under different conditions (e.g., prior to or after an event such as administration of an agent of interest), or in a different, comparable subject (e.g., in a comparable subject or system that differs from the subject or system of interest in presence of one or more indicators of a particular disease, disorder or condition of interest, or in prior exposure to a condition or agent, etc).
- comparative terms refer to statistically relevant differences (e.g., that are of a prevalence and/or magnitude sufficient to achieve statistical relevance). Those skilled in the art will be aware, or will readily be able to determine, in a given context, a degree and/or prevalence of difference that is required or sufficient to achieve such statistical significance.
- Partially unsaturated refers to a moiety that includes at least one double or triple bond.
- the term “partially unsaturated” is intended to encompass groups having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties.
- Peptide The term “peptide” as used herein refers to a polypeptide.
- a peptide is a polypeptide that is relatively short, for example having a length of less than about 100 amino acids, less than about 50 amino acids, less than about 40 amino acids less than about 30 amino acids, less than about 25 amino acids, less than about 20 amino acids, less than about 15 amino acids, or less than 10 amino acids.
- composition refers to an active agent, formulated together with one or more pharmaceutically acceptable carriers.
- active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
- compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
- oral administration for example, drenches (aqueous or non-aqueous solutions or suspension
- compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- composition or vehicle such as a liquid or solid fdler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- materials which can serve as pharmaceutically -acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as com starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic sa
- compositions that are appropriate for use in pharmaceutical contexts, i.e., salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known.
- pharmaceutically acceptable salts include, but are not limited to, nontoxic acid addition salts, which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other known methods such as ion exchange.
- nontoxic acid addition salts which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other known methods such as ion exchange.
- pharmaceutically acceptable salts include, but are not limited to, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethane sulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palm
- pharmaceutically acceptable salts include, but are not limited to, nontoxic base addition salts, such as those formed by acidic groups of provided compounds with bases.
- Representative alkali or alkaline earth metal salts include salts of sodium, lithium, potassium, calcium, magnesium, and the like.
- pharmaceutically acceptable salts are ammonium salts (e.g., ⁇ N(R) 3 + ).
- pharmaceutically acceptable salts are sodium salts.
- pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl having from 1 to 6 carbon atoms, sulfonate and aryl sulfonate.
- Polypeptide As used herein refers to any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature.
- a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
- a polypeptide may comprise or consist of natural amino acids, non-natural amino acids, or both.
- a polypeptide may comprise or consist of only natural amino acids or only non-natural amino acids.
- a polypeptide may comprise D-amino acids, L-amino acids, or both.
- a polypeptide may comprise only D-amino acids.
- a polypeptide may comprise only L-amino acids.
- a polypeptide may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide’s N-terminus, at the polypeptide’s C-terminus, or any combination thereof.
- such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, lipidation, methylation, pegylation, etc., including combinations thereof.
- a polypeptide may be cyclic, and/or may comprise a cyclic portion.
- a polypeptide is not cyclic and/or does not comprise any cyclic portion.
- a polypeptide is linear.
- a polypeptide may be or comprise a stapled polypeptide.
- the term “polypeptide” may be appended to a name of a reference polypeptide, activity, or structure; in such instances it is used herein to refer to polypeptides that share the relevant activity or structure and thus can be considered to be members of the same class or family of polypeptides.
- the present specification provides and/or those skilled in the art will be aware of exemplary polypeptides within the class whose amino acid sequences and/or functions are known; in some embodiments, such exemplary polypeptides are reference polypeptides for the polypeptide class or family.
- a member of a polypeptide class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference polypeptide of the class; in some embodiments with all polypeptides within the class).
- a common sequence motif e.g., a characteristic sequence element
- shares a common activity in some embodiments at a comparable level or within a designated range
- a member polypeptide shows an overall degree of sequence homology or identity with a reference polypeptide that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments be or comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
- a conserved region that may in some embodiments be or comprise a characteristic sequence element
- Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
- a relevant polypeptide may comprise or consist of a fragment of a parent polypeptide.
- a useful polypeptide as may comprise or consist of a plurality of fragments, each of which is found in the same parent polypeptide in a different spatial arrangement relative to one another than is found in the polypeptide of interest (e.g., fragments that are directly linked in the parent may be spatially separated in the polypeptide of interest or vice versa, and/or fragments may be present in a different order in the polypeptide of interest than in the parent), so that the polypeptide of interest is a derivative of its parent polypeptide.
- Prevent or prevention refers to reducing the risk of developing the disease, disorder and/or condition and/or to delaying onset of one or more characteristics or symptoms of the disease, disorder or condition. Prevention may be considered complete when onset of a disease, disorder or condition has been delayed for a predefined period of time.
- Protecting group The term “protecting group,” as used herein, is well known in the art and includes those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
- Suitable amino–protecting groups include methyl carbamate, ethyl carbamante, 9–fluorenylmethyl carbamate (Fmoc), 9–(2–sulfo)fluorenylmethyl carbamate, 9–(2,7–dibromo)fluoroenylmethyl carbamate, 2,7–di–t–butyl–[9–(10,10–dioxo–10,10,10,10– tetrahydrothioxanthyl)]methyl carbamate (DBD–Tmoc), 4–methoxyphenacyl carbamate (Phenoc), 2,2,2– trichloroethyl carbamate (Troc), 2–trimethylsilylethyl carbamate (Teoc), 2–phenylethyl carbamate (hZ), 1–(1–adamantyl)–1–methylethyl carbamate (Adpoc), 1,1–dimethyl–2–haloe
- suitable mono-protected amines include, but are not limited to, aralkylamines, carbamates, allyl amines, amides, and the like.
- suitable mono-protected amino moieties include t-butyloxycarbonylamino (-NHBOC), ethyloxycarbonylamino, methyloxycarbonylamino, trichloroethyloxycarbonylamino, allyloxycarbonylamino (-NHAlloc), benzyloxocarbonylamino (-NHCBZ), allylamino, benzylamino (-NHBn), fluorenylmethylcarbonyl (- NHFmoc), formamido, acetamido, chloroacetamido, dichloroacetamido, trichloroacetamido, phenylacetamido, trifluoroacetamido, benzamido, t
- suitable di-protected amines include amines that are substituted with two substituents independently selected from those described above as mono-protected amines, and further include cyclic imides, such as phthalimide, maleimide, succinimide, and the like.
- suitable di- protected amines include pyrroles and the like, 2,2,5,5-tetramethyl-[1,2,5]azadisilolidine and the like, and azide.
- Suitably protected carboxylic acids further include, but are not limited to, silyl–, alkyl–, alkenyl–, aryl–, and arylalkyl–protected carboxylic acids.
- Examples of suitable silyl groups include trimethylsilyl, triethylsilyl, t–butyldimethylsilyl, t–butyldiphenylsilyl, triisopropylsilyl, and the like.
- Examples of suitable alkyl groups include methyl, benzyl, p–methoxybenzyl, 3,4–dimethoxybenzyl, trityl, t–butyl, tetrahydropyran–2–yl.
- Examples of suitable alkenyl groups include allyl.
- Examples of suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl.
- Suitable arylalkyl groups include optionally substituted benzyl (e.g., p–methoxybenzyl (MPM), 3,4– dimethoxybenzyl, O–nitrobenzyl, p–nitrobenzyl, p–halobenzyl, 2,6–dichlorobenzyl, p–cyanobenzyl), and 2– and 4–picolyl.
- suitable protected carboxylic acids include, but are not limited to, optionally substituted C 1–6 aliphatic esters, optionally substituted aryl esters, silyl esters, activated esters, amides, hydrazides, and the like.
- ester groups include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, benzyl, and phenyl ester, wherein each group is optionally substituted.
- Additional suitable protected carboxylic acids include oxazolines and ortho esters.
- Suitable hydroxyl protecting groups include methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t–butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p–methoxybenzyloxymethyl (PMBM), (4–methoxyphenoxy)methyl (p–AOM), guaiacolmethyl (GUM), t–butoxymethyl, 4–pentenyloxymethyl (POM), siloxymethyl, 2– methoxyethoxymethyl (MEM), 2,2,2–trichloroethoxymethyl, bis(2–chloroethoxy)methyl, 2– (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3–bromotetrahydropyranyl, tetrahydrothiopyranyl, 1–methoxycyclohexyl, 4–methoxytetrahydropyrany
- the protecting groups include methylene acetal, ethylidene acetal, 1–t– butylethylidene ketal, 1–phenylethylidene ketal, (4–methoxyphenyl)ethylidene acetal, 2,2,2– trichloroethylidene acetal, acetonide, cyclopentylidene ketal, cyclohexylidene ketal, cycloheptylidene ketal, benzylidene acetal, p–methoxybenzylidene acetal, 2,4–dimethoxybenzylidene ketal, 3,4– dimethoxybenzylidene acetal, 2–nitrobenzylidene acetal, methoxymethylene acetal, ethoxymethylene acetal, dimethoxymethylene ortho ester, 1–methoxyethy
- a hydroxyl protecting group is acetyl, t-butyl, tbutoxymethyl, methoxymethyl, tetrahydropyranyl, 1 -ethoxyethyl, 1 -(2-chloroethoxy)ethyl, 2- trimethylsilylethyl, p- chlorophenyl, 2,4-dinitrophenyl, benzyl, benzoyl, p-phenylbenzoyl, 2,6- dichlorobenzyl, diphenylmethyl, p-nitrobenzyl, triphenylmethyl (trityl), 4,4'-dimethoxytrityl, trimethylsilyl, triethylsilyl, t- butyldimethylsilyl, t-butyldiphenylsilyl, triphenylsilyl, triisopropylsilyl, benzoylformate, chloroacetyl, trichlor
- each of the hydroxyl protecting groups is, independently selected from acetyl, benzyl, t- butyldimethylsilyl, t-butyldiphenylsilyl and 4,4'- dimethoxytrityl.
- the hydroxyl protecting group is selected from the group consisting of trityl, monomethoxytrityl and 4,4'-dimethoxytrityl group.
- a phosphorous linkage protecting group is a group attached to the phosphorous linkage (e.g., an intemucleotidic linkage) throughout oligonucleotide synthesis.
- a protecting group is attached to a sulfur atom of an phosphorothioate group. In some embodiments, a protecting group is attached to an oxygen atom of an intemucleotide phosphorothioate linkage. In some embodiments, a protecting group is attached to an oxygen atom of the intemucleotide phosphate linkage.
- a protecting group is 2-cyanoethyl (CE or Cne), 2-trimethylsilylethyl, 2-nitroethyl, 2- sulfonylethyl, methyl, benzyl, o-nitrobenzyl, 2-(p-nitrophenyl)ethyl (NPE orNpe), 2-phenylethyl, 3-(N- tert-butylcarboxamido)-l -propyl, 4-oxopentyl, 4-methylthio-l -butyl, 2-cyano-l,l-dimethylethyl, 4-N- methylaminobutyl, 3 -(2-pyridyl)-l -propyl, 2-[N-methyl-N-(2-pyridyl)]aminoethyl, 2-(N-formyl,N- methyl)aminoethyl, or 4-[N-methyl-N-(2,2,2-trifluoroacetyl
- Protected thiols are well known in the art and include those described in detail in Greene (1999). Suitable protected thiols further include, but are not limited to, disulfides, thioethers, silyl thioethers, thioesters, thiocarbonates, and thiocarbamates, and the like. Examples of such groups include, but are not limited to, alkyl thioethers, benzyl and substituted benzyl thioethers, triphenylmethyl thioethers, and trichloroethoxycarbonyl thioester, to name but a few.
- Reference As used herein describes a standard or control relative to which a comparison is performed. For example, in some embodiments, an agent, animal, individual, population, sample, sequence or value of interest is compared with a reference or control agent, animal, individual, population, sample, sequence or value. In some embodiments, a reference or control is tested and/or determined substantially simultaneously with the testing or determination of interest. In some embodiments, a reference or control is a historical reference or control, optionally embodied in a tangible medium. Typically, as would be understood by those skilled in the art, a reference or control is determined or characterized under comparable conditions or circumstances to those under assessment. Those skilled in the art will appreciate when sufficient similarities are present to justify reliance on and/or comparison to a particular possible reference or control.
- Specificity is a measure of the ability of a particular ligand (e.g., an agent) to distinguish its binding partner (e.g., beta-catenin) from other potential binding partners (e.g., another protein, another portion (e.g., domain) of beta-catenin.
- binding partner e.g., beta-catenin
- substitution As described herein, compounds of the disclosure may contain optionally substituted and/or substituted moieties. In general, the term “substituted,” whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
- an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
- Combinations of substituents envisioned by this disclosure are preferably those that result in the formation of stable or chemically feasible compounds.
- stable refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein. In some embodiments, example substituents are described below.
- Suitable monovalent substituents on Ro are independently halogen, —(CH 2 ) 0–2 R ⁇ , – (haloR ⁇ ), –(CH 2 ) 0–2 OH, –(CH 2 ) 0–2 OR ⁇ , –(CH 2 ) 0–2 CH(OR ⁇ ) 2 ; –O(haloR ⁇ ), –CN, –N 3 , –(CH 2 ) 0–2 C(O)R ⁇ , – (CH 2 ) 0–2 C(O)OH, –(CH 2 ) 0–2 C(O)OR ⁇ , –(CH 2 ) 0–2 SR ⁇ , –(CH 2 ) 0–2 SH, –(CH 2 ) 0–2 NH 2 , –(CH 2 ) 0–2
- Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: –O(CR* 2) 2–3 O–, wherein each independent occurrence of R* is selected from hydrogen, C 1–6 aliphatic which may be substituted as defined below, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Suitable substituents on the aliphatic group of R* are halogen, –R ⁇ , -(haloR ⁇ ), –OH, ⁇ OR ⁇ , – O(haloR ⁇ ), –CN, –C(O)OH, –C(O)OR ⁇ , –NH 2 , –NHR ⁇ , –NR ⁇ 2, or –NO 2 , wherein each R ⁇ is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1–4 aliphatic, –CH 2 Ph, –O(CH 2 ) 0–1 Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- suitable substituents on a substitutable nitrogen are –R ⁇ , ⁇ NR ⁇ 2, – C(O)R ⁇ , –C(O)OR ⁇ , –C(O)C(O)R ⁇ , –C(O)CH 2 C(O)R ⁇ , –S(O) 2 R ⁇ , –S(O) 2 NR ⁇ 2, ⁇ C(S)NR ⁇ 2, –C(NH)NR ⁇ 2, or –N(R ⁇ )S(O) 2 R ⁇ ; wherein each R ⁇ is independently hydrogen, C 1–6 aliphatic which may be substituted as defined below, unsubstituted –OPh, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or, notwithstanding the definition above, two independent occurrences of R ⁇ ,
- Suitable substituents on the aliphatic group of R ⁇ are independently halogen, ⁇ R ⁇ , -(haloR ⁇ ), –OH, –OR ⁇ , –O(haloR ⁇ ), –CN, –C(O)OH, –C(O)OR ⁇ , –NH 2 , –NHR ⁇ , –NR ⁇ 2, or –NO 2 , wherein each R ⁇ is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1–4 aliphatic, –CH 2 Ph, –O(CH 2 ) 0–1 Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Subject refers to any organism to which a provided compound or composition is administered in accordance with the present disclosure e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.) and plants. In some embodiments, a subject may be suffering from, and/or susceptible to a disease, disorder, and/or condition. In some embodiments, a subject is a human.
- Susceptible to An individual who is “susceptible to” a disease, disorder, and/or condition is one who has a higher risk of developing the disease, disorder, and/or condition than does a member of the general public. In some embodiments, an individual who is susceptible to a disease, disorder and/or condition may not have been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may exhibit symptoms of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may not exhibit symptoms of the disease, disorder, and/or condition.
- Target polypeptide is a polypeptide with which an agent interacts.
- a target polypeptide is a beta-catenin polypeptide.
- a target polypeptide comprises, consists essentially of, or is a binding site of beta- catenin polypeptide.
- Target residue is a residue within a target polypeptide with which an agent is designed to interact.
- an agent may be characterized by particular interaction motifs (e.g., aromatic groups as described herein) and/or residues (e.g., amino acid residues comprising aromatic groups as described herein) selected and arranged (by virtue of being presented on the selected scaffold) to be within a certain predetermined distance (or volume) of a target residue.
- a target residue is or comprises an amino acid residue.
- Therapeutic agent refers to an agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
- a therapeutic agent is any substance that can be used to alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
- Therapeutic regimen refers to a dosing regimen whose administration across a relevant population may be correlated with a desired or beneficial therapeutic outcome.
- therapeutically effective amount means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that elicits a desired biological response when administered as part of a therapeutic regimen.
- a therapeutically effective amount of a substance is an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
- the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
- the effective amount of compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
- a therapeutically effective amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically effective amount.
- Treat refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
- Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition.
- treatment may be administered to a subject who exhibits only early signs of the disease, disorder, and/or condition, for example for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
- Unit dose refers to an amount administered as a single dose and/or in a physically discrete unit of a pharmaceutical composition.
- a unit dose contains a predetermined quantity of an active agent.
- a unit dose contains an entire single dose of the agent.
- more than one unit dose is administered to achieve a total single dose.
- administration of multiple unit doses is required, or expected to be required, in order to achieve an intended effect.
- a unit dose may be, for example, a volume of liquid (e.g., an acceptable carrier) containing a predetermined quantity of one or more therapeutic agents, a predetermined amount of one or more therapeutic agents in solid form, a sustained release formulation or drug delivery device containing a predetermined amount of one or more therapeutic agents, etc. It will be appreciated that a unit dose may be present in a formulation that includes any of a variety of components in addition to the therapeutic agent(s). For example, acceptable carriers (e.g., pharmaceutically acceptable carriers), diluents, stabilizers, buffers, preservatives, etc.. may be included as described infra.
- acceptable carriers e.g., pharmaceutically acceptable carriers
- diluents e.g., diluents, stabilizers, buffers, preservatives, etc.. may be included as described infra.
- a total appropriate daily dosage of a particular therapeutic agent may comprise a portion, or a plurality, of unit doses, and may be decided, for example, by the attending physician within the scope of sound medical judgment.
- the specific effective dose level for any particular subject or organism may depend upon a variety of factors including the disorder being treated and the severity of the disorder; activity of specific active compound employed; specific composition employed; age, body weight, general health, sex and diet of the subject; time of administration, and rate of excretion of the specific active compound employed; duration of the treatment; drugs and/or additional therapies used in combination or coincidental with specific compound(s) employed, and like factors well known in the medical arts.
- Unsaturated means that a moiety has one or more units of unsaturation.
- salts such as pharmaceutically acceptable acid or base addition salts, stereoisomeric forms, and tautomeric forms, of provided compound are included.
- the term “a” or “an” may be understood to mean “at least one”; (ii) the term “or” may be understood to mean “and/or”; (iii) the terms “comprising”, “comprise”, “including” (whether used with “not limited to” or not), and “include” (whether used with “not limited to” or not) may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; (iv) the term “another” may be understood to mean at least an additional/second one or more; (v) the terms “about” and “approximately” may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (vi) where ranges are provided, endpoints are included.
- a provided agent is or comprises a peptide.
- a provided agent is a peptide.
- a peptide is a stapled peptide.
- a provided agent is a stapled peptide.
- a peptide is a stitched peptide.
- a provided agent is a stitched peptide.
- a stitched peptide comprises two or more staples, wherein two staples are bonded to the same peptide backbone atom.
- Stapled peptides as described herein are typically peptides in which two or more amino acids of a peptide chain are linked through connection of two peptide backbone atoms of the amino acid residues and, as is understood by those skilled in the art, the connection is not through the peptide backbone between the linked amino acid residues.
- a stapled peptide comprises one or more staples.
- a staple as described herein is a linker that can link one amino acid residue to another amino acid residue through bonding to a peptide backbone atom of each of the amino acid residues and, as is understood by those skilled in the art, the connection through a staple is not through the peptide backbone between the linked amino acid residues.
- a staple bonds to the peptide backbone by replacing one or more hydrogen and/or substituents (e.g., side chains, O, S, etc.) on peptide backbone atoms (e.g., C, N, etc.).
- substituents e.g., side chains, O, S, etc.
- side chains form portions of staples.
- a staple is bonded to two carbon backbone atoms, e.g., two alpha carbon atoms.
- a staple comprises C(R’) 2 or N(R’), either individually or as part of a large moiety, wherein R’ is R and is taken together with another group attached to a backbone atom which can be R (e.g., R a3 ) and their intervening atoms to form a ring as described herein (e.g., when PyrS2 is stapled in various peptides).
- R is R and is taken together with another group attached to a backbone atom which can be R (e.g., R a3 ) and their intervening atoms to form a ring as described herein (e.g., when PyrS2 is stapled in various peptides).
- a peptide e.g., a stapled peptide
- a stapled peptide is or comprise a helical structure.
- a peptide is a stapled peptide.
- a staple is a hydrocarbon staple.
- a staple as described herein is a non-hydrocarbon staple.
- a non-hydrocarbon staple comprises one or more chain heteroatoms wherein a chain of a staple is the shortest covalent connection within the staple from one end of the staple to the other end of the staple.
- a non-hydrocarbon staple is or comprises at least one sulfur atom derived from an amino acid residue of a polypeptide.
- a non-hydrocarbon staple comprises two sulfur atom derived from two different amino acid residues of a polypeptide.
- a non-hydrocarbon staple comprises two sulfur atoms derived from two different cysteine residues of a polypeptide.
- a staple is a cysteine staple.
- a staple is a non-cysteine staple.
- a non-hydrocarbon staple is a carbamate staple and comprises a carbamate moiety (e.g., ⁇ N(R’) ⁇ C(O) ⁇ O ⁇ ) in its chain.
- a non-hydrocarbon staple is an amino staple and comprises an amino group (e.g., ⁇ N(R’) ⁇ ) in its chain.
- a non-hydrocarbon staple is an ester staple and comprises an ester moiety ( ⁇ C(O) ⁇ O ⁇ ) in its chain.
- a non- hydrocarbon staple is an amide staple and comprises an amide moiety ( ⁇ C(O) ⁇ N(R’) ⁇ ) in its chain.
- a non-hydrocarbon staple is a sulfonamide staple and comprises a sulfonamide moiety ( ⁇ S(O) 2 ⁇ N(R’) ⁇ ) in its chain.
- a non-hydrocarbon staple is an ether staple and comprises an ether moiety ( ⁇ O ⁇ ) in its chain.
- an amino group in an amino staple e.g., ( ⁇ N(R’) ⁇
- R’ of a carbamate moiety, amino group, amide moiety, sulfonamide moiety, or ether moiety is R, and is taken together with an R group attached to a backbone (e.g., R a3 when it is R) and their intervening atoms to form a ring as described herein.
- R’ of a carbamate moiety or amino group is R, and is taken together with an R group attached to a backbone (e.g., R a3 when it is R) and their intervening atoms to form a ring as described herein.
- a staple comprises one or more amino groups, e.g., ⁇ N(R’) ⁇ , wherein each R’ is independently as described herein.
- ⁇ N(R’) ⁇ bonds to two carbon atoms.
- ⁇ N(R’) ⁇ bonds to two carbon atoms, wherein neither of the two carbon atoms are bond to any heteroatoms through a double bond.
- ⁇ N(R’) ⁇ bonds to two sp3 carbon atoms.
- a staple comprises one or more ⁇ C(O) ⁇ N(R’) ⁇ groups, wherein each R’ is independently as described herein.
- a staple comprises one or more carbamate groups, e.g., one or more ⁇ (O) ⁇ C(O) ⁇ N(R’) ⁇ , wherein each R’ is independently as described herein.
- R’ is ⁇ H.
- R’ is optionally substituted C 1- 6 aliphatic.
- R’ is optionally substituted C 1-6 alkyl.
- R’ is C 1- 6 aliphatic.
- R’ is C 1-6 alkyl.
- R’ is methyl.
- a stapled peptide comprise one or more staples.
- a stapled peptide comprises one and no more than one staple. In some embodiments, a stapled peptide comprises two and no more than two staples. In some embodiments, two staples of a stapled peptide bond to a common backbone atom. In some embodiments, two staples of a stapled peptide bond to a common backbone atom which is an alpha carbon atom of an amino acid residue.
- peptides, e.g., staple peptides, of the present disclosure is or comprises a helix structure. As those skilled in the art will appreciate, helixes can have various lengths. In some embodiments, lengths of helixes range from 5 to 30 amino acid residues.
- a length of a helix is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, or more, amino acid residues. In some embodiments, a length of a helix is 6 amino acid residues. In some embodiments, a length of a helix is 8 amino acid residues. In some embodiments, a length of a helix is 10 amino acid residues. In some embodiments, a length of a helix is 12 amino acid residues. In some embodiments, a length of a helix is 14 amino acid residues. In some embodiments, a length of a helix is 16 amino acid residues. In some embodiments, a length of a helix is 17 amino acid residues.
- a length of a helix is 18 amino acid residues. In some embodiments, a length of a helix is 19 amino acid residues. In some embodiments, a length of a helix is 20 amino acid residues.
- Amino acids stapled together can have various number of amino acid residues in between, e.g., 1-20, 1-15, 1-10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, etc.
- a staple is (i, i+4) which means there are three amino acid residues between the two amino acids (at positions i and i+4, respectively) that bond to the staple (at positions i+1, i+2, i+3, respectively).
- a staple is (i, i+3). In some embodiments, a staple is (i, i+5). In some embodiments, a staple is (i, i+6). In some embodiments, a staple is (i, i+7). In some embodiments, a staple is (i, i+8). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+7). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+4).
- a stapled peptide comprises two staples, one is (i, i+4) and the other is (i, i+7). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+3). In some embodiments, a stapled peptide comprises two staples, one is (i, i+4) and the other is (i, i+4). In some embodiments, a stapled peptide comprises two staples, one is (i, i+7) and the other is (i, i+7). In some embodiments, the two staples are bonded to a common backbone atom, e.g., an alpha carbon atom of an amino acid residue.
- a stapled peptide comprises a staple which staple is L s , wherein L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , each of L s1 , L s2 , and L s3 is independently L, wherein each L is independently as described in the present disclosure.
- a provided staple is L s .
- L s1 comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- L s1 is ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic.
- R’ is optionally substituted C 1-6 alkyl. In some embodiments, R’ is C 1- 6 alkyl. In some embodiments, R’ is methyl. In some embodiments, the peptide backbone atom to which L s1 is bonded is also bonded to R 1 , and R’and R 1 are both R and are taken together with their intervene atoms to form an optionally substituted ring as described in the present disclosure. In some embodiments, a formed ring has no additional ring heteroatoms in addition to the nitrogen atom to which R’ is bonded. In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4- membered.
- a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered.
- L’ is optionally substituted bivalent C 1 -C 20 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 15 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 8 aliphatic.
- L’ is optionally substituted bivalent C 1 -C 7 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 4 aliphatic. In some embodiments, L’ is optionally substituted alkylene. In some embodiments, L’ is optionally substituted alkenylene. In some embodiments, L’ is unsubstituted alkylene. In some embodiments, L’ is ⁇ CH 2 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 2 ⁇ .
- L’ is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 5 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 6 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 7 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 8 ⁇ . In some embodiments, L’ is bonded to a peptide backbone atom. In some embodiments, L’ is optionally substituted alkenylene. In some embodiments, L’ is unsubstituted alkenylene.
- L s1 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s1 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s1 is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s1 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s1 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure. [0117] In some embodiments, L s1 comprises at least one ⁇ O ⁇ . In some embodiments, L s1 is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure. [0118] In some embodiments, L s1 is a covalent bond. [0119] In some embodiments, L s1 is L’, wherein L’ is as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. [0122] In some embodiments, L s3 comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(CH 3 )C(O) ⁇ , wherein L’ is independently as described in the present disclosure.
- L s3 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s3 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s3 is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s3 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure. [0125] In some embodiments, L s3 comprises at least one ⁇ O ⁇ . In some embodiments, L s3 is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure. [0126] In some embodiments, L s3 is L’, wherein L’ is as described in the present disclosure. In some embodiments, L s3 is optionally substituted alkylene.
- L s3 is unsubstituted alkylene.
- L s comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(O) ⁇ .
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(S) ⁇ .
- L s comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure.
- L s , L s1 , L s2 , and L s3 each independently and optionally comprise a R’ group, e.g., a R’ group in ⁇ C(R’) 2 ⁇ , ⁇ N(R’) ⁇ , etc., and the R’ group is taken with a group (e.g., a group that can be R) attached to a backbone atom (e.g., R a1 , R a2 , R a3 , a R’ group of L a1 or L a2 (e.g., a R’ group in ⁇ C(R’) 2 ⁇ , ⁇ N(R’) ⁇ , etc.), etc.) to form a double bond or an optionally substituted ring as two R groups can.
- a R’ group e.g., a R’ group in ⁇
- a formed ring is an optionally substituted 3-10 membered ring. In some embodiments, a formed ring is an optionally substituted 3-membered ring. In some embodiments, a formed ring is an optionally substituted 4-membered ring. In some embodiments, a formed ring is an optionally substituted 5-membered ring. In some embodiments, a formed ring is an optionally substituted 6-membered ring. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated. In some embodiments, a formed ring is partially unsaturated. In some embodiments, a formed ring is aromatic.
- a formed ring comprises one or more ring heteroatom (e.g., nitrogen).
- a staple, or L s , L s1 , L s2 , and/or L s3 comprises ⁇ N(R’) ⁇ , and the R’ is taken together with a group attached to a backbone atom to form an optionally substituted ring as described herein.
- a staple, or L s , L s1 , L s2 , and/or L s3 comprises ⁇ C(R’) 2 ⁇ , and the R’ is taken together with a group attached to a backbone atom to form an optionally substituted ring as described herein.
- L is used to refer to a linker moiety as described herein; each L superscript (e.g., L a , L s1 , L s2 , L s3 , L s , etc.) therefore is understood, in some embodiments, to be L, unless otherwise specified.
- L comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(O) ⁇ .
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(S) ⁇ .
- L is ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. [0132] In some embodiments, L comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 )C(O) ⁇ , wherein L’ is independently as described in the present disclosure.
- L comprises at least one ⁇ C(O)O ⁇ .
- L comprises at least one ⁇ C(O)O ⁇ .
- L is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure.
- L is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure.
- L comprises at least one ⁇ O ⁇ . In some embodiments, L is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure. [0136] In some embodiments, L is L’, wherein L’ is as described in the present disclosure. In some embodiments, L is optionally substituted alkylene. In some embodiments, L is unsubstituted alkylene. [0137] In some embodiments, L is optionally substituted bivalent C 1 -C 25 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 20 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 15 aliphatic.
- L is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 8 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 7 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 4 aliphatic. In some embodiments, L is optionally substituted alkylene.
- L is optionally substituted alkenylene. In some embodiments, L is unsubstituted alkylene. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 5 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 6 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 7 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 8 ⁇ .
- L is bonded to a peptide backbone atom.
- L is optionally substituted alkenylene.
- L is unsubstituted alkenylene.
- m is 3. In some embodiments, m is 4. In some embodiments, m is 5. In some embodiments, m is 6. In some embodiments, m is 7. In some embodiments, m is 8. In some embodiments, m is 9. In some embodiments, m is 10. In some embodiments, m is 11. In some embodiments, a staple is referred to a (i, i+m) staple.
- a n1 is a carbon atom. In some embodiments, A n1 is achiral. In some embodiments, A n1 is chiral. In some embodiments, A n1 is R. In some embodiments, A n1 is S.
- a n2 is a carbon atom. In some embodiments, A n2 is achiral. In some embodiments, A n2 is chiral. In some embodiments, A n2 is R. In some embodiments, A n2 is S. [0142] In some embodiments, A n1 is achiral and A n2 is achiral. In some embodiments, A n1 is achiral and A n2 is R. In some embodiments, A n1 is achiral and A n2 is S. In some embodiments, A n1 is R and A n2 is achiral. In some embodiments, A n1 is R and A n2 is R.
- a n1 is R and A n2 is S. In some embodiments, A n1 is S and A n2 is achiral. In some embodiments, A n1 is S and A n2 is R. In some embodiments, A n1 is S and A n2 is S. [0143] In some embodiments, provided stereochemistry at staple-backbone connection points and/or combinations thereof, optionally together with one or more structural elements of provided peptide, e.g., staple chemistry (hydrocarbon, non-hydrocarbon), staple length, etc.
- staple chemistry hydrocarbon, non-hydrocarbon
- a staple can be of various lengths, in some embodiments, as represent by the number of chain atoms of a staple.
- a chain of a staple is the shortest covalent connection in the staple from a first end (connection point with a peptide backbone) of a staple to a second end of the staple, wherein the first end and the second end are connected to two different peptide backbone atoms.
- a staple comprises 5-30 chain atoms, e.g., 5-20, 5-15, 5, 6, 7, 8, 9, or 10 to 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 chain atoms.
- a staple comprises 5 chain atoms.
- a staple comprises 6 chain atoms.
- a staple comprises 7 chain atoms.
- a staple comprises 8 chain atoms.
- a staple comprises 9 chain atoms. In some embodiments, a staple comprises 10 chain atoms. In some embodiments, a staple comprises 11 chain atoms. In some embodiments, a staple comprises 12 chain atoms. In some embodiments, a staple comprises 13 chain atoms. In some embodiments, a staple comprises 14 chain atoms. In some embodiments, a staple comprises 15 chain atoms. In some embodiments, a staple comprises 16 chain atoms. In some embodiments, a staple comprises 17 chain atoms. In some embodiments, a staple comprises 18 chain atoms. In some embodiments, a staple comprises 19 chain atoms. In some embodiments, a staple comprises 20 chain atoms.
- a staple has a length of 5 chain atoms. In some embodiments, a staple has a length of 6 chain atoms. In some embodiments, a staple has a length of 7 chain atoms. In some embodiments, a staple has a length of 8 chain atoms. In some embodiments, a staple has a length of 9 chain atoms. In some embodiments, a staple has a length of 10 chain atoms. In some embodiments, a staple has a length of 11 chain atoms. In some embodiments, a staple has a length of 12 chain atoms. In some embodiments, a staple has a length of 13 chain atoms. In some embodiments, a staple has a length of 14 chain atoms.
- a staple has a length of 15 chain atoms. In some embodiments, a staple has a length of 16 chain atoms. In some embodiments, a staple has a length of 17 chain atoms. In some embodiments, a staple has a length of 18 chain atoms. In some embodiments, a staple has a length of 19 chain atoms. In some embodiments, a staple has a length of 20 chain atoms. In some embodiments, a staple has a length of 8-15 chain atoms. In some embodiments, a staple has 8-12 chain atoms. In some embodiments, a staple has 9-12 chain atoms. In some embodiments, a staple has 9-10 chain atoms.
- a staple has 8-10 chain atoms.
- length of a staple can be adjusted according to the distance of the amino acid residues it connects, for example, a longer staple may be utilized for a (i, i+7) staple than a (i, i+4) or (i, i+3) staple.
- a (i, i+3) staple has about 5-10, 5-8, e.g., about 5, 6, 7, 8, 9 or 10 chain atoms.
- a (i, i+3) staple has 5 chain atoms.
- a (i, i+3) staple has 6 chain atoms.
- a (i, i+3) staple has 7 chain atoms.
- a (i, i+3) staple has 8 chain atoms. In some embodiments, a (i, i+3) staple has 9 chain atoms. In some embodiments, a (i, i+3) staple has 10 chain atoms. In some embodiments, a (i, i+4) staple has about 5-12, 5-10, 7-12, 5-8, e.g., about 5, 6, 7, 8, 9, 10, 11 or 12 chain atoms. In some embodiments, a (i, i+4) staple has 5 chain atoms. In some embodiments, a (i, i+4) staple has 6 chain atoms. In some embodiments, a (i, i+4) staple has 7 chain atoms.
- a (i, i+4) staple has 8 chain atoms. In some embodiments, a (i, i+4) staple has 9 chain atoms. In some embodiments, a (i, i+4) staple has 10 chain atoms. In some embodiments, a (i, i+4) staple has 11 chain atoms. In some embodiments, a (i, i+4) staple has 12 chain atoms. In some embodiments, a (i, i+7) staple has about 8-25, 10-25, 10-16, 12-15, e.g., about 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 chain atoms. In some embodiments, a (i, i+7) staple has 8 chain atoms.
- a (i, i+7) staple has 9 chain atoms. In some embodiments, a (i, i+7) staple has 10 chain atoms. In some embodiments, a (i, i+7) staple has 11 chain atoms. In some embodiments, a (i, i+7) staple has 12 chain atoms. In some embodiments, a (i, i+7) staple has 13 chain atoms. In some embodiments, a (i, i+7) staple has 14 chain atoms. In some embodiments, a (i, i+7) staple has 15 chain atoms. In some embodiments, a (i, i+7) staple has 16 chain atoms.
- a (i, i+7) staple has 17 chain atoms. In some embodiments, a (i, i+7) staple has 18 chain atoms. In some embodiments, a (i, i+7) staple has 19 chain atoms. In some embodiments, a (i, i+7) staple has 20 chain atoms. In some embodiments, a (i, i+7) staple has 21 chain atoms. In some embodiments, a (i, i+7) staple has 22 chain atoms. In some embodiments, a stapled peptide has two staples, each of which is independently such a (i, i+3), (i, i+4) or (i, i+7) staple.
- a stapled peptide has such a (i, i+3) staple and such a (i, i+7) staple. In some embodiments, a stapled peptide has such a (i, i+4) staple and such a (i, i+7) staple.
- Staple lengths may be otherwise described. For example, in some embodiments, staple lengths may be described as the total number of chain atoms and non-chain ring atoms, where a non-chain ring atom is an atom of the staple which forms a ring with one or more chain atoms but is not a chain atom in that it is not within the shortest covalent connection from a first end of the staple to a second end of the staple.
- staples formed using Monomer A (which comprises an azetidine moiety), Monomer B (which comprises a pyrrolidine moiety), and/or Monomer C (which comprises a pyrrolidine moiety), etc., may comprise one or two non-chain ring atoms.
- a staple has no heteroatoms in its chain.
- a staple comprises at least one heteroatom in its chain.
- a staple comprises at least one nitrogen atom in its chain.
- a staple is L s , wherein L s is an optionally substituted, bivalent C 8-14 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is L s , wherein L s is an optionally substituted, bivalent C 9-13 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is L s , wherein L s is an optionally substituted, bivalent C 10-15 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is L s , wherein L s is an optionally substituted, bivalent C 11-14 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is a (i, i+3) staple in that not including the two amino acid residues that are directly connected to the staple, there are two amino acid residues between the two amino acid residues that are directly connected to the staple.
- a staple is a (i, i+4) staple in that not including the two amino acid residues that are directly connected to the staple, there are three amino acid residues between the two amino acid residues that are directly connected to the staple.
- a staple is a (i, i+7) staple in that not including the two amino acid residues that are directly connected to the staple, there are six amino acid residues between the two amino acid residues that are directly connected to the staple.
- any replacement of methylene units if any, is replaced with ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ C(O)O ⁇ , ⁇ S(O) 2 N(R’) ⁇ , or ⁇ O ⁇ .
- any replacement of methylene units, if any, is replaced with ⁇ N(R’) ⁇ , ⁇ N(R’) ⁇ C(O) ⁇ , or ⁇ N(R’)C(O)O ⁇ .
- any replacement of methylene units, if any, is replaced with ⁇ N(R’) ⁇ or ⁇ N(R’)C(O)O ⁇ .
- a staple comprises a double bond.
- a staple comprises a double bond may be formed by olefin metathesis of two olefins.
- staples are formed by metathesis reactions, e.g., involving one or more double bonds in amino acid residues as described herein.
- an olefin e.g., in a staple, is converted into ⁇ CHR’ ⁇ CHR’ ⁇ , wherein each R’ is independently as described herein.
- R’ is R as described herein.
- R’ is ⁇ H.
- each R’ is ⁇ H.
- R’ is ⁇ OR, wherein R is as described herein.
- R’ is ⁇ OH.
- R’ is ⁇ N(R) 2 wherein each R is independently as described herein.
- R’ is ⁇ SR wherein R is as described herein.
- R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 aliphatic. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkenyl. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkynyl. In some embodiments, ⁇ CHR’ ⁇ CHR’ ⁇ is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, each of the two olefins is independently of a side chain of an amino acid residue. In some embodiments, each olefin is independently a terminal olefin.
- each olefin is independently a mono-substituted olefin.
- an amino acid of formula A-I or a salt thereof has structure of formula A-IV: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ COOH, A-IV or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-IV or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid has structure of formula A-V: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ COOH, A-V or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-V or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid for stapling has structure of formula A-VI: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ L a2 ⁇ COOH, A-VI or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-VI or a salt thereof, wherein each variable is independently as described in the present disclosure.
- each of R SP1 and R SP2 independently comprises a reactive group.
- each of R SP1 and R SP2 is independently a reactive group.
- a reactive group is for a cycloaddition reaction (e.g., [3+2], [4+2], etc.), e.g., an alkene, an alkyne, a diene, a 1,3-dipole (e.g., ⁇ N 3 ), etc.
- a reactive group is optionally substituted ⁇ C ⁇ CH.
- a reactive group is ⁇ C ⁇ CH.
- a reactive group is ⁇ N 3 .
- R SP1 or R SP2 of a first amino acid residue and R SP1 or R SP2 of a second amino acid residue can react with each other so that the two amino acid residues are connected with a staple.
- a reaction is amidation and one reactive group is an amino group, e.g., ⁇ NHR wherein R is as described herein (e.g., in some embodiments, R is ⁇ H; in some embodiments, R is optionally substituted C 1-6 aliphatic), and the other is an acid group (e.g., ⁇ COOH) or an activated form thereof.
- a reaction is a cycloaddition reaction, e.g., [4+2], [3+2], etc.
- a first and a second reactive groups are two reactive groups suitable for a cycloaddition reaction.
- a reaction is a click reaction.
- one reaction group is or comprises ⁇ N 3
- the other is or comprises an alkyne, e.g., a terminal alkyne or a activated/strained alkyne.
- the other is or comprises ⁇ C ⁇ CH.
- R SP1 or R SP2 of a first amino acid residue and R SP1 or R SP2 of a second amino acid residue can react with a reagent so that the two are connected to form a staple.
- a reagent comprises two reactive groups, one of which reacts with R SP1 or R SP2 of a first amino acid residue, and the other reacts with R SP1 or R SP2 of a first amino acid residue.
- R SP1 or R SP2 of both amino acid residues are the same or the same type, e.g., both are amino groups, and the two reactive groups of a linking reagent are also the same, e.g., both are acid groups such as ⁇ COOH or activated form thereof.
- R SP1 or R SP2 of both amino acid residues are both acid groups, e.g., ⁇ COOH or activated form thereof, and both reactive groups of a linking agent are amino groups.
- R SP1 or R SP2 of both amino acid residues are both nucleophilic groups, e.g., ⁇ SH, and both reactive groups of a linking reagent are electrophilic (e.g., carbon attached to leaving groups such as ⁇ Br, ⁇ I, etc.).
- R SP1 and R SP2 are the same.
- R SP1 and R SP2 are different.
- R SP1 is or comprises ⁇ COOH.
- R SP1 is or comprises an amino group.
- R SP1 is or comprises ⁇ NHR.
- R is hydrogen or optionally substituted C 1-6 aliphatic.
- R SP1 is or comprises ⁇ NH 2 .
- R SP1 is or comprises ⁇ N 3 .
- R SP2 is or comprises ⁇ COOH.
- R SP2 is or comprises an amino group.
- R SP2 is or comprises ⁇ NHR.
- R is hydrogen or optionally substituted C 1-6 aliphatic.
- R SP2 is or comprises ⁇ NH 2 .
- R SP2 is or comprises ⁇ N 3 .
- each amino acid residue of a pair of amino acid residues is independently a residue of an amino acid of formula A-II or A-III or a salt thereof.
- such a pair of amino acid residues is stapled, e.g., through olefin metathesis.
- olefin in a staple is reduced.
- a staple has the structure of ⁇ L a ⁇ CH 2 ⁇ CH 2 ⁇ L a ⁇ , wherein each variable is independently as described herein.
- each amino acid residue of a pair of amino acid residues is independently a residue of an amino acid of formula A-II or A-III or a salt thereof.
- such a pair of amino acid residues is stapled, e.g., through olefin metathesis.
- olefin in a staple is reduced.
- a staple has the structure of ⁇ L a ⁇ CH 2 ⁇ CH 2 ⁇ L a ⁇ , wherein each variable is independently as described herein.
- one L a is L s1 as described herein, and one L a is L s3 as described herein.
- two amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by a staple have the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- two amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by a staple have the structure of ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- two amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by a staple have the structure of R a1 ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples have the structure of R a1 ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples have the structure of ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples (e.g., X 4 stapled with both X 1 and X 14 ) have the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )( ⁇ L s ⁇ R AA ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- each R AA is independently a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof.
- R AA is ⁇ C(R a3 )[ ⁇ L a1 ⁇ N(R a1 ) ⁇ ]( ⁇ L a2 ⁇ CO ⁇ ), wherein each variable is independently as described herein. In some embodiments, R AA is ⁇ C(R a3 )[ ⁇ N(R a1 ) ⁇ ]( ⁇ CO ⁇ ), wherein each variable is independently as described herein. In some embodiments, each R AA is independently ⁇ N( ⁇ )[ ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently ⁇ N( ⁇ )[ ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently R a1 ⁇ N( ⁇ )[ ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently R a1 ⁇ N( ⁇ )[ ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- Various staples e.g., L s , are as described herein.
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ as described herein.
- L s1 is L a as described herein.
- L s3 is L a as described herein.
- L s1 is L a of a first of two stapled amino acid residues.
- L s2 is L a of a second of two stapled amino acid residues.
- L s2 is or comprises a double bond.
- L s2 is or comprises optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is or comprises ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is or comprises ⁇ C(O)N(R’) ⁇ (e.g., a staple formed by two amino acid residues one of which has a R SP1 group that is or comprises an amino group and the other of which has a R SP2 group that is or comprises ⁇ COOH).
- L s2 is or comprises ⁇ C(O)NH ⁇ .
- each of L s1 and L s3 is independently optionally substituted linear or branched C 1-10 hydrocarbon chain.
- each of L s1 and L s3 is independently ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L s1 is ⁇ CH 2 ⁇ .
- L s3 is ⁇ (CH 2 ) 3 ⁇ .
- L s is ⁇ (CH 2 ) 6 ⁇ .
- L s is ⁇ (CH 2 ) 2 ⁇ C(O)NH ⁇ (CH 2 ) 4 ⁇ .
- L s is bonded to two backbone carbon atoms. In some embodiments, L s is bonded to two alpha carbon atoms of two stapled amino acid residues.
- L s is bonded to a backbone nitrogen atom and a backbone carbon atom (e.g., an alpha carbon).
- L a comprises at least one ⁇ N(R’) ⁇ wherein R’ is independently as described in the present disclosure.
- L a comprises ⁇ L am1 ⁇ N(R’) ⁇ wherein R’ is independently as described in the present disclosure, and L am1 is as described herein.
- L a is or comprises ⁇ L am1 ⁇ N(R’) ⁇ L am2 ⁇ , wherein each of L am1 , R’, and L am2 is independently as described herein.
- R’ is optionally substituted C 1-6 aliphatic. In some embodiments, R’ is methyl. In some embodiments, R’ is taken together with R a3 to form an optionally substituted ring as described herein. In some embodiments, a formed ring is a 3-10 membered monocyclic saturated ring as described herein. In some embodiments, a formed ring has no additional heteroatom ring atom in addition to the nitrogen of ⁇ N(R’) ⁇ . In some embodiments, a formed ring is 3- membered. In some embodiments, a formed ring is 4-membered. In some embodiments, a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered.
- L a comprises at least one ⁇ C(R’) 2 ⁇ wherein each R’ is independently as described in the present disclosure.
- L a comprises ⁇ L am1 ⁇ C(R’) 2 ⁇ wherein R’ is independently as described in the present disclosure, and L am1 is as described herein.
- L a is or comprises ⁇ L am1 ⁇ C(R’) 2 ⁇ L am2 ⁇ , wherein each of L am1 , R’, and L am2 is independently as described herein.
- R’ is ⁇ H.
- ⁇ C(R’) 2 ⁇ is optionally substituted ⁇ CH 2 ⁇ .
- ⁇ C(R’) 2 ⁇ is ⁇ CH 2 ⁇ .
- one R’ is taken together with R a3 to form an optionally substituted ring as described herein.
- a formed ring is a 3-10 membered monocyclic saturated ring as described herein.
- a formed ring has no additional heteroatom ring atom in addition to the nitrogen of ⁇ N(R’) ⁇ .
- a formed ring is 3-membered.
- a formed ring is 4-membered.
- a formed ring is 5-membered.
- a formed ring is 6-membered.
- each of L am1 and L am2 is independently L am as described herein.
- L am is a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L am is a covalent bond. In some embodiments, L am is an optionally substituted bivalent C 1 - C 10 aliphatic group. In some embodiments, L am is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am is optionally substituted C 1-10 alkylene. In some embodiments, L am is C 1-10 alkylene. In some embodiments, L am is optionally substituted linear C 1-10 alkylene. In some embodiments, L am is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am is ⁇ CH 2 ⁇ . [0169] In some embodiments, L am1 is a covalent bond.
- L am1 is an optionally substituted bivalent C 1 -C 10 aliphatic group. In some embodiments, L am1 is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am1 is optionally substituted C 1-10 alkylene. In some embodiments, L am1 is C 1-10 alkylene. In some embodiments, L am1 is optionally substituted linear C 1-10 alkylene. In some embodiments, L am1 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am1 is ⁇ CH 2 ⁇ . In some embodiments, L am1 is bonded to a backbone atom. In some embodiments, L am1 is bonded to an alpha-carbon of an amino acid.
- L am2 is a covalent bond. In some embodiments, L am2 is an optionally substituted bivalent C 1 -C 10 aliphatic group. In some embodiments, L am2 is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am2 is optionally substituted C 1-10 alkylene. In some embodiments, L am2 is C 1-10 alkylene. In some embodiments, L am2 is optionally substituted linear C 1-10 alkylene. In some embodiments, L am2 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am2 is ⁇ CH 2 ⁇ . In some embodiments, L am2 is or comprises ⁇ C(O) ⁇ .
- ⁇ C(O) ⁇ is bonded to a nitrogen atom.
- L am2 is or comprises ⁇ S(O) 2 ⁇ . In some embodiments, ⁇ S(O) 2 ⁇ is bonded to a nitrogen atom. In some embodiments, L am2 is or comprises ⁇ O ⁇ . In some embodiments, L am2 is or comprises ⁇ C(O) ⁇ O ⁇ . In some embodiments, ⁇ C(O) ⁇ O ⁇ is bonded to a nitrogen atom. In some embodiments, L am2 is bonded to a nitrogen atom, and it comprises a ⁇ C(O) ⁇ group which is bonded to the nitrogen atom.
- each of R a2 and R a3 independently comprises a double bond, e.g., a terminal olefin which can be optionally and independently stapled with another residue comprising an olefin.
- an amino acid are stapled with two amino acid residues independently through R a2 and R a3 .
- such an amino acid is B5.
- an amino acid is selected from Tables A-I, A-II, A-III (may be presented as Fmoc-protected).
- Fmoc-protected amino groups and carboxyl groups may independently form amide connections with other amino acid residues (or N- or C-terminus capping groups, or exist as N- or C-terminus amino or carboxyl groups).
- Olefins including those in Alloc groups, may be utilized to form staples through olefin metathesis.
- Staples comprising olefins may be further modified, e.g., through hydrogenation to convert olefin double bonds into single bonds, and/or through CO 2 extrusion to convert carbamate moieties (e.g., ⁇ O ⁇ (CO) ⁇ N(R’) ⁇ ) into amine moieties (e.g., ⁇ N(R’) ⁇ ).
- an agent is or comprises a stapled peptide (e.g., a stapled peptide described according to Table E3) or a salt thereof, in which stapled peptide each double bond is converted into a single bond.
- a conversion is achieved through hydrogenation which adds a ⁇ H to each olefin carbon atom.
- an olefin double bond is replaced with ⁇ CHR’ ⁇ CHR’ ⁇ , wherein each R’ is independently as described herein.
- R’ is R as described herein.
- R’ is ⁇ H.
- each R’ is ⁇ H.
- R’ is ⁇ OR, wherein R is as described herein.
- R’ is ⁇ OH.
- R’ is ⁇ N(R) 2 wherein each R is independently as described herein.
- R’ is ⁇ SR wherein R is as described herein.
- R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 aliphatic. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkenyl. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkynyl. In some embodiments, ⁇ CHR’ ⁇ CHR’ ⁇ is ⁇ CH 2 ⁇ CH 2 ⁇ . [0176] Table A-III. Exemplary amino acids (Fmoc-Protected). S 3 R 3 S 4
- an amino acid is an alpha-amino acid. In some embodiments, an amino acid is an L-amino acid. In some embodiments, an amino acid is a D-amino acid. In some embodiments, the alpha-carbon of an amino acid is achiral. In some embodiments, an amino acid is a beta-amino acid. In some embodiments, an amino acid is a gamma-amino acid. [0178] In some embodiments, a provided amino acid sequence contains two or more amino acid residues whose side chains are linked together to form one or more staples. In some embodiments, a provided amino acid sequence contains two or more amino acid residues, each of which independently has a side chain comprising an olefin.
- a provided amino acid sequence contains two or more amino acid residues, each of which independently has a side chain comprising a terminal olefin. In some embodiments, a provided amino acid sequence contains two and no more than two amino acid residues, each of which independently has a side chain comprising an olefin. In some embodiments, a provided amino acid sequence contains two and no more than two amino acid residues, each of which independently has a side chain comprising a terminal olefin. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid that comprises an olefin and a nitrogen atom other than the nitrogen atom of its amino group.
- a provided amino acid sequence comprises at least one residue of an amino acid that comprises a terminal olefin and a nitrogen atom other than the nitrogen atom of its amino group. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid that has a side chain than comprises a terminal olefin and a nitrogen atom.
- a provided amino acid sequence comprises at least one residue of an amino acid of formula A-I, wherein R a2 comprising an olefin and a ⁇ N(R’) ⁇ moiety, wherein R’ is as described in the present disclosure (including, in some embodiments, optionally taken together with R a3 and their intervening atoms to form an optionally substituted ring as described in the present disclosure).
- R a2 comprising a terminal olefin and a ⁇ N(R’) ⁇ moiety wherein R’ is as described in the present disclosure.
- a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-I.
- a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-II. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-III. In some embodiments, two olefins from two side chains are linked together through olefin metathesis to form a staple. In some embodiments, a staple is preferably formed by side chains of amino acid residues that are not at the corresponding positions of a target of interest. In some embodiments, a formed staple does not disrupt interaction between the peptide and a target of interest. [0179] In some embodiments, a provided staple is a hydrocarbon staple.
- a hydrocarbon staple comprises no chain heteroatoms wherein a chain of a staple is the shortest covalent connection within the staple from one end of the staple to the other end of the staple.
- an olefin in a staple is a Z-olefin.
- an olefin in a staple in an E-olefin in some embodiments, a provided composition comprises stapled peptides comprising a staple that contains a Z-olefin and stapled peptides comprising a staple that contains an E- olefin.
- a provided composition comprises stapled peptides comprising a staple that contains a Z-olefin.
- a provided composition comprises stapled peptides comprising a staple that contains an E-olefin.
- otherwise identical stapled peptides that differ only in the E/Z configuration of staple olefin demonstrate different properties and/or activities as demonstrated herein.
- stapled peptides with E-olefin in a staple may provide certain desirable properties and/or activities given the context.
- stapled peptides with Z-olefin in a staple may provide certain desirable properties and/or activities given the context.
- the present disclosure provides compositions comprising stapled peptides.
- a composition comprises one and only one stereoisomer of a stapled peptide (e.g., E or Z isomer, and/or a single diastereomer/enantiomer with respect to a chiral center, etc.).
- a composition comprises two or more stereoisomers (e.g., both E and Z isomers of one or more double bonds, and/or one or more diastereomers/enantiomers with respect to a chiral center, etc.).
- a composition corresponds to a single peak in a chromatographic separation, e.g., HPLC.
- a peak comprises one and only one stereoisomers.
- a peak comprises two or more stereoisomers.
- two staples may be bonded to the same atom of the peptide backbone, forming a stitched peptide.
- a staple is pro-lock wherein one end of the staple is bonded to the alpha-carbon of a proline residue.
- a staple is a staple illustrated below in Tables S-l, S-2, S-3, S-4 and S-
- a staple is a staple in Table S-
- the olefin is Z. In some embodiments, the olefin is E. In some embodiments, an (i, i+3) staple is selected from Table S-l. In some embodiments, an (i, i+3) staple is selected from Table S-2. Those skilled in the art reading the present disclosure will appreciate that when staples in Table S-l and Table S-2 are utilized for (i, i+3), “X 3 ” in those tables would be “X 2 ” (i.e., two amino acid residues instead of three amino acid residues). In some embodiments, an (i, i+4) staple is selected from Table S-l. In some embodiments, an (i, i+4) staple is selected from Table S-2. In some embodiments, an (i, i+7) staple is selected from Table S-3. In some embodiments, an (i, i+7) staple is selected from Table S-4.
- Table S-2 Exemplary staples.
- a staple may be one of the following, connecting the amino acids at the indicated position: Table S-5. Certain amino acids and staples.
- a peptide comprises a staple or stitch (two staples) from Table S-6.
- the amino acid residues can either be from N to C or C to N. In some embodiments, it is N to C. In some embodiments, it is C to N.
- a double bond is E. In some embodiments, a double bond is Z.
- a staple is a (i, i+3) staple. In some embodiments, a staple is a (i, i+4) staple. In some embodiments, a staple is a (i, i+7) staple.
- each double is independently E or Z when a structure comprises more than one double bond.
- each staple is independently a (i, i+3) or a (i, i+4) staple or a (i, i+7) staple. In some embodiments, each staple is independently a (i, i+4) staple or a (i, i+7) staple in a structure comprising two staples. In some embodiments, one staple is a (i, i+4) staple and the other is a (i, i+7) staple. In some embodiments, a PL3 residue is bonded to a (i, i+3) staple. In some embodiments, a PL3 residue is bonded to a (i, i+4) staple.
- staples are formed by metathesis of double bonds in side chains of amino acid residues, e.g., RdN and S7, R8 and PyrS, R5 and SeN, R6 and SeN, ReN and S5, ReN and S6, R7 and PyrS, Az and S7, R8 and SgN, Az and S8, R4 and SeN, R5 and SdN, R7 and Az, R8 and Az, RdN and S4, RgN and S8, RgN and S7, R8 and S5, PL3 and B5 and the same B5 and S8, PL3 and B5 and the same B5 and SeN, PL3 and B5 and the same B5 and SdN, PL3 and B5 and the same B5 and SdN, PL3 and B5 and the same B5 and SdN, PL3 and B5 and the same B5 and SdN, PL3 and B5 and the same B5 and SdN, PL3 and B5 and the same B5 and Sd
- a staple comprises ⁇ S ⁇ .
- stapling technologies comprise utilization of one or more, e.g., two or more, sulfur-containing moieties.
- a stapled peptide comprises cysteine stapling.
- two cysteine residues are stapled wherein the ⁇ S ⁇ moieties of the two cysteine residues are connected optionally through a linker.
- a stapled peptide com than one staples having the structure of .
- a stapled peptide comprises one and no more than one staples having the structure of .
- a stapled peptide comprises no staples having the structure of , , or . In some embodiments, a stapled peptide comprises no staples having the structure of having the structure of . [0192] In some embodiments, the present disclosure provides useful technologies relating to cysteine stapling. Among other things, the present disclosure appreciates that peptides amenable to cysteine stapling and/or comprising one or more cysteine staples, can be produced and/or assessed in a biological system.
- cysteine stapled peptides having a range of different structures (e.g., different amino acid sequences), and in fact can provide a user with complete control over selection and implementation of amino acid sequences to be incorporated into stapled peptides.
- Cysteine stapling involves linking one cysteine residue to another cysteine residue, where the resulting bond is not through the peptide backbone between the linked cysteine residues.
- a stapled peptide as described herein comprises a staple which staple is L s , wherein: L s is ⁇ L s1 ⁇ S ⁇ L s2 ⁇ S ⁇ L s3 ⁇ ; L s1 and L s3 are each independently L; L s2 is L and comprises at least one ⁇ C(O) ⁇ ; and each L is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 25 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’) ⁇ , ⁇ N(
- L is independently a bivalent C 1 -C 25 aliphatic group. In some embodiments, L is independently a bivalent C 1 -C 20 aliphatic group. In some embodiments, L is independently a bivalent C 1 -C 10 aliphatic group. In some embodiments, L is independently a bivalent C 1 - C 5 aliphatic group. In some embodiments, L is independently a bivalent C 1 aliphatic group. In some embodiments, L is ⁇ CH 2 . [0196] In some embodiments, L s1 is ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ .
- L s1 and L s3 are both ⁇ CH 2 ⁇ .
- L s is ⁇ CH 2 ⁇ S ⁇ L s2 ⁇ S ⁇ CH 2 ⁇ .
- L s2 comprises ⁇ C(R’) 2 ⁇ L’ ⁇ C(R’) 2 ⁇ , wherein L’ is described in the present disclosure.
- L s2 is ⁇ L x1 ⁇ C(O)Q ⁇ L’ ⁇ QC(O) ⁇ L x1 ⁇ , wherein each variable is independently as described in the present disclosure.
- L s2 is ⁇ CH 2 C(O)Q ⁇ L’ ⁇ QC(O)CH 2 ⁇ , wherein each ⁇ CH 2 ⁇ is independently and optionally substituted. In some embodiments, L s2 is ⁇ CH 2 C(O)Q ⁇ L’ ⁇ QC(O)CH 2 ⁇ . [0198] In some embodiments, L s2 In some embodiments, L s2 is L and comprises at least one ⁇ C(O) ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O) ⁇ .
- L s2 is L and comprises at least one ⁇ C(O)Q ⁇ , wherein Q is selected from the group consisting of: a covalent bond, ⁇ N(R’) ⁇ , ⁇ O ⁇ , and –S–. In some embodiments, L s2 is L and comprises at least one ⁇ C(O)Q ⁇ , wherein Q is selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)Q ⁇ , wherein Q is selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and –S–.
- L s2 is L and comprises at least two ⁇ C(O)Q ⁇ , wherein Q is selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ . In some embodiments, L s2 is L and comprises at least one ⁇ C(O)N(R’) ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)N(R’) ⁇ . In some embodiments, L s2 is L and comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)O ⁇ .
- L s2 comprises ⁇ Q ⁇ L’ ⁇ Q ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ Q ⁇ L’ ⁇ Q ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ , wherein L’ is described in the present disclosure.
- L s2 comprises –C(O)Q ⁇ L’ ⁇ QC(O) ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises –C(O)Q ⁇ L’ ⁇ QC(O) ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O, wherein L’ is described in the present disclosure.
- L s2 comprises – C(R’) 2 C(O)Q ⁇ L’ ⁇ QC(O)C(R’) 2 ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises –C(R’) 2 C(O)Q ⁇ L’ ⁇ QC(O)C(R’) 2 ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O, wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ N(R’) ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 comprises ⁇ C(O)N(R’) ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 is ⁇ C(R’) 2 C(O)N(R’) ⁇ L’ ⁇ N(R’)C(O)C(R’) 2 ⁇ , wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ O(R’) ⁇ L’ ⁇ O(R’) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 comprises ⁇ C(O)O ⁇ L’ ⁇ OC(O) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 is ⁇ C(R’) 2 C(O)O ⁇ L’ ⁇ OC(O)C(R’) 2 ⁇ , wherein L’ is described in the present disclosure. [0203] In some embodiments, R’ is an optionally substituted C 1-30 aliphatic. In some embodiments, R’ is an optionally substituted C 1-15 aliphatic.
- R’ is an optionally substituted C 1-10 aliphatic. In some embodiments, R’ is an optionally substituted C 1-5 aliphatic. In some embodiments, R’ is hydrogen. [0204] In some embodiments, L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 15 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 8 aliphatic.
- L’ is optionally substituted bivalent C 1 -C 7 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 3 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 2 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 aliphatic. In some embodiments, L’ is ⁇ CH 2 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 2 ⁇ .
- L’ is ⁇ (CH 2 ) 3 ⁇ . In some embodim ’ ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 5 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 6 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 7 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 8 ⁇ . [0205] In some embodiments, L’ is optionally substituted bivalent C 6-20 aryl ring. In some embodiments, L’ is optionally substituted bivalent C 6-14 aryl ring. In some embodiments, L’ is optionally substituted bivalent C 6-10 aryl ring.
- L’ is optionally substituted bivalent C 6 aryl ring. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least three halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with four halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two fluorine.
- L’ is bivalent C 6 aryl substituted with at least three fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with four fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least three chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with four chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted at with least one –O(CH2) 0-4 CH 3 .
- L’ is bivalent C 6 aryl substituted with at least two –O(CH2) 0-4 CH 3 . In some embodiments, L’ is bivalent C 6 aryl substituted with at least three –O(CH2) 0-4 CH 3 . In some embodiments, L’ is bivalent C 6 aryl substituted with four – O(CH2) 0-4 CH 3 . [0206] In some embodiments, L’ is bivalent 5-20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, L’ is bivalent 5-6 membered heteroaryl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- L’ is bivalent 5-6 membered heteroaryl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, L’ is bivalent 6 membered heteroaryl ring having 1-2 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, L’ is bivalent 6 membered heteroaryl ring having 2 nitrogen. [0207] In some embodiments, L’ is optionally substituted bivalent C 3-20 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-15 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-10 cycloaliphatic ring.
- L’ is optionally substituted bivalent C 3-9 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-8 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-7 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-6 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-5 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-4 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3 cycloaliphatic ring.
- L’ is optionally substituted bivalent C 4 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloalkyl ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloalkenyl ring. In some embodiments, L’ is optionally substituted bivalent C 6 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 6 cycloalkyl ring. [0208] In some embodiments, L s2 comprises ⁇ N(R’) ⁇ L’ ⁇ N(R’) ⁇ and L’ is a covalent bond.
- L s2 comprises ⁇ N(R) ⁇ N(R) ⁇ , wherein: each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1- 10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms,
- L s2 comprises ⁇ N(R) ⁇ N(R) ⁇ , wherein: each R is independently optionally substituted C 1-30 aliphatic; or two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered monocyclic ring.
- L s2 is a staple selected from the group consisting of:
- cysteine stapling is replaced with lysine stapling, wherein the cysteine residues for cysteine stapling are replaced with lysine residues for lysine stapling (e.g., using agents that can crosslink two lysine residues, for example, through reactions with side chain amino groups).
- R E in various formulae is or comprises an activated carboxylic acid group (e.g., NHS ester group), an imidoester group, etc.
- cysteine stapling is replaced with methionine stapling.
- cysteine residues for cysteine stapling are replaced with methionine residues for methionine stapling.
- cysteine stapling is replaced with tryptophan stapling.
- cysteine residues for cysteine stapling are replaced with tryptophan residues for tryptophan stapling.
- reagents, reactions, etc. are described in the art and can be utilized in accordance with the present disclosure for, e.g., methionine stapling, tryptophan stapling, etc.
- such stapling can be performed using reagents having various formulae described herein, wherein R E is or comprises a group that are suitable for methionine and/or tryptophan stapling.
- stapling may be performed using one residue at a first position, and a different residue at a second position.
- Useful reagents for such stapling may comprise a first reactive group for stapling at a first position (e.g., through a first R E ), and a second reactive group for stapling at a second position (e.g., through a second R E ).
- stapling is between residues (e.g., cysteine residues for cysteine stapling) separated by two residues (i+3 stapling).
- stapling is between residues separated by three residues (i+4 stapling).
- stapling is between residues separated by six residues (i+7 stapling).
- more than two residues can be stapled at the same time.
- three or more cysteines are stapled using crosslinking reagents containing three or more reactive groups (e.g., R E groups).
- R E groups reactive groups
- peptides amenable to cysteine stapling and/or comprising one or more non-cysteine staples can have its cysteine residues and cysteine staple replaced with other amino acids and staples described herein (e.g. hydrocarbon and other non-hydrocarbon amino acid and staples).
- the resulting non-cysteine stapled peptide maintains the same or similar interaction with a target of interest when compared to a reference cysteine stapled peptide.
- a provided agent has a structure selected from Table E3 or a salt thereof.
- a provided composition is a composition described in Table E3. As shown, e.g., in Tables E1 and E2 and the Figures, provided technologies can deliver improved useful properties and/or activities.
- a provided agent is a stapled peptide having the structure of
- a provided agent is a stapled peptide having the structure of
- a double bond of a (i, i+3) staple is E. In some embodiments, a double bond of a (i, i+3) staple is Z. In some embodiments, a double bond of a (i, i+4) staple is E. In some embodiments, a double bond of a (i, i+4) staple is Z. In some embodiments, a double bond of a (i, i+7) staple is E. In some embodiments, a double bond of a (i, i+7) staple is Z. In some embodiments, both double bonds are E. In some embodiments, both double bonds are Z. In some embodiments, a (i, i+3) staple is E, and the other is Z. In some embodiments, a (i, i+3) staple is Z, and the other is E.
- Agents e.g., peptides including stapled peptides, can contain various numbers of amino acid residues.
- a length of a peptide agent is about 5-20, 5-19, 5-18, 5-17, 5-16, 5-15, 10-20, 10-19, 10-18, 10-17, 10-16, 10-15, 11-20, 11-19, 11-18, 11-17, 11-16, 11-15, 12-20, 12-19, 12-18, 12-17, 12-16, 12-15, 13-20, 13-19, 13-18, 13-17, 13-16, 13-15, 14-20, 14-19, 14-18, 14-17, 14-16, 14-15, or about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid residues.
- a length is about 10 amino acid residues. In some embodiments, a length is about 11 amino acid residues. In some embodiments, a length is about 12 amino acid residues. In some embodiments, a length is about 13 amino acid residues. In some embodiments, a length is about 14 amino acid residues. In some embodiments, a length is about 15 amino acid residues. In some embodiments, a length is about 16 amino acid residues. In some embodiments, a length is about 17 amino acid residues. In some embodiments, a length is about 18 amino acid residues. In some embodiments, a length is about 19 amino acid residues. In some embodiments, a length is about 20 amino acid residues.
- the present disclosure provides technologies for modulating one or more beta-catenin functions.
- the present disclosure provides useful technologies for inhibiting one or more beta-catenin functions that are associated with cancer or hyperplasia.
- provided technologies are useful for preventing and treating conditions, disorders or diseases whose prevention and/or treatment will benefits from inhibition of beta-catenin.
- a condition, disorder or disease is cancer.
- Beta-catenin is reported to have various functions. For example, it can regulate and coordinate transcription of various genes. It is reported that high beta-catenin activity and/or expression levels may contribute to the development various conditions, disorders or diseases including cancer. Mutations and overexpression of beta-catenin are reported to be associated with conditions, disorders or diseases including many cancers including colorectal cancer, lung cancer, and breast cancer. Dysregulation of the Wnt/ -catenin signaling pathway has reportedly been linked to a number of conditions, disorders or diseases, including neurodegenerative diseases, psychiatric diseases, cancers, asthma, and even wound healing. Agents that can modulate beta-catenin functions are useful for various purposes including preventing and/or treating various conditions, disorders or diseases associated with beta-catenin.
- Beta-catenin may interact with various agents at various binding sites each independently comprising a set of amino acid residues that interact with binding agents.
- certain binding sites are utilized for beta-catenin interactions with Axin, APC, C-cadherin, E-cadherin, TCF3, and Bcl9.
- TCF3 it has been reported that two or more binding sites may be utilized simultaneously to interact with different portions of TCF3. See, e.g., Graham et al. Cell, Vol. 103, 885— 896, 2000.
- provided agents bind to beta-catenin at a unique binding site.
- provided agents interact with beta-catenin at a set of amino acid residues that are different from previously reported binding sites, e.g., those for Axin, APC, C-cadherin, E-cadherin, TCF3 or Bcl9.
- provided agents interact with one or more or all (e.g., about 1-23, 1-20, 1-15, 1-10, 1-5, 5-23, 5-20, 5-15, 5-10, 6-23, 6-20, 6-15, 6-10, 7-23, 7-20, 7-15, 7-10, 8- 23, 8-20, 8-15, 8-10, 9-23, 9-20, 9-15, 9-10, 10-23, 10-20, 10-15, 11-23, 11-20, 11-15, 12-23, 12-20, 12- 15, 13-23, 13-20, 13-15, 13-23, 14-20, 15-23, 15-20, 16-23, 16-20, 17-23, 17-20, 18-23, or 18-20, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, etc.) of a set of amino acid residues that are or correspond to amino acid residues in SEQ ID NO: 1, e.g., in some embodiments, the following amino acid residues of SEQ ID NO: 1:
- a set of amino acid residues are or correspond to amino acid residues A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues A305, Y306, G307, N308, Q309, K312, K345, V346, V349, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, W383, N387, D413, and N415 of SEQ ID NO: 1. In some embodiments, a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, W383, and N387 of SEQ ID NO: 1. In some embodiments, a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, R386 and N387 of SEQ ID NO: 1. In some embodiments, provided agents interact with Y306 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with G307 or an amino acid residue corresponding thereto.
- provided agents interact with K312 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with K345 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with R386 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with W383 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with N387 or an amino acid residue corresponding thereto.
- a present agent interacts with a polypeptide whose sequence comprises or is SEQ ID NO: 2:
- amino acid residues that interact with a provided agent is with SEQ ID NO: 2.
- amino acid residues that interact with a provided agent e.g., one or more amino acid residues in an agent
- two amino acid residues interacting with each other they are typically within a certain range of distances when, e.g., assessed using crystallography, NMR, etc.
- certain amino acid residues reported to interact with one or more polypeptides are not significantly involved in interactions between provided and beta-catenin.
- provided agents do not interact with an Axin binding site.
- provided agents do not interact with a Bcl9 binding site.
- provided agents do not interact with one or more or all of amino acid residues that are or correspond to N426, C429, K435, R469, H470, S473, R474, K508 and N516 of SEQ ID NO: 1.
- provided agents do not interact with N426 or an amino acid residue corresponding thereto.
- provided agents do not interact with C429 or an amino acid residue corresponding thereto.
- provided agents do not interact with K435 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with R469 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with H470 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with S473 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with R474 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with K508 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with N516 or an amino acid residue corresponding thereto.
- mutation of one or more amino acid residues outside of SEQ ID NO: 2 in beta-catenin does not significant/y (e.g., not exceeding 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90% or more) reduce interactions of beta-catenin with a provided agent.
- mutation of one or more or all of amino acid residues that are or correspond to N426, C429, K435, R469, H470, S473, R474, K508 and N516 of SEQ ID NO: 1 does not significantly reduce interactions of beta-catenin with a provided agent.
- mutation of N426 or an amino acid residue corresponding thereto does not significantly reduce interaction of beta-catenin with an agent.
- mutation of Q379 or an amino acid residue corresponding thereto (e.g., to Ala, Glu, Phe, Trp, etc.) does not significantly reduce interaction of beta-catenin with an agent.
- an agent binds to a TCF site of beta-catenin.
- an agent interacts with one or more but not all amino acid residues that interact with TCF.
- an agent interacts with one or more but not all amino acid residues that interact with an extended region of XTcf3-CBD.
- an agent does not interact with beta-catenin amino acid residues that interact with a beta-hairpin module of XTcf3-CBD.
- an agent does not interact with beta-catenin amino acid residues that interact with a helix module of XTcf3- CBD.
- For certain amino acid residues that interact various modules of XTcF3-CBD see, e.g., Graham et al. Cell, Vol. 103, 885-896, 2000.
- an agent competes with TCF for beta-catenin binding.
- an agent competes with an extended region of TCF (e.g., Alal4-Glu24, or Aspl6-Glu24, as described in Graham et al. Cell, Vol. 103, 885-896, 2000) for beta-catenin binding.
- an agent does not compete, or competes at a less degree, with Axin for beta-catenin binding.
- an agent does not compete, or competes at a less degree, with Bcl9 for beta-catenin binding.
- an agent compared to an extended region of TCF, an agent does not compete, or competes at a less degree, with a beta-hairpin module of XTcf3-CBD for beta-catenin binding. In some embodiments, compared to an extended region of TCF, an agent does not compete, or competes at a less degree, with a helix module of XTcf3-CBD for beta-catenin binding. In some embodiments, an agent competes with E- cadherin for beta-catenin binding.
- the present disclosure provides complexes of peptides (e.g., polypeptides whose sequences are or comprises SEQ ID NO: 1 or 2) and provided agents.
- polypeptides and provided agents interact with one or more or all amino acid residues as described herein, and optionally do not interact with one or more or all amino acid residues as described herein.
- the present disclosure provides complexes comprising a provided agent and a beta-catenin polypeptide or a portion thereof.
- a portion thereof comprises one or more or all of the interacting residues as described herein.
- an agent and a beta-catenin polypeptide or a portion thereof interact with other at one or more or all of the interacting residues.
- the present disclosure provides an agent having the structure of formula I: R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein: R N is a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; each of L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 is independently L, wherein L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 comprise: a first R’ group and a second R’ group which are taken together to form ⁇ L s ⁇ which is bonded to the atom to which a first R
- the present disclosure provides an agent having the structure of formula I: R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein: R N is a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; each of L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 is independently L, wherein L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 comprise: a first R’ group and a second R’ group which are taken together to form ⁇ L s ⁇ which is bonded to the atom to which a first R’ group is
- a second R’ group and a third R’ group are attached to the same atom. In some embodiments, none of the first, second and fourth R’ groups are attached to the same atom. In some embodiments, each of the first, second, third and fourth R’ groups is independently attached to a different atom.
- a compound of formula I is a stapled peptide as described herein.
- each L s is independently a staple as described herein.
- L s e.g., L s formed by taking the first and the second R’ groups, has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- a length between two connection sites, e.g., of L s , L, etc. is the shortest covalent connection from one site to the other.
- the length of ⁇ CH 2 ⁇ CH 2 ⁇ is 2 atoms ( ⁇ C ⁇ C ⁇ )
- the length of 1, 3-phenylene is 3 atoms.
- L s e.g., L s formed by taking the third and the fourth R’ groups, has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- staples e.g., L s
- connecting two atoms having a longer distance typically has a longer length than staples connecting two atom having a shorter distance, e.g., (i, i+7) staples typically have longer lengths than (i, i+3) or (i, i+4) staples.
- a length is 5 atoms.
- a length is 6 atoms.
- a length is 7 atoms. In some embodiments, a length is 8 atoms. In some embodiments, a length is 9 atoms. In some embodiments, a length is 10 atoms. In some embodiments, a length is 11 atoms. In some embodiments, a length is 12 atoms. In some embodiments, a length is 13 atoms. In some embodiments, a length is 14 atoms. In some embodiments, a length is 15 atoms. In some embodiments, a length is 16 atoms. In some embodiments, a length is 17 atoms. In some embodiments, a length is 18 atoms. In some embodiments, a length is 19 atoms.
- L P1 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P1 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P1 is or comprises an amino acid residue. In some embodiments, L P1 is or comprises a peptide.
- L P1 is or comprises ⁇ [X] p ⁇ X 1 ⁇ , wherein each of p, X and X 1 is independently as described herein, and X 1 is bonded to L AA1 . In some embodiments, L P1 is or comprises ⁇ X 1 ⁇ . [0238] In some embodiments, L P1 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a first R’ group of the four. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of X 1 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- L AA1 is amino acid residue.
- L AA1 is an amino acid residue that comprises a side chain comprising an acidic or polar group.
- L AA1 is an amino acid residue that comprises a side chain comprising an acidic group.
- L AA1 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA1 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA1 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA1 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA1 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0241] In some embodiments, L AS1 is L AS as described herein. In some embodiments, R AA1 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA1 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA1 is X 2 as described herein.
- L P2 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P2 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P2 is or comprises an amino acid residue. In some embodiments, L P2 is or comprises a peptide.
- L P2 is or comprises ⁇ [X]pX 4 [X]p’ ⁇ , wherein each of p, p’, X and X 4 is independently as described herein.
- L P2 is or comprises ⁇ [X]pX 3 X 4 [X]p’ ⁇ , wherein each X and X 11 is independently an amino acid residue, and each of p and p’ is independently 0-10.
- L P2 is or comprises ⁇ X 3 X 4 ⁇ , wherein each X 3 and X 4 is independently as described herein, and X 4 is bonded to L AA2 .
- L P2 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a second R’ group and the other is a third of the four.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 4 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 4 .
- L AA2 is amino acid residue.
- L AA2 is an amino acid residue that comprises a side chain comprising an acidic or polar group. In some embodiments, L AA2 is an amino acid residue that comprises a side chain comprising an acidic group. [0246] In some embodiments, L AA2 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA2 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA2 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA2 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA2 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0247] In some embodiments, L AS2 is L AS as described herein. In some embodiments, R AA2 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA2 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA2 is X 5 as described herein.
- L P3 is a covalent bond.
- L P3 is an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P3 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P3 is or comprises an amino acid residue. In some embodiments, L P3 is or comprises a peptide.
- L AA3 is amino acid residue. In some embodiments, L AA3 is an amino acid residue that comprises a side chain comprising an acidic or polar group. In some embodiments, L AA3 is an amino acid residue that comprises a side chain comprising an acidic group. [0250] In some embodiments, L AA3 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA3 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA3 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA3 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA3 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0251] In some embodiments, L AS3 is L AS as described herein. In some embodiments, R AA3 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA3 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA3 is X 6 as described herein.
- L P4 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P4 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P4 is or comprises an amino acid residue. In some embodiments, L P4 is or comprises a peptide.
- L P4 is or comprises ⁇ [X]pX 7 X 8 [X]p’ ⁇ , wherein each X and X 11 is independently an amino acid residue, and each of p and p’ is independently 0-10.
- L P4 is or comprises ⁇ X 7 X 8 ⁇ , wherein each X 7 and X 8 is independently as described herein, and X 8 is bonded to L AA4 .
- L AA4 [0254]
- L AA4 is amino acid residue.
- L AA4 is an amino acid residue that comprises a side chain comprising an aromatic group.
- L AA4 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA4 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(N(R’)C(N(R’
- L AA4 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA4 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA4 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0256] In some embodiments, L AS4 is L AS as described herein. In some embodiments, R AA4 is optionally substituted C 6-14 aryl. In some embodiments, R AA4 is optionally substituted phenyl. In some embodiments, R AA4 is phenyl. In some embodiments, R AA4 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA4 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 10- membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur. In some embodiments, lly substituted . In some embodiments, R AA4 is stituted . In some embodiments, R AA4 is optionally substituted . In some embodiments, R AA4 is an aromatic amino acid residue as described herein. In some embodiments, R AA4 is X 9 as described herein.
- L P5 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P5 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P5 is or comprises an amino acid residue. In some embodiments, L P5 is or comprises a peptide.
- L P5 is or comprises ⁇ [X]pX 11 [X]p’ ⁇ , wherein each variable is independently as described herein.
- L P5 is or comprises ⁇ X 10 X 11 ⁇ , wherein each X 10 and X 11 is independently as described herein, and X 11 is bonded to L AA5 .
- L P5 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a fourth R’ group of the four.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 11 .
- such a carbon atom is an alpha carbon of an amino acid residue. In some embodiments, such a carbon atom is an alpha carbon of X 11 .
- L AA5 [0260] In some embodiments, L AA5 is amino acid residue. In some embodiments, L AA5 is an amino acid residue that comprises a side chain comprising an aromatic group. [0261] In some embodiments, L AA5 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA5 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA5 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA5 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA5 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0262] In some embodiments, L AS5 is L AS as described herein. In some embodiments, R AA5 is optionally substituted C 6-14 aryl. In some embodiments, R AA5 is optionally substituted phenyl. In some embodiments, R AA5 is phenyl. In some embodiments, R AA5 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA5 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 10- membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur.
- R AA emb 5 is optionally substituted .
- R AA5 is o tionall substituted .
- R AA5 is optionally substituted .
- R AA5 is an aromatic amino acid residue as described herein.
- R AA5 is X 12 as described herein.
- L P6 [0263] In some embodiments, L P6 is a covalent bond.
- L P6 is an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P6 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P6 is or comprises an amino acid residue. In some embodiments, L P6 is or comprises a peptide.
- L AA6 is amino acid residue. In some embodiments, L AA6 is an amino acid residue that comprises a side chain comprising an aromatic group. [0265] In some embodiments, L AA6 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA6 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA6 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA6 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA6 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0266] In some embodiments, L AS6 is L AS as described herein. In some embodiments, R AA6 is optionally substituted C 6-14 aryl. In some embodiments, R AA6 is optionally substituted phenyl. In some embodiments, R AA6 is phenyl. In some embodiments, R AA6 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA6 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 10- membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur. In some embodiments, lly substituted . In some embodiments, R AA6 is AA6 stituted . In some embodiments, R is optionally substituted . In some embodiments, R AA6 is an aromatic amino acid residue as described herein. In some embodiments, R AA6 is X 13 as described herein. L P7 [0267] In some embodiments, L P7 is a covalent bond.
- L P7 is an optionally substituted, bivalent C 1 -C 25 (e.g., C 1-20 , C 1-15 , C 1-10 , C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 , or C 20 ) aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C
- L P7 is an optionally substituted, bivalent C 1 -C 25 (e.g., C 1-20 , C 1-15 , C 1-10 , C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 , or C 20 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R
- L P7 is an optionally substituted, bivalent C 1 -C 20 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L P7 is an optionally substituted, bivalent C 1 -C 15 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L P7 is an optionally substituted, bivalent C 1 -C 10 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L AS is a covalent bond.
- L AS is an optionally substituted, bivalent C 1 -C 10 (e.g., C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , or C 10 ) aliphatic group, wherein one or more methylene units of the group optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O)
- L AS is an optionally substituted, bivalent C 1 -C 10 aliphatic group, wherein one or more methylene units of the group optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ S(O) ⁇ , or ⁇ S(O) 2 ⁇ .
- L AS is an optionally substituted, bivalent C 1 -C 10 aliphatic group, wherein one or more methylene units of the group optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , or ⁇ N(R’) ⁇ .
- L AS is an optionally substituted, bivalent C 1 -C 10 alkylene group. In some embodiments, L AS is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L AS is ⁇ CH 2 ⁇ . In some embodiments, the length of L AS is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 atoms. In some embodiments, it is 1 atom. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms.
- an agent of formula I is a stapled peptide as described herein. In some embodiments, an agent of formula I is an agent selected from Table E2 or a pharmaceutically acceptable salt thereof. [0270] Among other things, the present disclosure provides agents, e.g. peptides, that can bind to beta-catenin. In some embodiments, a peptide is a stapled peptide. In some embodiments, a peptide is a stitched peptide. In some embodiments, an agent binds to a TCF site of beta-catenin.
- an agent competes with TCF for beta-catenin binding.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein the agent binds to beta-catenin.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein the agent binds to beta-catenin.
- X 2 comprises a side chain comprising an acidic or polar group. In some embodiments, X 2 comprises a side chain comprising an acidic. In some embodiments, X 5 comprises a side chain comprising an acidic or polar group. In some embodiments, X 5 comprises a side chain comprising an acidic. In some embodiments, X 9 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling.
- X 4 and X 11 are independently amino acid residues suitable for stapling.
- X 10 and X 14 are independently amino acid residues suitable for stapling.
- X 7 and X 14 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 4 and X 11 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 10 and X 14 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 7 and X 14 are independently amino acid residues suitable for stapling.
- X 3 and X 10 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are stapled.
- X 4 and X 11 are stapled.
- X 10 and X 14 are stapled.
- X 7 and X 14 are stapled.
- X 3 and X 10 are stapled.
- X 1 and X 4 are stapled, and X 4 and X 11 are stapled.
- X 1 and X 4 are stapled, and X 10 and X 14 are stapled. In some embodiments, X 1 and X 4 are stapled, and X 7 and X 14 are stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14
- X 2 comprises a side chain comprising an acidic or polar group. In some embodiments, X 2 comprises a side chain comprising an acidic. In some embodiments, X 5 comprises a side chain comprising an acidic or polar group. In some embodiments, X 5 comprises a side chain comprising an acidic. In some embodiments, X 9 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling.
- X 4 and X 11 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling, and X 4 and X 11 are independently amino acid residues suitable for stapling. In some embodiments, X 3 and X 10 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are stapled. In some embodiments, X 4 and X 11 are stapled. In some embodiments, X 1 and X 4 are stapled, and X 4 and X 11 are stapled. In some embodiments, X 3 and X 10 are stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or polar group; X 5 comprises a side chain comprising an acidic
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p14, p15, p16 and p17 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic group; X 5 comprises a side chain comprising an acidic group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- X 2 comprises a side chain comprising an acidic or polar group. In some embodiments, X 2 comprises a side chain comprising an acidic. In some embodiments, X 5 comprises a side chain comprising an acidic or polar group. In some embodiments, X 5 comprises a side chain comprising an acidic. In some embodiments, X 9 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling.
- X 4 and X 11 are independently amino acid residues suitable for stapling.
- X 10 and X 14 are independently amino acid residues suitable for stapling.
- X 7 and X 14 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 4 and X 11 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 10 and X 14 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are independently amino acid residues suitable for stapling, and X 7 and X 14 are independently amino acid residues suitable for stapling.
- X 3 and X 10 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are stapled.
- X 4 and X 11 are stapled.
- X 10 and X 14 are stapled.
- X 7 and X 14 are stapled.
- X 3 and X 10 are stapled.
- X 1 and X 4 are stapled, and X 4 and X 11 are stapled.
- X 1 and X 4 are stapled, and X 10 and X 14 are stapled. In some embodiments, X 1 and X 4 are stapled, and X 7 and X 14 are stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or
- X 2 comprises a side chain comprising an acidic or polar group. In some embodiments, X 2 comprises a side chain comprising an acidic. In some embodiments, X 5 comprises a side chain comprising an acidic or polar group. In some embodiments, X 5 comprises a side chain comprising an acidic. In some embodiments, X 9 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling.
- X 4 and X 11 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are independently amino acid residues suitable for stapling, and X 4 and X 11 are independently amino acid residues suitable for stapling. In some embodiments, X 3 and X 10 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 4 are stapled. In some embodiments, X 4 and X 11 are stapled. In some embodiments, X 1 and X 4 are stapled, and X 4 and X 11 are stapled. In some embodiments, X 3 and X 10 are stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- the present disclosure provides an agent, which is or comprises a peptide comprising: X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p23 , wherein: each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1; each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X
- X 1 Various types of amino acid residues can be used for X 1 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 1 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 1 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 1 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0312] As shown herein (e.g., for various amino acids and residues thereof), in various embodiments, L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1- 10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a methylene unit is replaced with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replaced with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replaced with ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is 1,2-phenylene. In some embodiments, a methylene unit is replaced with ⁇ O ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ .
- L is ⁇ C(O) ⁇ 1,2-phenylene ⁇ O ⁇ CH 2 ⁇ .
- L is applicable to all groups that can be such a group or moiety (e.g., L a , L s1 , L s2 , L s3 , etc.), no matter where such embodiments are described.
- X 1 a residue of amino acid that comprises an optionally substituted ring.
- the amino group of X 1 is part of an optionally substituted ring.
- X 1 is an amino acid as described herein (e.g., of formula A-I, A-II, A-III, etc.), wherein R a1 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a1 and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- a formed ring is saturated.
- a formed ring is monocyclic.
- a formed ring has no heteroatoms in addition to the intervening atoms.
- L a1 and L a2 are covalent bond.
- a formed ring is unsubstituted.
- a formed ring is substituted.
- a substitute comprises a double bond which is suitable for metathesis with another double bond to form a staple.
- X 1 is Pro.
- X 1 is alphaMePro (methyl replacing ⁇ H at alpha carbon).
- X 1 comprises a hydrophobic side chain.
- side chain of X 1 comprises an optionally substituted aromatic ring.
- X 1 is Phe.
- X 1 is Ala. In some embodiments, none of R a2 and R a3 are hydrogen. In some embodiments, X 1 is Aib. In some embodiments, X 1 is comprises a side chain which comprises an acidic group, e.g., ⁇ COOH. In some embodiments, X 1 is Asp. In some embodiments, X 1 is an amino acid reside suitable for stapling. In some embodiments, X 1 comprises a double bond, e.g., a terminal double bond in its side chain. In some embodiments, X 1 is PL3. [0314] In some embodiments, X 1 is an amino acid reside suitable for stapling.
- X 1 is a residue of PL3 and stapled. [0316]
- X 1 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- X 1 is a residue of Bn3OAllyl, BzAm3Oallyl, HypBzEs3OAllyl, HypEs4, HypEs5, HypPAc3OAllyl, MePro, NMebAla, PAc3OAllyl, ProAm5, ProAm6, ProBzAm3OAllyl, ProPAc3OAllyl, ProSAm3, PyrR, Sar, Aib, Ala, Asp, Gly, Phe, PL3, Pro, R3, or R5.
- X 1 is a residue of Bn3OAllyl, BzAm3Oallyl, HypBzEs3OAllyl, HypEs4, HypEs5, HypPAc3OAllyl, MePro, NMebAla, PAc3OAllyl, ProAm5, ProAm6, ProBzAm3OAllyl, ProPAc3OAllyl, ProSAm3, PyrR, or Sar.
- X 1 is a residue of Aib, Ala, Asp, Gly, Phe, PL3, Pro, R3, or R5.
- X 1 is stapled (a staple bonds to X 1 ).
- X 1 is PL3 and stapled. In some embodiments, X 1 is stapled with X 4 .
- a staple connecting a pair of amino acid residues, e.g., X 1 and X 4 has the structure of L s , ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of one amino acid residue, e.g., X 1 , and L s3 is L a of the other amino acid residue, e.g., X 4 .
- a staple is L s .
- L s1 is L a of one amino acid residue of a pair of stapled amino acid residues
- L s3 is L a of the other amino acid residue of a pair of stapled amino acid residues.
- L s is ⁇ L a ⁇ L s2 ⁇ L a ⁇ , wherein each variable is independently as described herein.
- L a are described herein.
- L s1 is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L s3 is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- a staple e.g., L s
- L s is bonded to two backbone atoms. In some embodiments, it is bonded to two carbon backbone atoms. In some embodiments, it is independently bonded to an alpha carbon atom of an amino acid residue at each end.
- X 2 Various types of amino acid residues can be used for X 2 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 2 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 2 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 2 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0326] In some embodiments, X 2 is a residue of amino acid that comprises an acidic or polar group.
- X 2 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.) (in some embodiments, may be referred to as an “acidic amino acid residue”).
- an amino acid residue whose side chain comprises an acidic group comprises ⁇ COOH in its side chain.
- it is a residue of an amino acid having the structure of formula A-IV or a salt thereof.
- it is a residue of amino acid having the structure of formula PA, PA-a, PA-b, PA-c, etc.
- R PA is ⁇ H and R PS and R PC are ⁇ OH. In some embodiments, it is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ . In some embodiments, it is ⁇ NH ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ . In some embodiments, it is ⁇ NH ⁇ CH( ⁇ L a ⁇ COOH) ⁇ C(O) ⁇ . [0328] As described herein, L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- X 2 is a residue of Asp, Glu, RbGlu, SbGlu, NMeD, and isoDAsp. In some embodiments, X 2 is a residue of Asp, Glu, RbGlu, SbGlu, and isoDAsp. In some embodiments, X 2 is a residue of Asp.
- an acidic group such as ⁇ COOH may exist, in some embodiments, predominantly, as its negatively charged form, e.g., ⁇ COO ⁇ .
- X 2 is a residue of amino acid (e.g., of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof) whose side chain comprises a polar group (in some embodiments, may be referred to as a “polar amino acid residue”; in some embodiments, it does not include amino acid residue whose side chains are electrically charged at, e.g., about pH 7.4).
- amino acid e.g., of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof
- an amino acid residue whose side chain comprises a polar group is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ . In some embodiments, an amino acid residue whose side chain comprises a polar group is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ . In some embodiments, an amino acid residue whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- R a2 is ⁇ L a ⁇ C(O)N(R’) 2 wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ C(O)NH 2 wherein L is independently as described herein.
- L a is L’ as described herein.
- R a3 is H.
- such a polar amino acid residue is Asn. In some embodiments, it is MeAsn.
- an amino acid residue whose side chain comprises a polar group is an amino acid residue whose side chain comprises ⁇ OH.
- R a2 is ⁇ L a ⁇ OH wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ OH wherein L is independently as described herein.
- L a is L’ as described herein.
- such an amino acid residue is a residue of Hse, Ser, aThr, or Thr.
- it is a residue of Hse, Ser, or aThr.
- it is a residue of Hse.
- it is a residue of Ser.
- it is a residue of aThr.
- Other polar amino acid residues are described herein and can be utilized at various amino acid residue positions.
- X 2 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 2 is a residue of Hse.
- X 2 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ CONH 2 .
- X 2 is a residue of Asn.
- X 2 comprises a side chain which is hydrophobic, is aliphatic, is aromatic, etc.
- X 2 is a residue of Asp, Asn, RbGlu, Phe, Glu, Ile, NMeD, Ala, Dab, Gln, His, Hse, isoDAsp, Leu, Ser, tetz, [MeSO2]Dap, [Tf]Dap, 3FF, 3MeF, SbGlu, or Tyr.
- X 2 is selected from Asp, Hse, Asn, Glu, RbGlu, SbGlu, and isoDAsp (as appreciated by those skilled in the art, an amino acid code can refer to an amino acid and/or a residue thereof depending on context).
- X 2 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0336] In some embodiments, X 2 is a residue of [CH2CMe2CO2H]TriAzDap, [CMe2CO2H]TriAzDap, [Et]AspE, [EtSSEt]AspE, [EtSSHex]AspE, [EtSSPh]AspE, [EtSSpy]AspE, [Me]AspE, AcAsp, AspSH, RbOHAsp, [MeSO2]Dap, [Tf]Dap, 2COOHF, 3COOHF, 3FF, 3MeF, 4Thz, 4Tria, Aad, Ala, Asn, Asp, Dab, Gln, Glu, His, Hse, Ile, isoDAsp, Leu, NMeD,
- X 2 is a residue of [CH2CMe2CO2H]TriAzDap, [CMe2CO2H]TriAzDap, [Et]AspE, [EtSSEt]AspE, [EtSSHex]AspE, [EtSSPh]AspE, [EtSSpy]AspE, [Me]AspE, AcAsp, AspSH, or RbOHAsp.
- X 2 is a residue of [MeSO2]Dap, [Tf]Dap, 2COOHF, 3COOHF, 3FF, 3MeF, 4Thz, 4Tria, Aad, Ala, Asn, Asp, Dab, Gln, Glu, His, Hse, Ile, isoDAsp, Leu, NMeD, Phe, PL3, R3, R5, RbGlu, SbGlu, Ser, tetz, TfeGA, Thr, or Tyr.
- X 3 Various types of amino acid residues can be used for X 3 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 3 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 3 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 3 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0340] In some embodiments, L a is L as described herein. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1- 10.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ .
- L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ .
- R’ is Bn.
- R’ is ⁇ C(O)R. In some embodiments, R is phenyl. In some embodiments, R is t-butyl. In some embodiments, R is cyclohexyl.
- X 3 is a hydrophobic amino acid residue.
- a hydrophobic amino acid residue is an amino acid residue whose side chain is an optionally substituted aliphatic group. In some embodiments, it is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl.
- it is a residue of an amino acid whose side chain is C 1-10 aliphatic optionally substituted with one or more non-polar and non-charged groups. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non-polar and non-charged groups. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 aliphatic optionally substituted with one or more hydrophobic substituents. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 aliphatic. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl.
- a hydrophobic amino acid residue e.g., X 3
- a hydrophobic amino acid residue has the structure of ⁇ NH 2 ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or ⁇ NH ⁇ C(R a2 )H ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ R’.
- R’ is R as described herein.
- R is optionally substituted group selected from C 1-10 aliphatic, phenyl, 10-membered aryl, and 5-10 membered heteroaryl having 1-5 heteroatoms.
- each substituent, if any, is independently a non-polar group.
- R is optionally substituted C 1-10 aliphatic.
- R is optionally substituted C 1-10 alkyl.
- R is C 1-10 aliphatic.
- R is C 1-10 alkyl.
- R is methyl.
- R is isopropyl.
- R is 1-methylpropyl.
- R is 2- methylpropyl.
- R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R is 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-10 membered heteroaryl having 1-5 heteroatoms.
- R is optionally substituted 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, R is 9-10 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a hydrophobic amino acid residue is a residue of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, etc. Other hydrophobic amino acid residues are described herein and can be utilized at various amino acid residue positions.
- X 3 comprises a side chain comprising a cycloaliphatic group (e.g., a 4- , 5-, or 6-membered cycloalkyl group).
- X 3 comprises a side chain which is or comprises an optionally substituted aromatic group (in some embodiments, may be referred to as an “aromatic amino acid residue”).
- an aromatic amino acid residue has a side chain which is or comprises an optionally substituted aromatic group.
- an aromatic amino acid residue, e.g., X 3 has the structure of ⁇ NH 2 ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or ⁇ NH ⁇ C(R a2 )H ⁇ C(O) ⁇ wherein each variable is independently as described herein, and R a2 comprises an optionally substituted aromatic group.
- an aromatic amino acid residue has a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen. In some embodiments, it comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, it comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms.
- an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom.
- it is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ .
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein.
- R’ is an optionally substituted group selected from phenyl, 10- membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH.
- R’ is optionally substituted phenyl.
- R’ is phenyl.
- R’ is optionally substituted aryl.
- R’ is aryl.
- R’ is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms.
- R’ is optionally substituted 5-membered heteroaryl having 1 heteroatom.
- R’ is 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R’ is 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R’ is optionally substituted 9-10 membered heteroaryl having 1-5 heteroatoms. In some embodiments, R’ is optionally substituted 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, R’ is 9-10 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R’ is 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. In some embodiments, L a is a covalent bond.
- L a is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a is ⁇ (CH 2 )n ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, L a is ⁇ CH(Ph) ⁇ . In some embodiments, an aromatic amino acid residue is Phe. In some embodiments, an aromatic amino acid residue is Tyr. In some embodiments, an aromatic amino acid residue is Trp. Other aromatic amino acid residues are described herein and can be utilized at various amino acid residue positions. [0348] In some embodiments, X 3 is a residue of an amino acid suitable for stapling as described herein.
- R’ of ⁇ N(R’) ⁇ or ⁇ N(R’)C(O)O ⁇ and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered ring having 0-5 heteroatoms in addition to the intervening atoms. In some embodiments, there are no heteroatoms in addition to the intervening atoms. In some embodiments, there are no heteroatoms in addition to the nitrogen to which R’ is attached. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated. In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4-membered.
- a formed ring is 5-membered. In some embodiments, a formed ring is 6- membered.
- X 3 is a residue of an amino acid comprising a double bond, e.g., a terminal olefin, suitable for stapling. In some embodiments, X 3 is a residue of an amino acid having the structure of A-II, A-III, etc. In some embodiments, X 3 is a residue of RdN. In some embodiments, X 3 is a residue of S8. In some embodiments, X 3 is stapled. In some embodiments, X 3 is stapled with X 10 .
- X 3 is a residue of an amino acid having the structure of formula A-I, A-II, A-III, etc. [0351] In some embodiments, X 3 is a residue of an amino acid whose side chain is hydrophobic. In some embodiments, X 3 is a residue of an amino acid whose side chain is an optionally substituted aliphatic group. In some embodiments, X 3 is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl. In some embodiments, X 3 is a residue of an amino acid whose side chain is C 1-10 alkyl.
- X 3 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non-polar and non-charged groups. In some embodiments, X 3 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more substituents independently selected from halogen, ⁇ SR and ⁇ OR, where each R is independently C 1-4 alkyl. In some embodiments, X 3 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more substituents independently selected from halogen, ⁇ SR and ⁇ OR, where each R is independently C 1-4 alkyl. In some embodiments, R is methyl.
- X 3 is a residue of Npg, Ala, Ile, Leu, Cha, Abu, hLeu, Val, F3CA, aIle, Nva, TOMe, S(Ome), nLeu, or HF2CA.
- X 3 is a residue of an amino acid whose side chain comprises an optionally substituted aromatic group.
- X 3 is a residue of an amino acid whose side chain comprises a hydrocarbon aromatic group.
- X 3 is a residue of NpG. Phe, 1NapA, or 2NapA.
- X 3 is a residue of an amino acid whose side chain comprises a polar group, e.g., Gln, Hse, Ser, Asn, [AzAc]Lys, Thr, Asn, Ser, etc.
- X 3 is a residue of Npg, Ala, Ile, Leu, Cha, Phe, Abu, hLeu, RdN, 1NapA, 2NapA, R8, Val, F3CA, [AzAc]Lys, Gln, aIle, Nva, TOMe, hSe, S(Ome), nLeu, Thr, Asn, Ser, or HF2CA.
- X 3 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0355] In some embodiments, X 3 is a residue of [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me3AdamantC]-Lys, [Me3AdamantC-PEG2]-Lys, Npa, 1NapA, 2NapA, Abu, aIle, Ala, Asn, Asp, B5, Cha, F3CA, Gln, Glu, HF2CA, hLeu, hSe, Ile, iPrLys, Leu, Lys, nLeu, Npg, Nva, Phe, R8, RdN, S(Ome), Ser, TfeGA, Thr, TOMe, Trp, Tyr, or Val.
- X 3 is a residue of [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me3AdamantC]-Lys, [Me3AdamantC-PEG2]-Lys, or Npa.
- X 3 is a residue of 1NapA, 2NapA, Abu, aIle, Ala, Asn, Asp, B5, Cha, F3CA, Gln, Glu, HF2CA, hLeu, hSe, Ile, iPrLys, Leu, Lys, nLeu, Npg, Nva, Phe, R8, RdN, S(Ome), Ser, TfeGA, Thr, TOMe, Trp, Tyr, or Val.
- X 4 Various types of amino acid residues can be used for X 4 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 4 is a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof.
- X 4 is a residue of an amino acid of formula A-II or salt thereof.
- X 4 is a residue of an amino acid of formula A-III or salt thereof.
- X 4 is a residue of an amino acid of formula A-IV or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-V or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-VI or salt thereof. In some embodiments, X 4 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 4 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 4 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 4 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 4 is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- each of ⁇ L a ⁇ connected R SP1 or R SP2 is independent L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 4 is residue of an amino acid suitable for stapling as described herein. In some embodiments, X 4 is a residue of an amino acid which comprises two functional groups suitable for stapling. In some embodiments, X 4 is a residue of an amino acid which comprises one and only one functional group suitable for stapling. In some embodiments, X 4 is a residue of an amino acid which comprises two olefins, e.g., two terminal olefins. In some embodiments, X 4 is a residue of an amino acid which comprises one and only one double bond for stapling, e.g., a terminal olefin.
- each L a is independently optionally substituted bivalent C 1-10 alkylene or heteroalkylene.
- each L a is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 1.
- n is 2.
- n is 3.
- n is 4.
- n is 5.
- n is 6.
- n is 7.
- n is 8.
- n is 9.
- n is 10.
- X 4 is B5.
- X 4 is R8, RdN, R5, RgN, ReN, R7, Az, R6, or R4. [0361] In some embodiments, X 4 is stapled.
- X 4 is connected to two residues independently through two staples (e.g., when X 4 is B5).
- X 4 is staple with X 1
- X 4 is stapled with X 11 .
- various staples may be utilized for connecting stapled amino acid residues.
- a staple is L s as described herein.
- each staple connected to X 4 is independently L s as described herein.
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- one of L s1 and L s3 is L a of one of two stapled amino acid residues, and the other is L a of the other of two stapled amino acid residues.
- L s3 is L a of X 4 , e.g., when X 4 is stapled with an amino acid residue to its N-terminus side (e.g., X 1 ).
- L s1 is L a of X 4 , e.g., when X 4 is stapled with an amino acid residue to its C-terminus side (e.g., X 11 ).
- L s1 is L a of X 1
- L s3 is L a of X 4
- L s1 is L a of X 4
- L s3 is L a of X 11 .
- two staples are bonded to X 4 , wherein a first staple staples X 4 with an amino acid residue to the N-terminus side of X 4 (an amino acid residue to a N-terminus side of a reference amino acid residue may be referred to as “N-direction amino acid residue” of the reference amino acid residue, e.g., X 1 is a N-direction amino acid residue of X 4 ), wherein the first staple is L s having the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of the N-direction amino acid residue, and L s3 is L a of X 4 , and wherein a second staple staples X 4 with an amino acid residue to the C-terminus side of X 4 (an amino acid residue to a C-terminus side of a reference amino acid residue may be referred to as “C- direction amino acid residue” of the reference amino acid residue, e.g.,
- L a is described herein and can be utilized for various amino acid residues including X 4 and N-direction (e.g., X 1 ) and C- direction (e.g., X 11 ) amino acid residues.
- each L a is ⁇ (CH 2 ) 3 ⁇ .
- L s2 is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is ⁇ CH 2 ⁇ CH 2 ⁇ .
- each staple is independently bonded to two alpha carbon atoms of two stapled amino acid residues.
- X 4 is stapled with two amino acid residues, e.g., X 1 and X 11 .
- X 4 is stapled with only one residue, e.g., X 11 (e.g., when X 4 is a residue of R5, R4, or R6).
- X 4 is a residue of R4.
- X 4 is a residue of R5.
- X 4 is a residue of R6.
- a staple is L s as described herein.
- L s1 is L a of a first amino acid residue of two stapled amino acid residues, e.g., X 4
- L s3 is L a of a second amino acid residue of two stapled amino acid residues, e.g., X 11
- a second amino acid residue e.g., X 11
- X 4 is stapled.
- X 4 is connected to two residues independently through two staples (e.g., when X 4 is B5).
- X 4 is stapled with X 1 and X 11 . In some embodiments, X 4 is stapled with only one residue, e.g., X 11 (e.g., when X 4 is R8, RdN, R5, RgN, ReN, R7, Az, R6, or R4). [0369] In some embodiments, X 4 is not stapled (e.g., when other residues are optionally stapled).
- X 4 is a residue of an amino acid whose side chain is hydrophobic, comprises an optionally substituted aromatic group, or comprises an acid group (e.g., ⁇ COOH, which as those skilled in the art appreciate may exist as a salt form at certain conditions, e.g., certain pH).
- X 4 is Ala.
- X 4 is Asp.
- X 4 is selected from B5, R8, RdN, R5, Ala, RgN, ReN, R7, Az, Asp, R6, and R4.
- X 4 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0372] In some embodiments, X 4 is a residue of B3, B4, B6, Aib, Ala, Asp, Az, B5, Npg, R3, R4, R5, R6, R7, R8, RdN, ReN, RgN, S3, S4, S5, or S6. [0373] In some embodiments, X 4 is a residue of B3, B4, or B6.
- X 4 is a residue of Aib, Ala, Asp, Az, B5, Npg, R3, R4, R5, R6, R7, R8, RdN, ReN, RgN, S3, S4, S5, or S6.
- Various types of amino acid residues can be used for X 5 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 5 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 5 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 5 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 5 is a residue of an amino acid of formula A-IV or a salt thereof.
- X 5 is a residue of an amino acid of formula PA, PA-a, PA-b, PA-c, or a salt thereof.
- R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 5 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 5 is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is ⁇ CH(CH 3 ) ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 5 is a residue of amino acid that comprises an acidic or polar group. In some embodiments, X 5 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.). [0378] In some embodiments, X 5 is a residue of Asp, Glu, RbGlu, SbGlu, NMeD, and isoDAsp. In some embodiments, X 5 is a residue of Asp, Glu, RbGlu, SbGlu, and isoDAsp. In some embodiments, X 5 is a residue of Asp.
- X 5 is a residue of Glu.
- an acidic group such as ⁇ COOH may exist, in some embodiments, predominantly, as its negatively charged form, e.g., ⁇ COO ⁇ .
- X 5 is a residue of amino acid whose side chain comprises a polar group as described herein.
- X 5 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 5 is a residue of Hse.
- X 5 is a residue of Ser.
- X 5 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ CONH 2 .
- X 5 is a residue of Asn.
- X 5 is a residue of Gln.
- X 5 comprises a side chain which is hydrophobic, is aliphatic, is aromatic, etc.
- X 5 is a residue of Asp, Hse, Asn, Glu, tetz, 3Thi, hPhe, 2pyrA, Ala, [MeSO2]Dap, [Tf]Dap, Ser, Gln, Leu, Dab, [MeSO2]Dab, nLeu, His, 3pyrA, 4pyrA, [NHiPr]AsnR, [NHEt]AsnR, [NHnPr]AsnR, [NHCyPr]AsnR, [NHCyBu]AsnR, [NHMe]AsnR, Phe, isoAsp, isoDAsp, RbGlu, and SbGlu.
- X 5 is selected from Asp, Asn, Gln, Glu, Hse, and Ser. [0383] In some embodiments, X 5 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 5 is a residue of [Et]AspE, [EtSSEt]AspE, [EtSSHex]AspE, [EtSSPh]AspE, [EtSSpy]AspE, [Me]AspE, AspSH, bMe2Asp, [MeSO2]Dab, [MeSO2]Dap, [NHCyBu]AsnR, [NHCyPr]AsnR, [NHEt]AsnR, [NHiPr]AsnR, [NHMe]AsnR, [NHnPr]AsnR, [Tf]Dap, 2pyrA, 3pyrA, 3Thi, 4pyrA, Ala, Arg, Asn, Asp, B5, BztA, Dab, Gln, Glu, His, hPhe, Hse, isoAsp, isoDAs
- X 5 is a residue of [Et]AspE, [EtSSEt]AspE, [EtSSHex]AspE, [EtSSPh]AspE, [EtSSpy]AspE, [Me]AspE, AspSH, or bMe2Asp.
- X 5 is a residue of [MeSO2]Dab, [MeSO2]Dap, [NHCyBu]AsnR, [NHCyPr]AsnR, [NHEt]AsnR, [NHiPr]AsnR, [NHMe]AsnR, [NHnPr]AsnR, [Tf]Dap, 2pyrA, 3pyrA, 3Thi, 4pyrA, Ala, Arg, Asn, Asp, B5, BztA, Dab, Gln, Glu, His, hPhe, Hse, isoAsp, isoDAsp, Leu, nLeu, Npg, RbGlu, SbGlu, Ser, tetz, or Thr.
- X 6 Various types of amino acid residues can be used for X 6 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 6 is a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof.
- X 6 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 6 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 6 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 6 is a residue of an amino acid of formula A-IV or a salt thereof. In some embodiments, X 6 is a residue of an amino acid of formula PA, PA-a, PA-b, PA-c, or a salt thereof. In some embodiments, R PA is ⁇ H and R PS and R PC are ⁇ OH.
- R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H.
- X 6 is a residue of amino acid that comprises an acidic or polar group as described herein. In some embodiments, X 6 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.) as described herein. [0389] In some embodiments, X 6 is a residue of an amino acid having the structure of formula A-IV or a salt thereof.
- X 6 is a residue of amino acid having the structure of formula PA, PA-a, PA-b, PA-c, etc.
- R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 6 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C ( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ .
- X 6 is ⁇ NH ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ .
- X 6 is ⁇ NH ⁇ CH( ⁇ L a ⁇ COOH) ⁇ C(O) ⁇ .
- L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ .
- L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ Cy ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ Cy ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ Cy ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ Cy ⁇ CH 2 ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is phenylene. In some embodiments, ⁇ Cy ⁇ is substituted phenylene. In some embodiments, ⁇ Cy ⁇ is mono-substituted phenylene.
- a substituent is ⁇ F. In some embodiments, a substituent is optionally substituted C 1-6 alkyl. In some embodiments, a substituent is ⁇ CF 3 . In some embodiments, a substituent is ⁇ OH. In some embodiments, phenylene is 1,2-phenylene. In some embodiments, phenylene is 1,3- phenylene. In some embodiments, phenylene is 1,4-phenylene. In some embodiments, a substituent is ortho to the carbon atom closed to ⁇ COOH. In some embodiments, it is meta. In some embodiments, it is para. In some embodiments, ⁇ Cy ⁇ is 1,3-phenylene (e.g., in 3COOHF).
- ⁇ Cy ⁇ is an optionally substituted bivalent 5-10 membered heteroaryl group having 1-5 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent 5-membered heteroaryl group having 1-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent 6-membered heteroaryl group having 1-4 heteroatoms.
- L is bonded to a backbone atom, e.g., an alpha carbon atom, at ⁇ CH 2 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ N(R’) ⁇ wherein R’ is as described herein.
- L is ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ wherein R’ is as described herein.
- R’ is R as described herein.
- R is optionally substituted C 1-6 alkyl.
- R is ⁇ CH 2 CF 3 .
- X 6 is a residue of an amino acid of formula PA, PA-a, PA-b, PA-c, or a salt thereof, wherein R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 6 is a residue of TfeGA, 2COOHF, 3COOHF, Asp, Glu, RbGlu, SbGlu, NMeD, and isoDAsp. In some embodiments, X 6 is a residue of TfeGA, 2COOHF, 3COOHF, Asp, Glu, RbGlu, SbGlu, and isoDAsp. In some embodiments, X 6 is a residue of TfeGA. In some embodiments, X 6 is a residue of 2COOHF. In some embodiments, X 6 is a residue of 3COOHF. In some embodiments, X 6 is a residue of Asp.
- X 6 is a residue of Glu. In some embodiments, X 6 is a residue of EtGA. In some embodiments, X 6 is a residue of 4COOHF. In some embodiments, X 6 is a residue of Aad. In some embodiments, X 6 is a residue of DGlu. In some embodiments, X 6 is a residue of [iPr]GA. In some embodiments, X 6 is a residue of [Pfbn]GA. In some embodiments, X 6 is a residue of [Tfb]GA. In some embodiments, X 6 is a residue of [Bn]GA. In some embodiments, X 6 is a residue of 1AcAw.
- X 6 is a residue of amino acid whose side chain comprises a polar group as described herein. In some embodiments, X 6 is a residue of amino acid whose side chain comprises ⁇ OH. For example, in some embodiments, X 6 is a residue of Hse. In some embodiments, X 6 is a residue of Ser. In some embodiments, X 6 is a residue of Thr. In some embodiments, X 6 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ CONH 2 . For example, in some embodiments, X 6 is a residue of Asn. In some embodiments, X 6 is a residue of Gln.
- X 6 is a residue of Cit.
- X 6 is a hydrophobic amino acid residue as described herein.
- X 6 comprises a side chain which is hydrophobic, is aliphatic, comprises an optionally substituted aromatic group, comprises a basic group, etc.
- amino acid residues of certain properties, structures, etc. described for one position may also be utilized at other positions where amino acid residues of the same properties, structures, etc. can be utilized. For example, when hydrophobic amino acid residues can be utilized at both positions X 3 and X 6 , hydrophobic amino acid residues described for X 3 can be utilized for X 6 and vice versa.
- X 6 comprises a side chain comprising an optionally substituted aromatic group as described herein.
- X 6 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 6 is a residue of Asp, Glu, TfeGA, Thr, EtGA, Asn, 3COOHF, HIs, Gln, 2NapA, 4COOHF, nLeu, Leu, Cit, Aad, Cha, hLeu, hPhe, Ala, 3PyrA, Bip, Tyr, aMeDF, Phe, 1NapA, DaMeL, 3F3MeF, 4F3MeF, tetz, Arg, 2COOHF, DGlu, BztA, Trp, 6F1NapA, 3FF, 4FF, 34FF, 2PyrA, 4PyrA, hTyr, Qui, DipA, 4AmPhe, 2Thi, 1meH, [iPr]GA, [Pfbn]GA, [Tfb]GA, [Bn]GA, Lys, [Tfp]Dap, 1AcAW
- X 6 is a residue of [2COOH4NH2Ph]Dap, [2COOH4NO2Ph]Cys, [2COOH4NO2Ph]Dap, [2COOHPh]TriAzDab, [2COOHPh]TriAzDap, [2Nic]Dap, [3COOH4NO2Ph]Dap, [4AcMePip]GA, [4AcMePip]GAbu, [4CF3PhAc]GA, [4CF3PhAc]GAbu, [Ac]GA, [Ac]GAbu, [Bn]GAbu, [CCpCO2H]TriAzDap, [CF3CO]GA, [CH2CChCO2H]TriAzDap, [CH2CCpCO2H]TriAzDap, [CH2CH2CO2H]TriAzDab, [CH2CH2CO2H
- X 6 is a residue of [2COOH4NH2Ph]Dap, [2COOH4NO2Ph]Cys, [2COOH4NO2Ph]Dap, [2COOHPh]TriAzDab, [2COOHPh]TriAzDap, [2Nic]Dap, [3COOH4NO2Ph]Dap, [4AcMePip]GA, [4AcMePip]GAbu, [4CF3PhAc]GA, [4CF3PhAc]GAbu, [Ac]GA, [Ac]GAbu, [Bn]GAbu, [CCpCO2H]TriAzDap, [CF3CO]GA, [CH2CChCO2H]TriAzDap, [CH2CCpCO2H]TriAzDap, [CH2CH2CO2H]TriAzDab, [CH2CH2CO2H
- X 6 is a residue of [Bn]GA, [iPr]GA, [Me2NPr]GA, [Me2NPr]GAbu, [MeSO2]Dap, [Pfbn]GA, [Tfb]GA, [Tfp]Dap, 1AcAW, 1meH, 1NapA, 2COOHF, 2NapA, 2PyrA, 2Thi, 34FF, 3cbmf, 3COOHF, 3F3MeF, 3FF, 3PyrA, 3thi, 4AmPhe, 4COOHF, 4F3MeF, 4FF, 4PyrA, 6F1NapA, Aad, Ala, aMeDF, Arg, Asn, Asp, B5, Bip, BztA, Cha, Cit, DaMeL, DGlu, DipA, EtGA, GA, Gln, Glu, His, hLeu, hP
- X 7 Various types of amino acid residues can be used for X 7 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 7 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 7 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 7 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0403] In some embodiments, R a2 is R, wherein R is C 1-10 aliphatic. In some embodiments, R a3 is R, wherein R is C 1-10 aliphatic.
- each of R a2 and R a3 is independently R as described herein. In some embodiments, R a2 and R a3 are the same. In some embodiments, R is C 1-10 alkyl. In some embodiments, R is methyl.
- X 7 is a residue of an amino acid whose side chain is hydrophobic. In some embodiments, X 7 is a hydrophobic amino acid residue described herein, e.g., those described for X 3 . In some embodiments, X 7 is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl. In some embodiments, X 7 is a residue of an amino acid whose side chain is C 1-10 alkyl.
- X 7 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non-polar and non-charged groups.
- X 7 comprises a side chain comprising a cycloaliphatic group (e.g., a 3-, 4-, 5-, or 6-membered cycloalkyl group).
- a cycloaliphatic group e.g., a 3-, 4-, 5-, or 6-membered cycloalkyl group.
- Various types of amino acid residues can be utilized for X 7 .
- X 7 comprises a polar side chain.
- X 7 comprises a non-polar side chain.
- X 7 comprises a hydrophobic side chain.
- X 7 comprises an aliphatic side chain.
- X 7 comprises an alkyl side chain. In some embodiments, X 7 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 7 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, X 7 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, X 7 comprises a detectable moiety such as a fluorescent moiety. [0406] In some embodiments, X 7 is a residue of amino acid whose side chain comprises a polar group. Various polar amino acid residues described herein may be utilized for X 7 .
- X 7 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 7 is a residue of Ser.
- X 7 is a residue of amino acid whose side chain comprises a basic group.
- X 7 is a residue of amino acid whose side chain comprises an amino group, e.g., Lys.
- X 7 comprises a side chain comprising an optionally substituted aromatic group, e.g., Phe.
- X 7 is selected from Ala, Leu, iPrLys, Phe, Ser, Aib, Gln, nLeu, Trp, Ile, and Lys, and a substituted or labeled lysine.
- X 7 is selected from Ala, Leu, iPrLys, [AzAc]Lys, Phe, Ser, [FAM6Ppg][p1TB]Lys, Aib, Gln, nLeu, Trp, [FAM6Ppg][1TriAc]Lys, Ile, and Lys.
- a lysine is labeled with a detectable moiety (either directly or indirectly detectable).
- X 7 is selected from Ala, Leu, iPrLys, Phe, Ser, Aib, Gln, nLeu, Trp, Ile, and Lys.
- X 7 is Ala.
- X 7 is or comprises a residue of an amino acid or a moiety of Table A- IV.
- X 7 is a residue of [2OxoPpz]GlnR, [3Py]4SF, [4Pippip]GlnR, [Ac]Lys, [AcPpz]GlnR, [bismethoxyethylamine]GlnR, [CF3CO]Lys, [CH2NMe2]4SEF, [EtSO2Ppz]GlnR, [isoindoline]GlnR, [Me2diaminobutane]GlnR, [Me2Npr]Lys, [Me2NPrPip]GlnR, [MeSO2]Lys, [Morph]GlnR, [NHEt]GlnR, [NMe2]GlnR, [Phc]Lys, [TfePpz]GlnR, Cpg, CyLeu, F2Pi
- X 7 is a residue of [2OxoPpz]GlnR, [3Py]4SF, [4Pippip]GlnR, [Ac]Lys, [AcPpz]GlnR, [bismethoxyethylamine]GlnR, [CF3CO]Lys, [CH2NMe2]4SEF, [EtSO2Ppz]GlnR, [isoindoline]GlnR, [Me2diaminobutane]GlnR, [Me2Npr]Lys, [Me2NPrPip]GlnR, [MeSO2]Lys, [Morph]GlnR, [NHEt]GlnR, [NMe2]GlnR, [Phc]Lys, [TfePpz]GlnR, Cpg, CyLeu, F2Pi
- X 7 is a residue of [MorphAc]Lys, [mPEG4]Lys, 3COOHF, Aib, Ala, Asn, Asp, Gln, Gly, His, Hse, Ile, iPrLys, Leu, Lys, nLeu, Phe, R5, Ser, Thr, or Trp.
- Various types of amino acid residues can be used for X 8 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 8 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 8 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 8 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 8 comprises a polar side chain as described herein. In some embodiments, X 8 comprises a non-polar side chain. In some embodiments, X 8 comprises a hydrophobic side chain. In some embodiments, X 8 is a hydrophobic amino acid residue as described herein, e.g., those described for X 3 . In some embodiments, X 8 comprises an aliphatic side chain. In some embodiments, X 8 comprises an alkyl side chain. In some embodiments, X 8 comprises a side chain comprising an optionally substituted aromatic group.
- X 8 comprises a side chain comprising an acidic group, e.g., ⁇ COOH, as described herein. In some embodiments, X 8 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 as described herein. In some embodiments, X 8 comprises a detectable moiety such as a fluorescent moiety. [0414] In some embodiments, X 8 is selected from Ala, Leu, Phe, Ser, Aib, Asp, Glu, Aad, Trp, nLeu, , Gln, , Ile, Lys, iPrLys, and a substituted or labeled lysine.
- a lysine is labeled with a detectable moiety (either directly or indirectly detectable).
- X 8 is selected from Ala, Leu, Phe, Ser, Aib, Asp, Glu, Aad, Trp, nLeu, [mPEG2]Lys, [AzAc]Lys, Gln, [FAM6Ppg][1TriAc]Lys, [35CF3PhPr]Lys, [1NapPr]Lys, [22PhPr]Lys, [MorphAc]Lys, [MePipAc]Lys, [MeBipipAc]Lys, [4MePipBz]Lys, [MeMorphBz]Lys, [Me2NCBz]Lys, [mPEG4]Lys, [mPEG6]Lys, [mPEG6]Lys
- X 8 is Ala. [0415] In some embodiments, X 8 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0416] In some embodiments, X 8 is a residue of [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me2NCBz]Lys, [Me3AdamantC-PEG2]-Lys, F2PipAbu, F2PipNva, MePpzAbu, MePpzAsn, MePpzNva, MorphAbu, MorphAsn, MorphNva, dAla, [1NapPr]Lys, [22PhPr]Lys, [35CF3PhPr]Lys, [4MePipBz]Lys, [AdamantC]Lys, [AdamantPro]Lys, [Bua]
- X 8 is a residue of [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me2NCBz]Lys, [Me3AdamantC-PEG2]-Lys, F2PipAbu, F2PipNva, MePpzAbu, MePpzAsn, MePpzNva, MorphAbu, MorphAsn, MorphNva, or dAla.
- X 8 is a residue of [1NapPr]Lys, [22PhPr]Lys, [35CF3PhPr]Lys, [4MePipBz]Lys, [AdamantC]Lys, [AdamantPro]Lys, [Bua]Lys, [Me3AdamantC]Lys, [Me3AdamantC]- Lys, [MeBipipAc]Lys, [MeMorphBz]Lys, [MePipAc]Lys, [MorphAc]Lys, [mPEG2]Lys, [mPEG4]Lys, [mPEG6]Lys, [mPEG8]Lys, [Oct]Lys, 3COOHF, Aad, Aib, Ala, Asp, Gln, Glu, Gly, Ile
- X 9 Various types of amino acid residues can be used for X 9 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 9 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 9 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 9 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0420] In some embodiments, X 9 comprises a side chain which is or comprises an optionally substituted aromatic group. In some embodiments, X 9 is an aromatic amino acid residue as described herein.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted phenyl.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, -C(O)OH, or ⁇ CN, wherein each R is independently hydrogen or C 1-4 alkyl or haloalkyl.
- an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen. In some embodiments, X 9 comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom.
- X 9 is a residue of an amino acid of formula A-I or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein.
- R’ is R as described herein.
- R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic.
- each substituent is independently halogen or ⁇ OH.
- R is optionally substituted phenyl.
- R is phenyl.
- R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom.
- R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. As described herein, L a is L. In some embodiments, L is a covalent bond. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 9 is a residue of an amino acid having the structure of formula A-I, wherein R a2 is ⁇ L a ⁇ R’, and R’ is an optionally substituted aromatic group.
- L a is optionally substituted CH 2 .
- L a is ⁇ CH 2 ⁇ .
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ N(R) 2 , ⁇ C(O)N(R) 2 , or ⁇ CN, wherein each R is independently ⁇ H, C 1-4 alkyl or haloalkyl, or ⁇ Ph.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-4 alkyl or haloalkyl.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-2 alkyl or haloalkyl.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more halogen.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more ⁇ F.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ CF 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ CH 3 , ⁇ CF 3 , or ⁇ CN. In some embodiments, X 9 comprises a side chain which is or comprises an aromatic group optionally substituted at 2’-position. In some embodiments, X 9 comprises a side chain which is or comprises an unsubstituted aromatic group. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having one oxygen atom. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 9 is selected from Phe, 3F3MeF, 2Thi, 3Thi, 4F3MeF, 3OMeF, 3MeF, 2MeF, 2NapA, 345FF, 34FF, 3FF, His, 2FurA, 2PyrA, 4AmPhe, 4FF, 1meH, 23FF, 2FF, 35FF, 3CBMF, 3ClF, 3meH, 3PyrA, 4CBMF, 4ClF, 4Thz, BztA, hPhe, hTyr, MeTyr, 1NapA, 2CNF, 3CNF, 4CNF, 4MeF, Bip, DipA, and Phg.
- X 9 is Phe. [0422] In some embodiments, X 9 comprises a polar side chain. In some embodiments, X 9 is a polar amino acid residue as described herein. In some embodiments, X 9 comprises a non-polar side chain. In some embodiments, X 9 comprises a hydrophobic side chain. In some embodiments, X 9 is a hydrophobic amino acid residue as described herein. In some embodiments, X 9 comprises an aliphatic side chain. In some embodiments, X 9 comprises an alkyl side chain. In some embodiments, X 9 comprises a side chain comprising a cycloaliphatic group (e.g., a 5- or 6-membered cycloalkyl group).
- a cycloaliphatic group e.g., a 5- or 6-membered cycloalkyl group.
- X 9 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 9 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, X 9 is an acidic amino acid residue as described herein. In some embodiments, X 9 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, X 9 is a basic amino acid residue as described herein. In some embodiments, X 9 is Gln. In some embodiments, X 9 is Asp. In some embodiments, X 9 is Cha. In some embodiments, X 9 is CypA. In some embodiments, X 9 is Ala.
- X 9 is nLeu. In some embodiments, X 9 is Npg. [0423] In some embodiments, X 9 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0424] In some embodiments, X 9 is a residue of [3Py]4SF, [CH2NMe2]4SEF, [CH2NMe2]TriAzDap, [CH2Ppz]TriAzDap, [MorphCH2]TriAzDap, [SO2MorphCH2]TriAzDap, 2NH2F, 3CH2NMe2F, 3CO2PhF, 3SO2F, 4BrF, Cba, 1meH, 1NapA, 23FF, 2cbmf, 2ClF, 2CNF, 2FF, 2FurA, 2MeF, 2NapA, 2PyrA, 2Thi, 345FF, 34FF,
- X 9 is a residue of [3Py]4SF, [CH2NMe2]4SEF, [CH2NMe2]TriAzDap, [CH2Ppz]TriAzDap, [MorphCH2]TriAzDap, [SO2MorphCH2]TriAzDap, 2NH2F, 3CH2NMe2F, 3CO2PhF, 3SO2F, 4BrF, or Cba.
- X 9 is a residue of 1meH, 1NapA, 23FF, 2cbmf, 2ClF, 2CNF, 2FF, 2FurA, 2MeF, 2NapA, 2PyrA, 2Thi, 345FF, 34FF, 35FF, 3CBMF, 3ClF, 3CNF, 3COOHF, 3F3MeF, 3FF, 3MeF, 3meH, 3OMeF, 3PyrA, 3Thi, 4AmPhe, 4CBMF, 4ClF, 4CNF, 4F3MeF, 4FF, 4MeF, 4Thz, Ala, Asp, Bip, BztA, Cha, CypA, DipA, Gln, His, hPhe, hTyr, MeTyr, nLeu, Npg, Phe, Phg, Ser, or Tyr.
- X 10 Various types of amino acid residues can be used for X 10 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 10 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 10 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 10 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0428] In some embodiments, X 10 is a residue of an amino acid suitable for stapling as described herein.
- X 10 is a residue of an amino acid comprising a double bond, e.g., a terminal olefin, suitable for stapling. In some embodiments, X 10 is a residue of an amino acid having the structure of A-II, A-III, etc. In some embodiments, X 10 is a residue of RdN. In some embodiments, X 10 is a residue of S8. In some embodiments, X 10 is stapled. In some embodiments, X 10 is stapled with X 3 . [0429] In some embodiments, X 10 is a residue of an amino acid having the structure of formula A-I, A-II, A-III, etc.
- X 10 is a residue of an amino acid whose side chain is hydrophobic. In some embodiments, X 10 is a residue of an amino acid whose side chain is an optionally substituted aliphatic group. In some embodiments, X 10 is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl. In some embodiments, X 10 is a residue of an amino acid whose side chain is C 1-10 alkyl. In some embodiments, X 10 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non-polar and non-charged groups.
- X 10 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more substituents independently selected from halogen, ⁇ SR and ⁇ OR, where each R is independently C 1-4 alkyl. In some embodiments, X 10 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more substituents independently selected from halogen, ⁇ SR and ⁇ OR, where each R is independently C 1-4 alkyl. In some embodiments, R is methyl.
- X 10 is a residue of Npg, Ala, Ile, Leu, Cha, Abu, hLeu, Val, F3CA, aIle, Nva, TOMe, S(Ome), nLeu, or HF2CA.
- X 10 is a residue of an amino acid whose side chain comprises an optionally substituted aromatic group.
- X 10 is a residue of an amino acid whose side chain comprises a hydrocarbon aromatic group.
- X 10 is a residue of NpG. Phe, 1NapA, or 2NapA.
- X 10 is a residue of Leu.
- X 10 is a residue of amino acid whose side chain comprises a polar group as described herein. In some embodiments, X 10 is a residue of amino acid whose side chain comprises ⁇ OH. For example, in some embodiments, X 10 is a residue of Hse. In some embodiments, X 10 is a residue of Ser. In some embodiments, X 10 is a residue of Thr. In some embodiments, X 10 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ CONH 2 . For example, in some embodiments, X 10 is a residue of Asn. In some embodiments, X 10 is a residue of Gln.
- X 10 is a residue of Cit.
- X 10 is a residue of amino acid whose side chain comprises an optionally substituted aromatic group.
- X 10 is an aromatic amino acid residue as described herein.
- an aromatic group is optionally substituted phenyl.
- X 10 is Phe.
- X 10 is selected from Asn, Val, Gln, Leu, Thr, Ser, Phe, Ala, Hse, Cit, iPrLys, S7, S5, Cha, PyrS, S(Ome), [AzAc]Lys, nLeu, 2F3MeF, 3F3MeF, and 4F3MeF.
- X 10 is a residue of Asn, Val, Gln, Leu, Thr, Ser, Phe, Ala, Hse, Cit, iPrLys, S7, S5, Cha, PyrS, S(Ome), or [AzAc]Lys.
- X 10 is Leu, Thr or Hse. In some embodiments, X 10 is Leu. In some embodiments, X 10 is Thr. In some embodiments, X 10 is Hse. [0434] In some embodiments, X 10 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- X 10 is a residue of [4MePpzPip]GlnR, [4Pippip]GlnR, [4PyPip]GlnR, [CH2NMe2]TriAzDap, [CH2Ppz]TriAzDap, [H4IAP]GlnR, [Me2NPrPip]GlnR, [Morph]GlnR, [MorphCH2]TriAzDap, [NHBn]GlnR, [Ppz]GlnR, [RDMAPyr]GlnR, [SO2MorphCH2]TriAzDap, [TfePpz]GlnR, 4BrF, AcLys, F2PipNva, Me2Asn, Me2Gln, MePpzAsn, MorphAsn, MorphGln, MorphGln, MorphI
- X 10 is a residue of [4MePpzPip]GlnR, [4Pippip]GlnR, [4PyPip]GlnR, [CH2NMe2]TriAzDap, [CH2Ppz]TriAzDap, [H4IAP]GlnR, [Me2NPrPip]GlnR, [Morph]GlnR, [MorphCH2]TriAzDap, [NHBn]GlnR, [Ppz]GlnR, [RDMAPyr]GlnR, [SO2MorphCH2]TriAzDap, [TfePpz]GlnR, 4BrF, AcLys, F2PipNva, Me2Asn, Me2Gln, MePpzAsn, MorphAsn, MorphGln, MorphGln, MorphI
- X 10 is a residue of 2F3MeF, 3F3MeF, 4F3MeF, Abu, Ala, Arg, Asn, Cha, Cit, dSer, Gln, His, hLeu, Hse, iPrLys, Leu, Lys, nLeu, Npg, Phe, PyrS, PyrS2, R5, S(Ome), S5, S7, Ser, Thr, Trp, or Val.
- X 11 Various types of amino acid residues can be used for X 11 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 11 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 11 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 11 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0439] In some embodiments, X 11 is a residue of an amino acid suitable for stapling as described herein.
- an amino acid residue suitable for stapling is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, it is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- each amino acid residue in a pair of amino acid residues suitable for stapling, is independently ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- both R a1 and R a3 are ⁇ H.
- X 11 is a residue of an amino acid suitable for stapling. In some embodiments, X 11 is a residue of an amino acid, e.g., having the structure of formula A-I, A-II, A-III, A- IV, A-V, A-VI, etc., whose side chain comprise a functional group suitable for stapling, e.g., a double bond.
- X 11 is a residue of an amino acid that comprises one and no more than one functional groups for stapling. In some embodiments, X 11 is a residue of an amino acid that comprises one and no more than one double bond for stapling. As in certain embodiments of X 1 , in some embodiments, X 11 comprises a ring structure, and its amino group is part of a ring. In some embodiments, X 11 is an amino acid as described herein (e.g., of formula A-I, A-II, A-III, etc.), wherein R a1 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a1 and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- R a2 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a2 and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- a formed ring e.g., by R a1 and R a3 taken together with their intervening atoms, by R a2 and R a3 taken together with their intervening atoms, or by any other two suitable R taken together with their intervening atoms, either in X 11 or another moiety, is saturated.
- a formed ring is monocyclic.
- a formed ring has no heteroatoms in addition to the intervening atoms.
- a formed ring has at least one heteroatom in addition to the intervening atoms.
- a formed ring has at least one nitrogen in addition to the intervening atoms.
- L a1 and L a2 are covalent bond.
- a formed ring is unsubstituted.
- a formed ring is substituted.
- a substitute comprises a double bond which is suitable for metathesis with another double bond to form a staple.
- a substituent bonds to a nitrogen ring atom e.g., see PyrS, PyrsS1, PyrS2, PyrS3, etc.).
- L a is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein, and each ⁇ CH 2 ⁇ is optionally substituted.
- L a is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein.
- ⁇ (CH 2 ) n1 ⁇ is bonded to X 11 .
- n1 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- n1 is 1.
- n1 is 2.
- n1 is 3. In some embodiments, n2 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n2 is 1. In some embodiments, n2 is 2. In some embodiments, n2 is 3. In some embodiments, n2 is 4. In some embodiments, n2 is 5. In some embodiments, R’ of ⁇ N(R’) ⁇ of L a and R a3 are taken together with their intervening atoms to form an optionally substituted ring. In some embodiments, a formed ring is optionally substituted 3-10 membered monocyclic, saturated or partially unsaturated ring having, in addition to the nitrogen atom to which R’ is attached, 0-3 heteroatoms.
- a formed ring is saturated. In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4-membered. In some embodiments, a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered. In some embodiments, a formed ring is 7-membered. In some embodiments, a formed ring is 8- membered. In some embodiments, a formed ring has no ring heteroatoms other than the nitrogen atom to which R’ is attached. In some embodiments, X 11 is a residue of PyrS2. [0444] In some embodiments, X 11 is stapled. In some embodiments, X 11 is stapled with X 4 .
- X 11 is PyrS2 and stapled.
- a staple e.g., L s
- L s has the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 , wherein each variable is independently as described herein.
- L s1 or L s3 is L a of X 11 as described herein.
- L s3 is L a of X 11 as described herein.
- L s1 is L a of another amino acid residue, e.g., X 4 .
- L s1 is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s3 is L as described herein. In some embodiments, L s3 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein, and each ⁇ CH 2 ⁇ is optionally substituted. In some embodiments, L s3 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein. In some embodiments, ⁇ (CH 2 ) n1 ⁇ is bonded to X 11 . In some embodiments, n1 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- n1 is 1. In some embodiments, n1 is 2. In some embodiments, n1 is 3. In some embodiments, n2 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n2 is 1. In some embodiments, n2 is 2. In some embodiments, n2 is 3. In some embodiments, n2 is 4. In some embodiments, n2 is 5. In some embodiments, R’ of ⁇ N(R’) ⁇ of L a and R a3 are taken together with their intervening atoms to form an optionally substituted ring.
- a formed ring is optionally substituted 3-10 membered monocyclic, saturated or partially unsaturated ring having, in addition to the nitrogen atom to which R’ is attached, 0-3 heteroatoms.
- a formed ring is saturated.
- a formed ring is 3-membered.
- a formed ring is 4-membered.
- a formed ring is 5-membered.
- a formed ring is 6-membered.
- a formed ring is 7-membered.
- a formed ring is 8- membered.
- a formed ring has no ring heteroatoms other than the nitrogen atom to which R’ is attached.
- X 11 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- X 11 is a residue of an amino acid selected from PyrS2, S8, PyrS, S7, PyrS3, SeN, Az, S4, S6, SdN, S10, S5, SgN or PyrS1.
- X 11 is a residue of PyrS2.
- X 11 is a residue of S8.
- X 11 is a residue of PyrS.
- X 11 is a residue of S7.
- X 11 is a residue of PyrS3.
- X 11 is a residue of SeN.
- X 11 is a residue of Az.
- X 11 is a residue of S4. In some embodiments, X 11 is a residue of S6. In some embodiments, X 11 is a residue of SdN. In some embodiments, X 11 is a residue of S10. In some embodiments, X 11 is a residue of S5. In some embodiments, X 11 is a residue of SgN. In some embodiments, X 11 is a residue of PyrS1. [0449] In some embodiments, X 11 is stapled. In some embodiments, X 11 is stapled with X 4 . [0450] In some embodiments, X 11 is amino acid residue not suitable for stapling, e.g., via olefin metathesis.
- X 11 comprises a polar side chain. In some embodiments, X 11 comprises a non-polar side chain. In some embodiments, X 11 comprises a hydrophobic side chain. In some embodiments, X 11 comprises an aliphatic side chain. In some embodiments, X 11 comprises an alkyl side chain. In some embodiments, X 11 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 11 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, X 11 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 .
- X 11 comprises a detectable moiety such as a fluorescent moiety.
- X 11 is Ala.
- X 11 is Phe.
- X 11 is selected from S8, PyrS2, PyrS, S7, PyrS3, SeN, Ala, Az, Phe, S4, S6, SdN, S10, S5, SgN, and PyrS1.
- X 11 is a residue of Az2, Az3, PyrR2, PyrS4, SeNc5, SPip1, SPip2, SPip3, Aib, Ala, Az, Leu, Phe, PyrS, PyrS1, PyrS2, PyrS3, S10, S4, S5, S6, S7, S8, SdN, SeN, or SgN.
- X 11 is a residue of Az2, Az3, PyrR2, PyrS4, SeNc5, SPip1, SPip2, or SPip3.
- X 11 is a residue of Aib, Ala, Az, Leu, Phe, PyrS, PyrS1, PyrS2, PyrS3, S10, S4, S5, S6, S7, S8, SdN, SeN, or SgN.
- Various types of amino acid residues can be used for X 12 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 12 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 12 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 12 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group. In some embodiments, X 12 is an aromatic amino acid residue as described herein. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one oxygen atom. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom.
- an aromatic group is optionally substituted 6-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 6-membered heteroaryl having 1 nitrogen atom. In some embodiments, an aromatic group is optionally substituted phenyl.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ C(O)OH, ⁇ C(O)NH 2 , ⁇ CN, or –NO 2 , wherein each R is independently C 1-4 alkyl or haloalkyl. In some embodiments, an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen.
- X 12 comprises a side chain which is or comprises two optionally substituted aromatic groups.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH.
- an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom.
- X 12 is a residue of an amino acid of formula A-I or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein.
- R’ is R as described herein.
- R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1- 5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic.
- each substituent is independently halogen or ⁇ OH.
- R is optionally substituted phenyl.
- R is phenyl.
- R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom.
- R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. As described herein, L a is L. In some embodiments, L is a covalent bond. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1- 10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 12 is a residue of an amino acid having the structure of formula A-I, wherein R a2 is ⁇ L a ⁇ R’, and R’ is an optionally substituted aromatic group.
- L a is optionally substituted CH 2 .
- L a is ⁇ CH 2 ⁇ .
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ N(R) 2 , ⁇ C(O)N(R) 2 , or ⁇ CN, wherein each R is independently ⁇ H, C 1-4 alkyl or haloalkyl, or ⁇ Ph.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-4 alkyl or haloalkyl.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-2 alkyl or haloalkyl.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more halogen.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more ⁇ F.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ CF 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ CH 3 , ⁇ CF 3 , or ⁇ CN. In some embodiments, X 12 comprises a side chain which is or comprises an aromatic group optionally substituted at 2’-position. In some embodiments, X 12 comprises a side chain which is or comprises an unsubstituted aromatic group. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5- membered heteroaryl having one oxygen atom. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 12 is selected from Phe, 3Thi, 2ClF, 3FF, 2OMeF, 2FF, Pff, 2CBMF, 3ClF, 3F3MeF, 1NapA, 2NapA, 2PyrA, 4CBMF, 4COOHF, 4F3MeF, Tyr, 2BrF, 2F3MeF, 2Thi, 4PyrA, hPhe, Trp, 1meH, 23FF, 2MeF, 34FF, 3OMeF, 3PyrA, 4ClF, 4CNF, His, 2CNF, 2NO2F, 35FF, 3CBMF, 3CNF, 3MeF, 3meH, 4FF, 4MeF, 4Thz, BztA, dPhe, and hTyr.
- X 12 is 3Thi. In some embodiments, X 12 is Phe. In some embodiments, X 12 is Phe, wherein the phenyl group is substituted. In some embodiments, X 12 is Phe, wherein the phenyl group is 2’-substituted. In some embodiments, X 12 is 1FF. In some embodiments, X 12 is 2ClF. In some embodiments, X 12 is 2BrF. In some embodiments, X 12 is 2F3MeF. In some embodiments, X 12 is 2MeF. In some embodiments, X 12 is 2CNF. [0458] In some embodiments, X 12 comprises a polar side chain.
- X 12 comprises a non-polar side chain. In some embodiments, X 12 comprises a hydrophobic side chain. In some embodiments, X 12 comprises an aliphatic side chain. In some embodiments, X 12 comprises an alkyl side chain. In some embodiments, X 12 comprises a side chain comprising a cycloaliphatic group (e.g., a 5- or 6-membered cycloalkyl group). In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 comprises a side chain comprising an acidic group, e.g., ⁇ COOH.
- X 12 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 .
- X 12 is Gln.
- X 12 is Asn.
- X 12 is Asp.
- X 12 is Glu.
- X 12 is Cha.
- X 12 is CypA.
- X 12 is Ala.
- X 12 is nLeu.
- X 12 is Npg.
- X 12 is [Acryl]Dap. [0459]
- X 12 is a polar amino acid residue as described herein.
- X 12 is hydrophobic amino acid residue as described herein. In some embodiments, X 12 is a hydrophobic amino acid residue as described herein. [0460] In some embodiments, X 12 is a residue of amino acid that comprises an acidic or polar group. In some embodiments, X 12 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.). Various acidic amino acid residues described herein may be utilized for X 12 , e.g., those described for X 2 , X 5 , X 6 , etc.
- X 12 is 2COOHF. In some embodiments, X 12 is a residue of amino acid whose side chain comprises a polar group. In some embodiments, X 12 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 . For example, in some embodiments, X 12 is a residue of 2cbmF. Various other polar amino acid residues described herein may also be utilized for X 12 .
- X 12 is selected from Phe, 3Thi, 2ClF, 3FF, 2OMeF, 2FF, Pff, Asp, 2CBMF, 3ClF, 3F3MeF, 1NapA, 2NapA, 2PyrA, 4CBMF, 4COOHF, 4F3MeF, Tyr, 2BrF, 2F3MeF, 2Thi, 4PyrA, Cha, CypA, hPhe, Trp, dPhe, [Acryl]Dap, 1meH, 23FF, 2MeF, 34FF, 3OMeF, 3PyrA, 4ClF, 4CNF, Ala, Glu, His, 2CNF, 2NO2F, 35FF, 3CBMF, 3CNF, 3MeF, 3meH, 4FF, 4MeF, 4Thz, Asn, BztA, dPhe and hTyr.
- X 12 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0463] In some embodiments, X 12 is a residue of [CyPr]-3SF, [Ph]3SF, [Ph]-3SF, 3BrF, 3CBMF, Cba, [Acryl]Dap, 1meH, 1NapA, 23FF, 2BrF, 2CBMF, 2ClF, 2CNF, 2F3MeF, 2FF, 2MeF, 2NapA, 2NO2F, 2OMeF, 2pyrA, 2Thi, 34FF, 35FF, 3ClF, 3CNF, 3F3MeF, 3FF, 3MeF, 3meH, 3OMeF, 3PyrA, 3thi, 4CBMF, 4ClF, 4CNF, 4COOHF, 4F3MeF, 4FF, 4MeF, 4PyrA
- X 12 is a residue of [CyPr]-3SF, [Ph]3SF, [Ph]-3SF, 3BrF, 3CBMF, or Cba. [0465] In some embodiments, X 12 is a residue of [Acryl]Dap, 1meH, 1NapA, 23FF, 2BrF, 2CBMF, 2ClF, 2CNF, 2F3MeF, 2FF, 2MeF, 2NapA, 2NO2F, 2OMeF, 2pyrA, 2Thi, 34FF, 35FF, 3ClF, 3CNF, 3F3MeF, 3FF, 3MeF, 3meH, 3OMeF, 3PyrA, 3thi, 4CBMF, 4ClF, 4CNF, 4COOHF, 4F3MeF, 4FF, 4MeF, 4PyrA, 4Thz, Ala, Asn, Asp, Bz
- X 13 Various types of amino acid residues can be used for X 13 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 13 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0467] Various types of amino acid residues can be used for X 13 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc.
- X 13 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group. In some embodiments, X 13 is an aromatic amino acid residue as described herein. [0469] In some embodiments, X 13 is a residue of an amino acid having the structure of formula A-I, wherein R a2 is ⁇ L a ⁇ R’, and R’ is an optionally substituted aromatic group. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted phenyl. In some embodiments, X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ C(O)OH, or ⁇ CN, wherein each R is independently hydrogen or C 1-4 alkyl or haloalkyl. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen. In some embodiments, X 13 comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms.
- an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom.
- X 13 is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein.
- R’ is R as described herein.
- R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic.
- each substituent is independently halogen or ⁇ OH.
- R is optionally substituted phenyl.
- R is phenyl.
- R is optionally substituted aryl.
- R is aryl.
- R is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms.
- R is optionally substituted 5-membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur.
- L a is L. In some embodiments, L is a covalent bond. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L a is optionally substituted CH 2 .
- L a is ⁇ CH 2 ⁇ .
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ N(R) 2 , ⁇ C(O)N(R) 2 , or ⁇ CN, wherein each R is independently ⁇ H, C 1-4 alkyl or haloalkyl, or ⁇ Ph.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-4 alkyl or haloalkyl.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently C 1-2 alkyl or haloalkyl.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more halogen.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN, wherein each R is independently methyl optionally substituted with one or more ⁇ F.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from ⁇ F, ⁇ OR, ⁇ CH 3 , ⁇ CF 3 , ⁇ NH 2 , ⁇ C(O)NH 2 , ⁇ Ph, or ⁇ CN.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ CH 3 , ⁇ CF 3 , or ⁇ CN. In some embodiments, X 13 comprises a side chain which is or comprises an aromatic group optionally substituted at 2’-position. In some embodiments, X 13 comprises a side chain which is or comprises an unsubstituted aromatic group. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5- membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having one oxygen atom. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-membered bicyclic heteroaryl having 1-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 10-membered bicyclic heteroaryl having 1-5 heteroatoms.
- an aromatic group is optionally substituted 10-membered bicyclic heteroaryl having one heteroatom which is sulfur. In some embodiments, an aromatic group is optionally substituted 10-membered bicyclic heteroaryl having one heteroatom which is oxygen. In some embodiments, an aromatic group is optionally substituted 10-membered bicyclic heteroaryl having one heteroatom which is nitrogen. In some embodiments, an aromatic group is optionally substituted 10- membered bicyclic aryl.
- X 13 is selected from BztA, Trp, 2NapA, 1NapA, WCHO, 5CpW, 5FW, aMeW, H2Trp, His, Phe, 23FF, 34FF, 34OMeF, 1MeW, 5CF3W, 5ClW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, Bip, and Qui.
- X 13 is selected from BztA, Trp, 2NapA, 1NapA, WCHO, 5CpW, 5FW, aMeW, H2Trp, 1MeW, 5CF3W, 5ClW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, and Qui.
- X 13 is selected from BztA, Trp, 2NapA, 1NapA, WCHO, 5CpW, 5FW, aMeW, 1MeW, 5CF3W, 5ClW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, and Qui.
- X 13 is BztA.
- X 13 is Trp.
- X 13 is 1NapA.
- X 13 is 2NapA.
- X 13 comprises a polar side chain. In some embodiments, X 13 comprises a non-polar side chain.
- X 13 comprises a hydrophobic side chain. In some embodiments, X 13 comprises an aliphatic side chain. In some embodiments, X 13 comprises an alkyl side chain. In some embodiments, X 13 comprises a side chain comprising a cycloaliphatic group (e.g., a 5- or 6-membered cycloalkyl group). In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 13 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, X 13 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 .
- X 13 is Gln. In some embodiments, X 13 is Asn. In some embodiments, X 13 is Asp. In some embodiments, X 13 is Glu. In some embodiments, X 13 is Cha. In some embodiments, X 13 is CypA. In some embodiments, X 13 is Ala. In some embodiments, X 13 is nLeu. In some embodiments, X 13 is Npg. In some embodiments, X 13 is [Acryl]Dap.
- X 13 is selected from BztA, Trp, 2NapA, 1NapA, WCHO, 5CpW, 5FW, Ala, aMeW, H2Trp, His, Phe, 23FF, 34FF, 34OMeF, 1MeW, 5CF3W, 5ClW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, Bip, and Qui. [0474] In some embodiments, X 13 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 13 is a residue of 2F3MeW, 34ClF, 34MeF, 3Br4FF, 3BrF, 4ClBztA, 4ClW, 4FW, 5IndA, 7AzaW, 7ClBztA, 7FBztA, Cba, RbMe2NapA, RbMeBztA, SbMe2NapA, SbMeBztA, 1MeW, 1NapA, 23FF, 2F3MeF, 2NapA, 34FF, 34OMeF, 3ClF, 3Thi, 4ClF, 5CF3W, 5ClW, 5CpW, 5FW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, Ala, aMeW, Bip, BztA, Cha, H2Trp, His, Phe, Pyr
- X 13 is a residue of 2F3MeW, 34ClF, 34MeF, 3Br4FF, 3BrF, 4ClBztA, 4ClW, 4FW, 5IndA, 7AzaW, 7ClBztA, 7FBztA, Cba, RbMe2NapA, RbMeBztA, SbMe2NapA, or SbMeBztA.
- X 13 is a residue of 1MeW, 1NapA, 23FF, 2F3MeF, 2NapA, 34FF, 34OMeF, 3ClF, 3Thi, 4ClF, 5CF3W, 5ClW, 5CpW, 5FW, 5MeOW, 6ClW, 6F1NapA, 7F1NapA, 7FW, Ala, aMeW, Bip, BztA, Cha, H2Trp, His, Phe, PyrS2, Qui, Trp, Tyr, or WCHO.
- X 14 Various types of amino acid residues can be used for X 14 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 14 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 14 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 14 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0479] In some embodiments, X 14 comprises a polar side chain. In some embodiments, X 14 is a polar amino acid residue as described herein. In some embodiments, X 14 comprises a non-polar side chain.
- X 14 comprises a hydrophobic side chain. In some embodiments, X 14 is a hydrophobic amino acid residue as described herein. In some embodiments, X 14 comprises an aliphatic side chain. In some embodiments, X 14 comprises an alkyl side chain. In some embodiments, X 14 comprises a side chain comprising a cycloaliphatic group (e.g., a 5- or 6-membered cycloalkyl group). In some embodiments, X 14 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 14 comprises a side chain comprising an acidic group, e.g., ⁇ COOH.
- X 14 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 .
- X 14 is Gln.
- X 14 is selected from Gln, His, Ser, dThr, Thr, Ala, Hse, Asn, Leu, Aib, Alaol, Throl, Leuol, dAsn, dGln, dHis, Tyr, [AzAc]Lys, 1MeH, 3MeH, 4TriA, dSer, NMeHis, NMeS, Pro, Trp, Val, MorphAla, 2FurA, Abu, Arg, Dab, iPrLys, Phe, Pheol, and Prool.
- X 14 is a residue of an amino alcohol, e.g., Throl, Alaol, Leuol, Pheol or Prool.
- an amino alcohol has a structure corresponding an amino acid wherein a ⁇ COOH group is replaced with a ⁇ OH group.
- when X 14 is a residue of an amino alcohol it is the last residue at the C-terminus. Such a sequence may be properly considered to have ⁇ OH as a C-terminus capping group, or such amino alcohol residues may be considered as C-terminus capping groups.
- X 15 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 14 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0484] In some embodiments, X 14 is a residue of [3C]TriAzLys, [4F3CPip]GlnR, [4MePpzPip]GlnR, [4Pippip]GlnR, [AcPpz]GlnR, [bismethoxyethylamine]GlnR, [Me2NPrPip]GlnR, [Morph]GlnR, [NHEt]GlnR, [NMe2]GlnR, [Pip]GlnR, [PropynPEG14]Lys, [RDMAPyr]GlnR, [TfePpz]GlnR, AcLys, BnBoroleK, F2PipNva, GlnR, Me2As
- X 14 is a residue of [3C]TriAzLys, [4F3CPip]GlnR, [4MePpzPip]GlnR, [4Pippip]GlnR, [AcPpz]GlnR, [bismethoxyethylamine]GlnR, [Me2NPrPip]GlnR, [Morph]GlnR, [NHEt]GlnR, [NMe2]GlnR, [Pip]GlnR, [PropynPEG14]Lys, [RDMAPyr]GlnR, [TfePpz]GlnR, AcLys, BnBoroleK, F2PipNva, GlnR, Me2Asn, Me2Gln, MePpzAsn, Met2O, MorphAsn, MorphGln,
- X 14 is a residue of 1MeH, 2cbmf, 2F3MeF, 2FurA, 3cbmf, 3MeH, 4TriA, Abu, Aib, Ala, Alaol, Arg, Asn, Asp, BztA, Cha, Dab, dAsn, dGln, dHis, dSer, dThr, Gln, His, Hse, iPrLys, Leu, Leuol, Lys, MorphAla, NMeHis, NMeS, Npg, Phe, Pheol, Pro, Prool, PyrS2, S5, Ser, Thr, Throl, Trp, Tyr, or Val.
- p14 is 1. In some embodiments, p14 is 0.
- Various type of amino acid residues can be utilized for X 15 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 15 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 15 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 15 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0489] In some embodiments, X 15 comprises a polar side chain as described herein. In some embodiments, X 15 comprises a non-polar side chain. In some embodiments, X 15 comprises a hydrophobic side chain as described herein.
- X 15 comprises an aliphatic side chain. In some embodiments, X 15 comprises an alkyl side chain. In some embodiments, a side chain of X 15 is C 1-10 alkyl. In some embodiments, X 15 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 15 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, X 15 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, X 15 comprises a detectable moiety such as a fluorescent moiety. [0490] In some embodiments, X 15 is Ala.
- X 15 is dAla. In some embodiments, X 15 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 15 is Lys. In some embodiments, X 15 is substituted or labeled lysine.
- X 15 is selected from [1Napc]Lys, [1NapPr]Lys, [22PhPr]Lys, [2Napc]Lys, [35CF3PhPr]Lys, [4MePipBz]Lys, [AdamantC]Lys, [AzAc]Lys, [Bua]Lys, [Me2NCBz]Lys, [Me3AdamantC]Lys, [MeBipipAc]Lys, [MeMorphBz]Lys, [MePipAc]Lys, [MorphAc]Lys, [mPEG2]Lys, [mPEG4]Lys, [mPEG6]Lys, [mPEG8]Lys, [Oct]Lys, [PropynPEG1]Lys, [PropynPEG
- X 15 is a residue of a compound without a carboxyl group, e.g., 6AmHex, 6AzHex, etc. In some embodiments, when X 15 is such a residue, it is the last residue at the C- terminus. Such a sequence may be properly considered to have X 15 as a C-terminus capping group. [0492] In some embodiments, X 15 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 15 is a residue of [3C]TriAzdLys, [3C]TriAzLys, [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me2NCBz]Lys, [Me3AdamantC-PEG2]-Lys, [PropynPEG14]Lys, dAla, dIle, [1Napc]Lys, [1NapPr]Lys, [22PhPr]Lys, [2Napc]Lys, [35CF3PhPr]Lys, [4MePipBz]Lys, [AdamantC]Lys, [Bua]Lys, [Me3AdamantC]Lys, [Me3AdamantC]-Lys, [MeBipipAc]Lys, [MeM
- X 15 is a residue of [3C]TriAzdLys, [3C]TriAzLys, [lithocholate]-Lys, [lithocholate-PEG2]-Lys, [Me2NCBz]Lys, [Me3AdamantC-PEG2]-Lys, [PropynPEG14]Lys, dAla, or dIle.
- X 15 is a residue of [1Napc]Lys, [1NapPr]Lys, [22PhPr]Lys, [2Napc]Lys, [35CF3PhPr]Lys, [4MePipBz]Lys, [AdamantC]Lys, [Bua]Lys, [Me3AdamantC]Lys, [Me3AdamantC]-Lys, [MeBipipAc]Lys, [MeMorphBz]Lys, [MePipAc]Lys, [MorphAc]Lys, [mPEG2]Lys, [mPEG4]Lys, [mPEG6]Lys, [mPEG8]Lys, [Oct]Lys, [PropynPEG1]Lys, [PropynPEG1]Lys,
- p15 is 1. In some embodiments, p15 is 0.
- Various types of amino acid residues can be used for X 16 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 16 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 16 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 16 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0498] In some embodiments, X 16 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 16 comprises a non-polar side chain.
- X 16 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 16 comprises an aliphatic side chain. In some embodiments, X 16 comprises an alkyl side chain. In some embodiments, a side chain of X 16 is C 1-10 alkyl. In some embodiments, X 16 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, it is an aromatic amino acid residue as described herein. In some embodiments, X 16 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein.
- X 16 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 16 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 16 is Ala. In some embodiments, X 16 is dAla. [0499] In some embodiments, X 16 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 16 is a residue of Cbg, Cpg, CyLeu, dLeu, dAla, Aib, Ala, Arg, Asn, dGln, dThr, Gln, Ile, Leu, nLeu, Phe, Ser, Thr, Trp, Tyr, or Val. [0501] In some embodiments, X 16 is a residue of Cbg, Cpg, CyLeu, dLeu, or dAla.
- X 16 is a residue of Aib, Ala, Arg, Asn, dGln, dThr, Gln, Ile, Leu, nLeu, Phe, Ser, Thr, Trp, Tyr, or Val.
- p16 is 1.
- p16 is 0.
- Various types of amino acid residues can be used for X 17 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 17 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 17 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 17 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 17 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 17 comprises a non-polar side chain. In some embodiments, X 17 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 17 comprises an aliphatic side chain. In some embodiments, X 17 comprises an alkyl side chain. In some embodiments, a side chain of X 17 is C 1-10 alkyl. In some embodiments, X 17 comprises a side chain comprising an optionally substituted aromatic group.
- X 17 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 17 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 17 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 17 is Ala, dAla, or Leu. In some embodiments, X 17 is Ala. In some embodiments, X 17 is dAla.
- X 17 is Leu. [0506] In some embodiments, X 17 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0507] In some embodiments, p17 is 1. In some embodiments, p17 is 0. [0508] Various types of amino acid residues can be used for X 18 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 18 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 18 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 18 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 18 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 18 comprises a non-polar side chain. In some embodiments, X 18 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 18 comprises an aliphatic side chain. In some embodiments, X 18 comprises an alkyl side chain. In some embodiments, a side chain of X 18 is C 1-10 alkyl. In some embodiments, X 18 comprises a side chain comprising an optionally substituted aromatic group.
- X 18 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 18 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 18 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 18 is Aib, Ala, or Leu. In some embodiments, X 18 is Ala or Leu. In some embodiments, X 18 is Aib.
- X 18 is Ala. In some embodiments, X 18 is Leu. [0510] In some embodiments, X 18 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0511] In some embodiments, p18 is 1. In some embodiments, p18 is 0. [0512] Various types of amino acid residues can be used for X 19 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 19 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 19 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 19 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 19 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 19 comprises a non-polar side chain. In some embodiments, X 19 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 19 comprises an aliphatic side chain. In some embodiments, X 19 comprises an alkyl side chain. In some embodiments, a side chain of X 19 is C 1-10 alkyl. In some embodiments, X 19 comprises a side chain comprising an optionally substituted aromatic group.
- X 19 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 19 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 19 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 19 is Aib, Ala, or Leu. In some embodiments, X 19 is Ala or Leu. In some embodiments, X 19 is Aib.
- X 19 is Ala. In some embodiments, X 19 is Leu. [0514] In some embodiments, X 19 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0515] In some embodiments, p19 is 1. In some embodiments, p19 is 0. [0516] Various types of amino acid residues can be used for X 20 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 20 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 20 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 20 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 20 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 20 comprises a non-polar side chain. In some embodiments, X 20 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 20 comprises an aliphatic side chain. In some embodiments, X 20 comprises an alkyl side chain. In some embodiments, a side chain of X 20 is C 1-10 alkyl. In some embodiments, X 20 comprises a side chain comprising an optionally substituted aromatic group.
- X 20 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 20 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 20 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 20 is Aib, Ala, or Leu. In some embodiments, X 20 is Ala or Leu. In some embodiments, X 20 is Aib.
- X 20 is Ala. In some embodiments, X 20 is Leu. [0518] In some embodiments, X 20 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0519] In some embodiments, p20 is 1. In some embodiments, p20 is 0. [0520] Various types of amino acid residues can be used for X 21 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 21 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 21 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 21 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 21 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 21 comprises a non-polar side chain. In some embodiments, X 21 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 21 comprises an aliphatic side chain. In some embodiments, X 21 comprises an alkyl side chain. In some embodiments, a side chain of X 21 is C 1-10 alkyl. In some embodiments, X 21 comprises a side chain comprising an optionally substituted aromatic group.
- X 21 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 21 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 21 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 21 is Aib, Ala, or Leu. In some embodiments, X 21 is Ala or Leu. In some embodiments, X 21 is Aib.
- X 21 is Ala. In some embodiments, X 21 is Leu. [0522] In some embodiments, X 21 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0523] In some embodiments, p21 is 1. In some embodiments, p21 is 0. [0524] Various types of amino acid residues can be used for X 22 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 22 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 22 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 22 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 22 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 22 comprises a non-polar side chain. In some embodiments, X 22 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 22 comprises an aliphatic side chain. In some embodiments, X 22 comprises an alkyl side chain. In some embodiments, a side chain of X 22 is C 1-10 alkyl. In some embodiments, X 22 comprises a side chain comprising an optionally substituted aromatic group.
- X 22 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 22 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 22 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 22 is Aib, Ala, or Leu. In some embodiments, X 22 is Ala or Leu. In some embodiments, X 22 is Aib.
- X 22 is Ala. In some embodiments, X 22 is Leu. [0526] In some embodiments, X 22 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0527] In some embodiments, p22 is 1. In some embodiments, p22 is 0. [0528] Various types of amino acid residues can be used for X 23 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 23 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 23 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 23 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 23 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 23 comprises a non-polar side chain. In some embodiments, X 23 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 23 comprises an aliphatic side chain. In some embodiments, X 23 comprises an alkyl side chain. In some embodiments, a side chain of X 23 is C 1-10 alkyl. In some embodiments, X 23 comprises a side chain comprising an optionally substituted aromatic group.
- X 23 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 23 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 23 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 23 is Aib, Ala, or Leu. In some embodiments, X 23 is Ala or Leu. In some embodiments, X 23 is Aib.
- X 23 is Ala. In some embodiments, X 23 is Leu. [0530] In some embodiments, X 23 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0531] In some embodiments, p23 is 1. In some embodiments, p23 is 0.
- an agent is or comprises a peptide having the structure of: R N ⁇ [X] p ⁇ X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 ⁇ [X] p’ ⁇ R C , or a salt thereof, wherein: each X is independently an amino acid residue; each p and p’ is independently 0-10; R N is independently a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; R C is independently a peptide, a carboxyl protecting group, ⁇ L RC ⁇ R’, ⁇ O ⁇ L RC ⁇ R’ or ⁇ N(R’) ⁇ L RC ⁇ R’; each of L RN and L RC is independently L; and each other variable is independently as described herein.
- p is 0. In some embodiments, p is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, p is 1. In some embodiments, p is 2. In some embodiments, p is 3. In some embodiments, p is 4. In some embodiments, p is 5. In some embodiments, p is 6. In some embodiments, p is 7. In some embodiments, p is 8. In some embodiments, p is 9. In some embodiments, p is 10. [0534] In some embodiments, p’ is 0. In some embodiments, p’ is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, p’ is 1. In some embodiments, p’ is 2. In some embodiments, p’ is 3.
- each X is independently a residue of an amino acid having the structure of A-I, A-II, A-III, A-IV, etc.
- R N is or comprises a peptide.
- R N is a N- terminus capping bodiments, R N is an amino protecting group.
- R N is ⁇ L RN ⁇ R’.
- L RN is ⁇ C(O) ⁇ .
- R N is ⁇ C(O)R.
- R N is Ac.
- R N is AzAc (N 3 ⁇ CH 2 ⁇ C(O) ⁇ ).
- R N is 2PyPrpc ( ). In som N is MeOPr (CH 3 OCH 2 CH 2 C(O) ⁇ ).
- R N is MeSO 2 ( ⁇ SO 2 CH 3 ).
- R N is mPEG2 (CH 3 OCH 2 CH 2 OCH 2 CH 2 C(O) ⁇ ).
- wherein R N is Nic ( ).
- R N is Oct (CH 3 (CH 2 ) 6 C(O) ⁇ ). In N some embodiments, R is Pic ( ). [0538] In some embodiments, R C is or comprises a peptide. In some embodiments, R C is a C- terminus capping group. In some embodiments, R C is a carboxyl protecting group. In some embodiments, R C is ⁇ L RC ⁇ R’. In some embodiments, R C is ⁇ O ⁇ L RC ⁇ R’. In some embodiments, R C is ⁇ OR’. In some embodiments, R C is ⁇ N(R’) ⁇ L RC ⁇ R’. In some embodiments, R C is ⁇ N(R’) 2 .
- R C is ⁇ NHR’. In some embodiments, R C is ⁇ N(R) 2 . In some embodiments, R C is ⁇ NHR. In some embodiments, R C is ⁇ NH 2 . In some embodiments, R ome embodiments, R C is m e embodiments, R C N i s ⁇ NHCyHe ( H ). In some embodiments, R C is ⁇ NHCyPr ( ). In some embodiments, R C is ⁇ NHCyBu.
- R C is ⁇ 6AmHex, wherein one amino group of ⁇ 6AmHex is bonded to the last ⁇ C(O) ⁇ of the peptide backbone (R C is ⁇ NH ⁇ (CH 2 ) 6 ⁇ NH 2 ).
- R C is ⁇ 6AZHex, wherein the amino group of ⁇ 6AzHex is C(O) ⁇ of the peptide backbone (R C is ⁇ NH ⁇ (CH 2 ) 6 ⁇ N 3 ).
- R C is amino group of ⁇ Alaol is bonded to the last ⁇ C(O) ⁇ of the peptide backbone (R C is ).
- R C is ⁇ Leuol, w oup of ⁇ Leuol is bonded to t peptide backbone (R C is ).
- R C is ⁇ Pheol, w g p of ⁇ Pheol is bonded to the last ⁇ C(O) ⁇ of the pepti C de backbone (R is ).
- R C is ⁇ Prool, wherein the amino group of ⁇ Prool is bonded t peptide backbone (R C is ).
- R C is ⁇ Throl, wherein the amino group of ⁇ Throl is bonded to the last ⁇ C(O) ⁇ of the peptide backbone (R C is ).
- an agent that binds to beta-catenin comprises an amino acid residue described herein, e.g., a residue of formula AA or a salt form thereof.
- an agent that binds to beta-catenin comprises a TfeGA residue.
- an agent that binds to beta- catenin comprises a 2COOHF residue.
- an agent that binds to beta-catenin comprises a 3COOHF residue.
- such a residue is X 2 , X 5 or X 6 .
- such a residue is X 5 .
- such a residue is X 6 .
- Certain useful agents e.g., stapled peptides
- Table E3 As examples; certain data are presented in Table E2 as examples.
- Amino Acids [0541] As appreciated by those skilled in the art, various amino acids may be utilized in accordance with the present disclosure. For example, both naturally occurring and non-naturally occurring amino acids can be utilized in accordance with the present disclosure.
- an amino acid is a compound comprising an amino group that can form an amide group with a carboxyl group and a carboxyl group.
- an amino acid is an alpha amino acid.
- an amino acid is a beta-amino acid. In some embodiments, an amino acid is a D-amino acid. In some embodiments, an amino acid is a L-amino acid. In some embodiments, an amino acid is an naturally encoded amino acid, e.g., in mammalian cells.
- an amino acid is a compound having the structure of formula A-I: NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH, A-I or a salt thereof, wherein: each of R a1 , R a2 , R a3 is independently ⁇ L a ⁇ R’; each of L a , L a1 and L a2 is independently L; each L is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 25 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’)
- a ring moiety of, e.g., ⁇ Cy ⁇ , R (including those formed by R groups taken together), etc. is monocyclic.
- a ring moiety is bicyclic or polycyclic.
- a monocyclic ring is an optionally substituted 3-10 (3, 4, 5, 6, 7, 8, 9, or 10, 3-8, 3-7, 4-7, 4-6, 5-6, etc.) membered, saturated, partially unsaturated or aromatic ring having 0-5 heteroatoms.
- each monocyclic ring unit of a bicyclic or polycyclic ring moiety is independently an optionally substituted 3-10 (3, 4, 5, 6, 7, 8, 9, or 10, 3-8, 3-7, 4-7, 4-6, 5-6, etc.) membered, saturated, partially unsaturated or aromatic ring having 0-5 heteroatoms.
- each heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each heteroatom is independently selected from oxygen, nitrogen, and sulfur.
- L a1 is a covalent bond.
- a compound of formula A-1 is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a2 is a covalent bond.
- a compound of formula A-1 is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a1 is a covalent bond and L a2 is a covalent bond.
- a compound of formula A-1 is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- an amino acid is suitable for stapling.
- an amino acid comprises a terminal olefin. Certain such amino acids are exemplified herein (e.g., those described in or utilized in peptides of various Tables).
- an agent comprises a detectable moiety, which can either be detected directly or indirectly.
- a detectable moiety is or comprises a fluorescent group.
- a detectable moiety is or comprises a biotin moiety.
- a detectable moiety is connected to the rest of an agent at an amino acid residue, e.g., through a side chain, optionally through a linker (e.g., L as described herein).
- a detectable moiety is ⁇ N 3 , which may be detected after a click chemistry reaction with a labeled agent comprising an alkyne.
- the present disclosure provides various compounds, which among other things may be utilized as amino acids for a number of applications, e.g., for preparation of peptides or other useful compounds.
- a compound e.g., an amino acid or a protected and/or activated form thereof or a salt thereof comprises 1) a first group which is an optionally protected amino group, 2) a second group which is an optionally protected and/or activated carboxyl group, and 3) a side chain (typically bonded to an atom between the first and second groups (“a side chain attachment atom”)) which comprises an optionally protected and/or activated carboxyl group and a) an optionally substituted ring (which ring is typically between the optionally protected and/or activated carboxyl group of the side chain and a side chain attachment atom) or b) an amino group (which amino group is typically between the optionally protected and/or activated carboxyl group of the side chain and a side chain attachment atom).
- a side chain attachment atom typically bonded to an atom between the first and second groups
- an optionally substituted ring which ring is typically between the optionally protected and/or activated carboxyl group of the side chain and a side chain attachment
- a provided compound is an optionally protected and/or activated amino acid or a salt thereof, wherein the side chain of the amino acid comprises an optionally protected and/or activated carboxyl group, and an optionally substituted ring or an amino group, wherein the optionally substituted ring or an amino group is between the optionally protected and/or activated carboxyl group and a backbone atom to which a side chain is attached (e.g., an atom between an amino and carboxyl group, both of which can be optionally and independently protected and/or activated (e.g., an alpha carbon atom in an amino acid)).
- the side chain of the amino acid comprises an optionally protected and/or activated carboxyl group, and an optionally substituted ring or an amino group, wherein the optionally substituted ring or an amino group is between the optionally protected and/or activated carboxyl group and a backbone atom to which a side chain is attached (e.g., an atom between an amino and carboxyl group, both of which
- the present disclosure provides compounds having the structure of formula PA: N(R PA )(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O)R PC , PA or a salt thereof, wherein: R PA is ⁇ H or an amino protecting group; each of R a1 and R a3 is independently ⁇ L a ⁇ R’; R a2 is ⁇ L aa ⁇ C(O)R PS ; each of L a , L a1 and L a2 is independently L; ⁇ C(O)R PS is optionally protected or activated ⁇ COOH; ⁇ C(O)R PC is optionally protected or activated ⁇ COOH; each L is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 25 aliphatic or heteroaliphatic group having 1-10 heteroatoms wherein one or more methylene units of the group are optionally and independently
- compounds having the structure of formula PA: N(R PA )(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O)R PC , PA or a salt thereof, wherein: R PA is ⁇ H or an amino protecting group; each of R a1 and R a3 is independently ⁇ L a ⁇ R’; R a2 is ⁇ L aa ⁇ C(O)R PS , wherein L aa is L and L aa comprises ⁇ N(R’) ⁇ or ⁇ Cy ⁇ ; each of L a1 and L a2 is independently L; ⁇ C(O)R PS is optionally protected or activated ⁇ COOH; ⁇ C(O)R PC is optionally protected or activated ⁇ COOH; each L is independently a covalent bond, or an optional
- L a1 is a covalent bond. In some embodiments, L a1 is not a covalent bond. [0555] In some embodiments, L a2 is a covalent bond. In some embodiments, L a2 is not a covalent bond.
- R a2 is ⁇ L aa ⁇ C(O)R PS , wherein L aa is an optionally substituted, bivalent C 1 -C 25 aliphatic or heteroaliphatic group having 1-10 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein at least one
- ⁇ Cy ⁇ is an optionally substituted bivalent 3-10 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) membered monocyclic cycloaliphatic group.
- ⁇ Cy ⁇ is an optionally substituted 3-10 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) membered monocyclic cycloalkyl ring.
- ⁇ Cy ⁇ is an optionally substituted 3-10 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) membered monocyclic heteroaliphatic ring having 1-5 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 3-10 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) membered monocyclic heteroalkyl ring having 1-5 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted bivalent 5-15 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) membered bicyclic or polycyclic cycloaliphatic group.
- ⁇ Cy ⁇ is an optionally substituted bivalent 5-15 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) membered bicyclic or polycyclic cycloalkyl group.
- ⁇ Cy ⁇ is an optionally substituted 5-15 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) membered bicyclic or polycyclic heteroaliphatic ring having 1-5 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 5-15 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) membered bicyclic or polycyclic heterocyclyl ring having 1-5 heteroatoms. In some embodiments, a cycloaliphatic, cycloalkyl, heteroaliphatic or heteroalkyl ring is 3-membered. In some embodiments, it is 4-membered. In some embodiments, it is 5-membered.
- ⁇ Cy ⁇ is optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent 10-membered bicyclic aryl ring. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 5-membered heteroaryl ring having 1-4 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 6-membered heteroaryl ring having 1-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 9-membered bicyclic heteroaryl ring having 1-5 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 10-membered bicyclic heteroaryl ring having 1-5 heteroatoms. In some embodiments, a heteroaliphatic, heterocyclyl or heteroaryl ring contains no more than 1 heteroatom. In some embodiments, each heteroatom is independently selected from nitrogen, oxygen and sulfur. [0558] In some embodiments, ⁇ Cy ⁇ is an optionally substituted 4-7 membered ring having 0-3 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 6-membered aryl ring. In some embodiments, an aryl ring is substituted. In some embodiments, it is substi or more halogen. In some embodiments, it is substituted with one or more ⁇ F. In s nts, it is not some embodiments, it is optionally substituted . I bodiments, it is n some embodiments, it is optionally substituted . odiments, it is . In some embodiments, it is optionally substituted . In some embodiments, it is . In some emb ⁇ is an optionally substituted 5-membere g having 1-3 heteroatoms. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. In some embodiments, ⁇ Cy ⁇ is optionally substituted . In some embodiments, ⁇ Cy ⁇ is . [0559] In some embodiments, L aa is ⁇ L am1 ⁇ Cy ⁇ L am2 ⁇ , wherein each of L am1 and L am2 is independently L am , wherein each L am is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N
- L aa comprises ⁇ Cy ⁇ .
- L aa is ⁇ L am1 ⁇ Cy ⁇ L am2 ⁇ , wherein each of L am1 and L am2 is independently L am , wherein each L am is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O)
- ⁇ L am2 ⁇ is bonded to ⁇ C(O)R PS .
- L am2 is a covalent bond.
- ⁇ Cy ⁇ is an optionally substituted 4-7 membered ring having 0-3 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 5-7 membered ring having 0-3 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 6-7 membered ring having 0-3 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 4-membered ring having 0-1 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted 5-membered ring having 0-2 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 6-membered ring having 0-2 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 7-membered ring having 0-3 heteroatoms.
- R a2 is ⁇ L aa ⁇ C(O)R PS , wherein L aa is an optionally substituted, bivalent C 1 -C 25 aliphatic or heteroaliphatic group having 1-10 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein at least one
- L aa comprises ⁇ N(R’) ⁇ .
- L aa is ⁇ L am1 ⁇ (NR’) ⁇ L am2 ⁇ , wherein each of L am1 and L am2 is independently L am , wherein each L am is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ ,
- ⁇ L am2 ⁇ is bonded to ⁇ C(O)R PS .
- L am1 is optionally substituted C 1-4 alkylene.
- L am1 is optionally substituted ⁇ (CH 2 )m ⁇ , wherein m is 1, 2, 3, or 4.
- L am1 is ⁇ CH 2 ⁇ .
- L am2 is optionally substituted linear C 1-2 alkylene.
- L am2 is ⁇ [C(R’) 2 ]n, wherein n is 1 or 2.
- L am2 is ⁇ [CHR’]n, wherein n is 1 or 2.
- each R’ is independently ⁇ H or optionally substituted C 1-6 alkyl.
- L am2 is optionally substituted ⁇ CH 2 ⁇ .
- L am2 is ⁇ CH 2 ⁇ .
- R’ is ⁇ R NR , wherein R NR is R.
- R’ is ⁇ CH 2 ⁇ R NR , wherein R NR is R.
- R’ of the ⁇ N(R’) ⁇ is ⁇ C(O)R NR , wherein R NR is R.
- R’ of the ⁇ N(R’) ⁇ is ⁇ SO 2 R NR , wherein R NR is R.
- R is optionally substituted C 1-6 aliphatic or heteroaliphatic having 1-4 heteroatoms.
- R NR is C 1-7 alkyl or heteroalkyl having 1-4 heteroatoms optionally substituted with one or more groups independently selected from halogen, a C 5-6 aromatic ring having 0-4 heteroatoms, and an optionally substituted 3-10 membered cycloalkyl or heteroalkyl ring having 1-4 heteroatoms.
- R is ⁇ CF 3 .
- L am2 is or comprises ⁇ C(R’) 2 ⁇ wherein the R’ group and R’ in ⁇ N(R’) ⁇ are taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms.
- L aa is ⁇ L am1 ⁇ N(R’) ⁇ L am2 ⁇ , wherein each of L am1 and L am2 is independently L am , wherein each L am is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) 2 N(
- ⁇ N(R’) ⁇ is bonded to two carbon atoms which two carbon atoms do not form any double bonds with heteroatoms. In some embodiments, ⁇ N(R’) ⁇ is bonded to two sp3 atoms. In some embodiments, ⁇ N(R’) ⁇ is bonded to two sp3 carbon atoms. In some embodiments, ⁇ N(R’) ⁇ is bonded to two ⁇ CH 2 ⁇ , each of which is independently and optionally substituted with one or two monovalent substituent. In some embodiments, ⁇ N(R’) ⁇ is bonded to two ⁇ CH 2 ⁇ . [0566] In some embodiments, L aa comprises ⁇ N(R’) ⁇ .
- R’ of the ⁇ N(R’) ⁇ is ⁇ R NR , wherein R NR is R. In some embodiments, R’ of the ⁇ N(R’) ⁇ is ⁇ CH 2 ⁇ R NR , wherein R NR is R, and the ⁇ CH 2 ⁇ is optionally substituted. In some embodiments, R’ of the ⁇ N(R’) ⁇ is ⁇ C(O)R NR , wherein R NR is R. In some embodiments, R’ of the ⁇ N(R’) ⁇ is ⁇ SO 2 R NR , wherein R NR is R. In some embodiments, ⁇ N(R’) ⁇ is ⁇ N(Et) ⁇ .
- ⁇ N(R’) ⁇ is ⁇ N(CH 2 CF 3 ) ⁇ .
- R’ is optionally substituted C 1-6 aliphatic or heteroaliphatic having 1-4 heteroatoms.
- R’ is C 1-7 alkyl or heteroalkyl having 1-4 heteroatoms, wherein the alkyl or heteroalkyl is optionally substituted with one or more groups independently selected from halogen, a C 5-6 aromatic ring having 0-4 heteroatoms, and an optionally substituted 3-10 membered cycloalkyl or heteroalkyl ring having 1-4 heteroatoms.
- R NR is ⁇ CF 3 .
- R’ of ⁇ N(R’) ⁇ is R, R a3 is R, and the two R groups are taken together with their intervening atoms to form an optionally substituted 3-10 membered ring having 0-5 heteroatoms in addition to the intervening atoms.
- a formed ring is 3-membered.
- a formed ring is 4-membered.
- a formed ring is 5- membered.
- a formed ring is 6-membered.
- a formed ring is 7-membered.
- a formed ring is monocyclic.
- a formed ring is bicyclic or polycyclic.
- a formed ring is saturated. In some embodiments, a formed ring is partially unsaturated.
- L am1 is a covalent bond. In some embodiments, L am1 is not a covalent bond. In some embodiments, L am1 is optionally substituted C 1-4 alkylene. In some embodiments, L am1 is optionally substituted ⁇ (CH 2 )m ⁇ , wherein m is 1, 2, 3, or 4. In some embodiments, L am1 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am1 is ⁇ CH 2 ⁇ . [0569] In some embodiments, L am2 is bonded to ⁇ C(O)R PS .
- L am2 is a covalent bond. In some embodiments, L am2 is a covalent bond when it is between ⁇ Cy ⁇ and ⁇ C(O)R PS . In some embodiments, L am2 is not a covalent bond. In some embodiments, L am2 is optionally substituted C 1-4 alkylene. In some embodiments, L am2 is optionally substituted ⁇ (CH 2 )m ⁇ , wherein m is 1, 2, 3, or 4. In some embodiments, L am2 is optionally substituted linear C 1-2 alkylene. In some embodiments, L am2 is ⁇ [C(R’) 2 ]n, wherein n is 1 or 2.
- L am2 is ⁇ [CHR’]n, wherein n is 1 or 2.
- each R’ is independently ⁇ H or optionally substituted C 1-6 alkyl.
- L am2 is optionally substituted ⁇ CH 2 ⁇ .
- L am2 is ⁇ CH 2 ⁇ .
- L am2 is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ .
- L am2 is ⁇ CH 2 ⁇ C(CH 3 ) 2 ⁇ .
- L am2 is or comprises ⁇ C(R’) 2 ⁇ wherein the R’ group and R’ in ⁇ N(R’) ⁇ of L aa are taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms.
- R a2 is ⁇ L aa ⁇ C(O)R PS , wherein L aa is L as described herein.
- L aa is L am2 as described herein.
- L aa is optionally substituted branched or linear C 1-10 hydrocarbon chain.
- L aa is optionally substituted C 1-10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) alkylene. In some embodiments, L aa is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L aa is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L aa is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L aa is ⁇ CH 2 ⁇ . [0573] In some embodiments, L a is L aa as described herein. [0574] In some embodiments, L aa is L a as described herein.
- each L is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 25 aliphatic or heteroaliphatic group having 1-10 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L is a covalent bond.
- L (or L a , L aa , L a1 , L a2 , L s1 , L s2 , L s3 , or another variable or moiety that can be L, or a linker moiety) is an optionally substituted, bivalent C 1 -C 25 , C 1 -C 20 , C 1 -C 15 , C 1 -C 10 , C 1 -C 9 , C 1 -C 8 , C 1 -C 7 , C 1 -C 6 , C 1 -C 5 , C 1 -C 4 , C 1 -C 3 , C 1 -C 2 , or C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 ,
- L is an optionally substituted, bivalent C 1 - C 25 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L, L a , L aa , L a1 , L a2 , L s1 , L s2 , L s3 , L”, or another variable or moiety that can be L, or a linker moiety is an optionally substituted, bivalent C 1 -C 25 , C 1 -C 20 , C 1 -C 15 , C 1 -C 10 , C 1 -C 9 , C 1 -C 8 , C 1 -C 7 , C 1 -C 6 , C 1 -C 5 , C 1 -C 4 , C 1 -C 3 , C 1 -C 2 , or C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 ,
- it is an optionally substituted, bivalent C 1 - C 10 , C 1 -C 9 , C 1 -C 8 , C 1 -C 7 , C 1 -C 6 , C 1 -C 5 , C 1 -C 4 , C 1 -C 3 , C 1 -C 2 , or C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , or C 10 , aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C
- it is an optionally substituted, bivalent C 2 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- it is an optionally substituted, bivalent C 3 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- it is an optionally substituted, bivalent C 4 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- it is an optionally substituted, bivalent C 5 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- it is an optionally substituted, bivalent C 6 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the bivalent aliphatic is saturated. In some embodiments, the bivalent aliphatic is linear. In some embodiments, the bivalent aliphatic is branched. In some embodiments, it is an optionally substituted, bivalent linear saturated C 6 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- each replacement if any is independently with ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- each replacement if any is independently with ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- each replacement if any is independently with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ . In some embodiments, each replacement if any is independently with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- L, L a , L aa , L a1 , L a2 , L s1 , L s2 , L s3 , L is an optionally substituted, bivalent C 1 -C 6 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is an optionally substituted, bivalent C 1 -C 5 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is an optionally substituted, bivalent C 1 -C 4 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is an optionally substituted, bivalent C 1 - C 3 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is an optionally substituted, bivalent C 1 -C 2 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is a bivalent C 1 - C 6 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ . In some embodiments, it is a bivalent C 1 -C 5 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is a bivalent C 1 -C 4 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is a bivalent C 1 -C 3 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- it is a bivalent C 1 -C 2 linear saturated aliphatic wherein one or more methylene units is optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , or ⁇ C(O) ⁇ .
- R’ in each moiety that is utilized to replace a methylene unit (e.g., ⁇ N(R’) ⁇ ) as described herein is hydrogen or optionally substituted C 1-6 aliphatic or phenyl.
- R’ is each such moiety is hydrogen or optionally substituted C 1-6 alkyl. In some embodiments, R’ is each such moiety is hydrogen or C 1-6 alkyl. In some embodiments, each ⁇ Cy ⁇ is optionally substituted bivalent ring selected from 3-10, 3-9, 3-8, 3-7, 5-10, 5- 9, 5-8, 5-7, 5-6, or 3, 4, 5, 6, 7, 8, 9, or 10 membered cycloaliphatic and heterocyclylene having 1-3 heteroatoms, phenylene, and 5-6 membered heteroarylene having 1-3 heteroatoms.
- ⁇ Cy ⁇ is optionally substituted bivalent 3-10, 3-9, 3-8, 3-7, 5-10, 5-9, 5-8, 5-7, 5-6, or 3, 4, 5, 6, 7, 8, 9, or 10 membered cycloaliphatic. In some embodiments, ⁇ Cy ⁇ is optionally substituted 3-10, 3-9, 3-8, 3-7, 5-10, 5-9, 5-8, 5-7, 5-6, or 3, 4, 5, 6, 7, 8, 9, or 10 membered heterocyclylene having 1-3 heteroatoms.
- ⁇ Cy ⁇ is optionally substituted 3-10, 3-9, 3-8, 3-7, 5-10, 5-9, 5-8, 5- 7, 5-6, or 3, 4, 5, 6, 7, 8, 9, or 10 membered heterocyclylene having 1 heteroatom.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is phenylene.
- ⁇ Cy ⁇ is optionally substituted 5-6 membered heteroarylene having 1-3 heteroatoms.
- ⁇ Cy ⁇ is optionally substituted 5-6 membered heteroarylene having 1 heteroatom.
- a heteroatom is nitrogen.
- a heteroatom is oxygen.
- a heteroatom is sulfur.
- L, L a , L aa , L aa , L a1 , L a2 , L s1 , L s2 , L s3 , L”, or another variable or moiety that can be L, or a linker moiety is optionally substituted ⁇ (CH 2 )n ⁇ . In some embodiments, it is ⁇ (CH 2 )n ⁇ .
- n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8.
- n is 9. In some embodiments, n is 10. [0579]
- L, L a , L aa , L a1 , L a2 , L s1 , L s2 , L s3 , L”, or another variable or moiety that can be L, or a linker moiety is an optionally substituted, bivalent heteroaliphatic group having 1-10 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) ⁇ , ⁇ S(
- each R’ is independently ⁇ R, ⁇ C(O)R, ⁇ CO 2 R, or ⁇ SO 2 R.
- R’ is ⁇ L a ⁇ R. In some embodiments, R’ is R.
- R’ is ⁇ C(O)R. In some embodiments, R’ is ⁇ CO 2 R. In some embodiments, R’ is ⁇ SO 2 R. In some embodiments, R’ is ⁇ H.
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms, 5-30 membered heteroaryl having 1-10 heteroatoms, and 3- 30 membered heterocyclyl having 1-10 heteroatoms, or two R groups are optionally and independently taken together to form a covalent bond, or two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatoms;
- R is ⁇ H. In some embodiments, R is not ⁇ H. In some embodiments, R is optionally substituted C 1-10 aliphatic. In some embodiments, R is optionally substituted C 1-10 alkyl. In some embodiments, R is methyl. In some embodiments, R is ethyl. In some embodiments, R is isopropyl. In some embodiments, R is ⁇ CF 3 . In some embodiments, R is ⁇ CH 2 CF 3 . In some embodiments, R is butyl. In some embodiments, R is t-butyl. In some embodiments, R is optionally substituted C 3-10 cycloaliphatic.
- R is optionally substituted C 3-10 cycloalkyl. In some embodiments, R is optionally substituted cyclopropyl. In some embodiments, R is optionally substituted cyclobutyl. In some embodiments, R is optionally substituted cyclopentyl. In some embodiments, R is optionally substituted cyclohexyl. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1-3 heteroatoms. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1 heteroatom.
- R is optionally substituted 6- membered heteroaryl having 1-3 heteroatoms. In some embodiments, R is optionally substituted 6- membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted bicyclic 8- 10 membered aromatic ring having 0-5 heteroatoms. In some embodiments, R is optionally substituted bicyclic 9-membered aromatic ring having 1-5 heteroatoms. In some embodiments, R is optionally substituted bicyclic 10-membered aromatic ring having 1-5 heteroatoms. In some embodiments, R is optionally substituted bicyclic 9-membered aromatic ring having 1 heteroatom. In some embodiments, R is optionally substituted bicyclic 10-membered aromatic ring having 1 heteroatom.
- R is optionally substituted bicyclic 10-membered aromatic ring having no heteroatom. In some embodiments, R is optionally substituted 3-10 membered heterocyclyl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 5-14 membered bicyclic heterocyclyl having 1-5 heteroatoms.
- two R groups (or two groups that can be R, e.g., two groups each independently selected from R’, R a1 , R a2 , R a3 , R a5 , R RN , etc.) are taken together with their intervening atom(s) to form an optionally substituted 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatoms.
- a formed ring is substituted.
- a formed ring is unsubstituted.
- a formed ring is 3-30, 3-20, 3-15, 3- 10, 3-9, 3-8, 3-7, 3-6, 4-10, 4-9, 4-8, 4-7, 4-6, 5-10, 5-9, 5-8, 5-7, 5-6, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 membered.
- a formed ring is 3-10 membered.
- a formed ring is 3-7 membered.
- a formed ring is 4-10 membered.
- a formed ring is 4-7 membered.
- a formed ring is 5-10 membered.
- a formed ring is 5-7 membered. In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4-membered. In some embodiments, a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered. In some embodiments, a formed ring is 7-membered. In some embodiments, a formed ring is 8-membered. In some embodiments, a formed ring is 9-membered. In some embodiments, a formed ring is 10-membered. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is bicyclic.
- a formed ring is polycyclic. In some embodiments, a formed ring has no heteroatoms in addition to the intervening atom(s). In some embodiments, a formed ring has 1-10, e.g., 1-5, 1-3, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 heteroatoms in addition to the intervening atom(s). In some embodiments, a formed ring is saturated. In some embodiments, a formed ring is partially unsaturated. In some embodiments, a formed ring comprises one or more aromatic ring. In some embodiments, a formed ring is bicyclic or polycyclic, and each monocyclic unit is independently 3-10 membered, saturated, partially unsaturated or aromatic and having 0-5 heteroatoms.
- each heteroatom is independently selected from nitrogen, oxygen and sulfur.
- a group that can be R e.g., R’, R a1 , R a2 , R a3 , R a5 , R RN , etc., is R as described herein. Those skilled in the art appreciate that embodiments described for one group that can be R may also be utilized for another group that can be R to the extent that such embodiments fall within the definition of R.
- the present disclosure rovides com ounds having the structure of PA-a or a salt thereof, wherein: each of m and n is independently 1, 2, 3, or 4; L RN is L; R RN is R; and R a5 is R’.
- m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 4.
- n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. [0589] In some embodiments, L RN is ⁇ CH 2 ⁇ , ⁇ CO ⁇ , or ⁇ SO 2 ⁇ .
- L RN is ⁇ CH 2 ⁇ . In some embodiments, L RN is ⁇ CO ⁇ . In some embodiments, L RN is ⁇ SO 2 ⁇ . In some embodiments, L RN is optionally substituted bivalent C 1-4 alkylene. In some embodiments, L RN is optionally substituted bivalent linear C 1-4 alkylene. In some embodiments, L RN is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L RN is ⁇ CH 2 ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L RN is ⁇ C(CH 3 ) ⁇ . [0590] In some embodiments, R RN is R as described herein.
- R RN is C 1-7 alkyl or heteroalkyl having 1-4 heteroatoms, wherein the alkyl or heteroalkyl is optionally substituted with one or more groups independently selected from halogen, a C 5-6 aromatic ring having 0-4 heteroatoms, and an optionally substituted 3-10 membered cycloalkyl or heteroalkyl ring having 1-4 heteroatoms.
- R e.g., R RN , R’, etc.
- R is optionally substituted aliphatic, e.g., C 1-10 aliphatic.
- R is optionally substituted alkyl, e.g., C 1-10 alkyl.
- R is optionally substituted cycloalkyl, e.g., C 1-10 cycloalkyl. In some embodiments, R is optionally substituted aryl. In some embodiments, R is optionally substituted heterocyclyl. In some embodiments, R is optionally substituted heteroaryl. In some embodiments, is methyl. In some embodiments, R is ⁇ CF 3 . In some embodiments, R is ethyl. In some embodiments, R is . In some embodiments, R is phenyl. In some embodiments, R is pentafluorophenyl. In some embodiments, R is pyridinyl. [0592] In some embodiments, one or more R a5 are independently –H.
- one or more R a5 are independently optionally substituted C 1-6 alkyl. In some embodiments, each R a5 is ⁇ H. [0593] In some embodiments, ⁇ L RN ⁇ R RN is R, and is taken together with a R a5 and their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms.
- various rings including those in various moieties (e.g., R or various groups that can be R, various bivalent rings such as those in ⁇ Cy ⁇ ) and those formed by two entities (e.g., two groups that are or can be R) taken together with their intervening forms, can be various sizes, e.g., 3-30.
- a ring is 3-30-membered.
- a ring is 3-20 membered.
- a ring is 3-10 membered.
- a ring is e.g., 3, 4, 5, 6, 7, 8, 9, or 10-membered.
- a ring is 3-membered.
- a ring is 4-membered. In some embodiments, a ring is 5-membered. In some embodiments, a ring is 6- membered. In some embodiments, a ring is 7-membered. In some embodiments, a ring is 8-membered. In some embodiments, a ring is 9-membered. In some embodiments, a ring is 10-membered. In some embodiments, a ring is substituted (in addition to potential groups already drawn out in formulae). In some embodiments, a ring is not substituted. In some embodiments, a ring is saturated. In some embodiments, a ring is partially unsaturated. In some embodiments, a ring is aromatic.
- a ring comprise one or more, e.g., 1-5, heteroatoms.
- one or more heteroatoms are oxygen.
- one or more heteroatoms are nitrogen.
- one or more heteroatoms are sulfur.
- a ring is a cycloaliphatic, e.g., cycloalkyl ring.
- a ring is a heterocycloaliphatic, e.g., heterocycloalkyl ring.
- a ring is an aryl ring.
- a ring is a heteroaryl ring.
- a ring is a heteroaryl ring.
- a ring is monocyclic. In some embodiments, a ring is bicyclic or polycyclic. In some embodiments, each monocyclic unit in a ring is independently an optionally substituted, 3-10 membered (e.g., 3, 4, 5, 6, 7, 8, 9, or 10-membered) , saturated, partially unsaturated or aromatic ring having 0-5 heteroatoms.
- a heteroatom is selected from nitrogen, oxygen, sulfur, silicon and phosphorus. As described herein, in some embodiments, a heteroatom is selected from nitrogen, oxygen, and sulfur.
- R a1 is ⁇ H.
- R a1 is optionally substituted C 1-6 alkyl. In some embodiments, R a1 are taken together with another group, e.g., R a3 and their intervening atoms to form an optionally substituted ring as described herein.
- ⁇ C(O)R PC is a protected carboxylic acid group. In some embodiments, ⁇ C(O)R PC is an activated carboxylic acid group.
- ⁇ C(O)R PC is an ester.
- ⁇ C(O)R PC is an activated ester for synthesis. In some embodiments, ⁇ C(O)R PC is ⁇ C(O)OR’. In some embodiments, R’ is R. In some embodiments, R’ is optionally substituted C 1-10 aliphatic. In some embodiments, R’ optionally substitute some embodiments, R’ is pentafluorophenyl. In some embodiments, R’ is . [0598] In some embodiments, ⁇ C(O)R PC is ⁇ COOH. [0599] In some embodiments, ⁇ C(O)R PS is a protected carboxylic acid group.
- ⁇ C(O)R PS is an activated carboxylic acid group if it is to be reacted with another moiety.
- ⁇ C(O)R PS is an ester.
- ⁇ C(O)R PS is an ester.
- ⁇ C(O)R PS is ⁇ C(O)OR’.
- R’ is R.
- R is optionally substituted C 1-10 aliphatic.
- R optionally substituted phenyl.
- R is optionally substituted t-Bu. In some embodiments, R is t- Bu. In some embodiments, R is benzyl. In some embodiments, R is allyl. In some embodiments, ⁇ C(O)R PS is a protected carboxylic acid group that is compatible with peptide synthesis (e.g., Fmoc-based peptide synthesis).
- ⁇ C(O)R PS is a protected carboxylic acid group which is orthogonal to ⁇ C(O)R PC and R PA , and remains intact when ⁇ C(O)R PC and/or N(R PA )(R a1 ) are protected, deprotected, and/or reacted (e.g., in peptide synthesis such as Fmoc-based peptide synthesis).
- ⁇ C(O)R PS is deprotected at a late stage during synthesis, e.g., after a peptide backbone is or is largely constructed such that an unprotected side chain ⁇ COOH does not impact synthesis.
- ⁇ C(O)R PS is ⁇ COOH.
- R PA is ⁇ H or an amino protecting group.
- R PA is – H.
- R PA is an amino protecting group.
- R PA is an amino protecting group suitable for peptide synthesis.
- R PA is ⁇ C(O) ⁇ O ⁇ R, wherein R is optionally substituted .
- R PA is ⁇ Fmoc.
- R PA is –Cbz.
- R PA is ⁇ Boc.
- R PS is a protecting group orthogonal to R PA .
- R PS is a protecting group orthogonal to R PC . In some embodiments, R PS is compatible with peptide synthesis. In some embodiments, R PS is optionally substituted C 1-6 aliphatic. In some embodiments, R PS is t-butyl. [0603] In some embodiments, R PS is ⁇ S ⁇ L ⁇ R’, wherein each variable is independently as described herein. In some embodiments, L is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, R PS is ⁇ S ⁇ CH 2 ⁇ R’, wherein R’ is as described herein. In some embodiments, R’ is R as described herein.
- R is optionally substituted C 6-30 aryl. In some embodiments, R is optionally substituted C 6-10 aryl. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is substituted phenyl wherein one or more substituents are independently alkoxy. In some embodiments, R is 2, 4, 6-trimethoxyphenyl. In some embodiments, R is optionally substituted 5-30 membered heteroaryl having 1-10 heteroatoms. In some embodiments, R is optionally substituted 5-10 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms.
- R PS is ⁇ S ⁇ CH 2 ⁇ Cy ⁇ R’, wherein the ⁇ CH 2 ⁇ is optionally substituted, and ⁇ Cy ⁇ is as described herein.
- R PS is ⁇ S ⁇ CH 2 ⁇ Cy ⁇ O ⁇ R’, wherein the ⁇ CH 2 ⁇ is optionally substituted, and ⁇ Cy ⁇ is as described herei ptionally substituted aromatic ring.
- ⁇ Cy n some embodiments, ⁇ Cy ⁇ is 2, 6-dimethoxy-1, 4-phenylene. In imethoxy-1, 3- phenylene.
- R PS is R PS is ⁇ SH. [0604]
- R a2 is . In some embodiments, R a2 is . In some embodiments, R a2 is
- a provided compound e.g., an amino acid is selected from: [0606]
- R a2 is R a2 in a compound described above (a non-hydrogen group attached to an alpha carbon).
- the present disclosure provides compounds having the structure of: or a salt thereof, wherein:
- Ring A is an optionally substituted 3-10 membered ring; n is 0-6; m is 0-6.
- n is 0. In some embodiments, m is 1-6.
- the present disclosure provides compounds having the structure of: or a salt thereof, wherein:
- Ring A is an optionally substituted 3-10 membered ring; n is 0-6; and m is 0-6.
- n is 0. In some embodiments, m is 1-6.
- the present disclosure provides compounds having the structure of: or a salt thereof, wherein: Ring A is an optionally substituted 3-10 membered ring; and n is 0-6.
- n is 0. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 0, 1, or 2. [0613] In some embodiments, m is 0. In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 4. In some embodiments, m is 5.
- Ring A is a ring as described herein. In some embodiments, Ring A is 3-membered. In some embodiments, Ring A is 4-membered. In some embodiments, Ring A is 5- membered. In some embodiments, Ring A is 6-membered. In some embodiments, Ring A is 7- membered. In some embodiments, Ring A is 8-membered. In some embodiments, Ring A is 9- membered. In some embodiments, Ring A is 10-membered. In some embodiments, Ring A is saturated. In some embodiments, Ring A is partially unsaturated. In some embodiments, Ring A is aromatic.
- Ring A has no additional heteroatoms in addition to the nitrogen atom. In some embodiments, Ring is unsubstituted. In some embodiments, Ring A is substituted with one or more halogen. In some embodiments, Ring A is substituted with one or more ⁇ F. In some embodiments, Ring A has a carbon substituted with two ⁇ F. In some embodiments, ⁇ C(O)R PS is at 2’-position (N being position 1). In some embodiments, ⁇ C(O)R PS is at 3’-position. In some embodiments, ⁇ C(O)R PS is at 4’- position.
- ⁇ C(O)R PS is attached to a chiral center, e.g., a chiral carbon atom.
- a chiral center is R.
- a chiral center is S.
- Ring A is bonded to ⁇ (CH 2 )n ⁇ at a chiral carbon which is R.
- Ring A is bonded to ⁇ (CH 2 )n ⁇ at a chiral carbon which is S.
- ⁇ (CH 2 )n ⁇ is at position 2 (the N is at position 1).
- ⁇ (CH 2 )n ⁇ is at position 3 (the N is at position 1).
- ⁇ (CH 2 )n ⁇ is at position 4 (the N is at position 1).
- Ring A is substituted.
- substituents on Ring A are of suitable properties, e.g., volumes, for various utilizations.
- substituents are independently selected from halogen, ⁇ R, ⁇ CF 3 , ⁇ N(R) 2 , ⁇ CN, and ⁇ OR, wherein each R is independently C 1-6 aliphatic optionally substituted with one or more ⁇ F.
- substituents are independently selected from halogen, C 1-5 linear, branched or cyclic alkyl, ⁇ OR wherein R is C 1-4 linear, branched or cyclic alkyl, fluorinated alkyl, ⁇ N(R) 2 wherein each R is independently C 1-6 linear, branched or cyclic alkyl, or ⁇ CN.
- substituents are selected from halogen, a C 5-6 aromatic ring having 0-4 heteroatoms, and an optionally substituted 3-10 membered cycloalkyl or heteroalkyl ring having 1-4 heteroatoms.
- a substituent is halogen. In some embodiments, it is ⁇ F.
- a substituent is optionally substituted C 1-4 alkyl. In some embodiments, a substituent is C 1-4 alkyl. In some embodiments, it is methyl. In some embodiments, it is ethyl. In some embodiments, it is i-Pr. In some embodiments, a substituent is C 1-4 haloalkyl. In some embodiments, a substituent is C 1-4 alkyl optionally substituted with one or more ⁇ F. In some embodiments, it is ⁇ CF 3 . In some embodiments, it is ⁇ CN.
- Ring A is or comprises an optionally substituted saturated monocyclic ring. In some embodiments, Ring A is or comprises an optionally substituted partially unsaturated monocyclic ring. In some embodiments, Ring A is or comprises an optionally substituted aromatic monocyclic ring.
- Ring A is optionally substituted phenyl. In some embodiments, Ring A is optionally substituted 5-6 membered heteroaryl having 1-3 heteroatoms. In some embodiments, Ring A is optionally substituted 5-6 membered heteroaryl having 1-3 heteroatoms, wherein at least one heteroatom is nitrogen. In some embodiments, Ring A is an optionally substituted 8-10 membered bicyclic ring having 1-6 heteroatoms. In some embodiments, Ring A is an optionally substituted 8-10 membered bicyclic aromatic ring having 1-6 heteroatoms, wherein each monocyclic unit is independently an optionally 5-6 membered aromatic ring having 0-3 heteroatoms.
- Ring A is bonded to ⁇ (CH 2 )n ⁇ at a carbon atom. In some embodiments, Ring A is bonded to ⁇ (CH 2 )n ⁇ at a nitrogen atom. In some embodiments, Ring A or ⁇ Cy ⁇ in L aa is optionally substituted, and each substitute is independently selected from halogen, ⁇ R, ⁇ CF 3 , ⁇ N(R) 2 , ⁇ CN, and ⁇ OR, wherein each R is independently C 1-6 aliphatic optionally substituted with one or more ⁇ F.
- Ring A or ⁇ Cy ⁇ in L aa is optionally substituted, and each substitute is independently selected from halogen, C 1-5 linear, branched or cyclic alkyl, ⁇ OR wherein R is yclic alkyl, fluorinated alkyl, ⁇ N(R) 2 wherein each R is independently C 1-6 alkyl, or ⁇ CN.
- Ring A is optionally substit odiments, the present disclosure provides a compound of formula or a salt thereof, wherein Ring A is optionally substituted phenyl, and each variable is as described herein.
- the present disclosure provides compounds having the structure of or a salt thereof, wherein each variable is independent as described herein.
- each variable is independent as described herein.
- e b di h di l vides compounds having the structure of or a salt thereof, wherein each variable is independent as described herein.
- Ring A is an optionally substituted 5- or 6-membered heteroaryl h s.
- a provided compound has the structure of , wherein Z is carbon or a heteroatom, Ring Het is an optionally substituted 5- or 6- membered heteroaryl having 1-4 heteroatoms, and each other variable is independently as described herein.
- a provided compound is selected from:
- Ring A is a 8-10 membered bicyclic aryl or a heteroaryl ring having 1- 5 heteroatoms. In some embodiments, Ring A is a 10-membered bicyclic aryl ring. In some embodiments, Ring A is a 8-membered bicyclic heteroaryl ring having 1-5 heteroatoms. In some embodiments, Ring A is a 9-membered bicyclic heteroaryl ring having 1-5 heteroatoms. In some embodiments, Ring A is a 10-membered bicyclic heteroaryl ring having 1-5 heteroatoms. In some embodiments, Ring A is an optionally substituted 5- or 6-membered heteroaryl having 1-4 heteroatoms.
- a provided compound has the structure wherein each of
- Ring rl and r2 is independently an optionally substituted 5- or 6-membered aryl or heteroaryl ring having
- a provided compound has the structure , wherein Z is carbon or a heteroatom, each of Ring rl and r2 is independently an optionally substituted 5- or 6-membered aryl or heteroaryl ring having 1-4 heteroatoms, and each other variable is independently as described herein.
- a provided compound is selected from:
- the present disclosure provides a compound of structure salt thereof.
- -C(0)R PS is -C(0)-0tBu.
- the present disclosure provides a compound of structure salt thereof, wherein each variable is independently as described herein.
- a provided compound is selected from: [0625] In m mb dim nt th r nt di l r r id m nd h in th tr t r f [0627]
- a provided compound is an amino acid.
- a provided compound is a protected amino acid.
- a provided compound is a protected and/or activated amino acid.
- a provided compound is suitable for [0628]
- a ring moiety of, e.g., ⁇ Cy ⁇ , R (including those formed by R groups taken together), etc. is monocyclic.
- a ring moiety is bicyclic or polycyclic.
- a monocyclic ring is an optionally substituted 3-10 (3, 4, 5, 6, 7, 8, 9, or 10, 3-8, 3-7, 4-7, 4-6, 5-6, etc.) membered, saturated, partially unsaturated or aromatic ring having 0-5 heteroatoms.
- each monocyclic ring unit of a bicyclic or polycyclic ring moiety is independently an optionally substituted 3-10 (3, 4, 5, 6, 7, 8, 9, or 10, 3-8, 3-7, 4-7, 4-6, 5-6, etc.) membered, saturated, partially unsaturated or aromatic ring having 0-5 heteroatoms.
- each heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each heteroatom is independently selected from oxygen, nitrogen, and sulfur.
- L a1 is a covalent bond.
- a compound of formula PA is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a2 is a covalent bond.
- a compound of formula PA is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a1 is a covalent bond and L a2 is a covalent bond.
- a compound of formula PA is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- an amino acid is suitable for stapling.
- an amino acid comprises a terminal olefin.
- an amino acid has the structure of NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L aa ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ COOH, or a salt thereof, wherein each variable is independently as described in the present disclosure.
- L aa is ⁇ L am1 ⁇ N(R’) ⁇ L am2 ⁇ , wherein each variable is as described herein.
- each of L am1 and L am2 is optionally substituted bivalent C 1-6 aliphatic.
- each of L am1 and L am2 is bivalent C 1-6 aliphatic.
- each of L am1 and L am2 is optionally substituted bivalent C 1-6 alkyl.
- each of L am1 and L am2 is bivalent C 1-6 alkyl.
- each of L am1 and L am2 is optionally substituted bivalent linear C 1-6 alkyl.
- each of L am1 and L am2 is bivalent linear C 1-6 alkyl.
- L am1 is ⁇ CH 2 ⁇ .
- L am2 is a covalent bond.
- L am2 is ⁇ CH 2 ⁇ .
- both L am1 and L am2 are ⁇ CH 2 ⁇ .
- L am1 is ⁇ CH 2 ⁇ and L am2 is a covalent bond.
- ⁇ N(R’) ⁇ is ⁇ N(Et) ⁇ .
- ⁇ N(R’) ⁇ is ⁇ N(CH 2 CF 3 ) ⁇ .
- L aa is ⁇ L am1 ⁇ Cy ⁇ L am2 ⁇ , wherein each variable is as described herein.
- ⁇ uted phenyl.
- ⁇ Cy ⁇ is optionally substituted 5-6 memb 4 heteroatoms.
- a compo und is (2COOHF) or a salt thereof.
- a compound is (3COOHF) or a salt thereof.
- a compound is (TfeGA) or a salt thereof.
- a compound is or a salt thereof.
- a compound e.g., a peptide, comprising a residue of a compound of formula PA or a salt form thereof.
- a residue has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or a salt form thereof, wherein each variable is independently as described herein.
- a residue has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L aa ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or a salt form thereof, wherein each variable is independently as described herein.
- a salt form thereof In some embodim or a salt form thereof. In some embo or a salt form thereof. In some embod or a salt form thereof. In some embodiments, a lt form thereof. In some embodiments, a residue is O N m thereof. In some embodiments, a residue is ereof. In some embodiments, a residue is or a salt form thereof. In some embodiments, a residue is or a salt form thereof.
- a residue is or a salt form thereof.
- an amino acid, or a structure moiety of an amino acid or an agent e.g., a peptide
- an amino acid, or a structure moiety of an amino acid or an agent is selected from below. Brackets indicate that a moie R 3 N H amino acid, for instance, for a Lys with a bracket moiety O , a bracket moiety would replace R 3 (when there is no bracket preceding an amino acid, e.g., Lys, then R 3 is hydrogen).
- R 1 is the N-term (and connects to the carboxylate of the previous amino acid residue, or a N-terminal cap, or is ⁇ H for an amino acid).
- R 2 is the C-term (and connects to the N-term of the next amino acid residue, or a C-terminal group, or is ⁇ OH for an amino acid).
- R 3 indicates a potential bracket moiety (or is H if no moiety is indicated).
- a compound has a structure selected from the table above, wherein R 1 is ⁇ OH. In some embodiments, a compound has a structure selected from the table above, wherein R 1 is an amino protection group, e.g., Fmoc, tBoc, etc. In some embodiments, a compound has a structure selected from the table above, wherein R 1 is an amino protecting group, e.g., Fmoc, tBoc, etc., and R 2 is ⁇ OH, or ⁇ COR 2 is an optionally substituted, protected or activated carboxyl group. In some embodiments, R 2 is ⁇ OH.
- an amino acid residue has a structure selected from the table above, wherein each of R 1 and R 2 independently represents a connection site (e.g., for structure , the residue is of the structure ).
- an agent, a peptide or a stapled peptide comprises such an amino acid residue.
- a peptide comprises one or more residues of amino acids selected from the Table above.
- a peptide comprises one or more residues of TfeGA.
- a peptide comprises one or more residues of 2COOHF.
- a peptide comprises one or more residues of 3COOHF.
- the present disclosure provides peptides, including stapled peptides, comprising residues of amino acids described herein.
- the present disclosure provides various methods comprising utilizing amino acids, optionally protected and/or activated, as described herein.
- the present disclosure provides methods for preparing peptides, comprising utilizing amino acids, typically protected and/or activated, as described herein.
- various amino groups are Fmoc protected for peptide synthesis (particularly for forming backbone peptide bonds).
- various side chain carboxylic acid groups are t- Bu protected ( ⁇ C(O) ⁇ O ⁇ tBu).
- the present disclosure provides methods, comprising replacing one or more acidic amino acid residues, e.g., Asp, Glu, etc., in a first compound, each independently with a provided amino acid residue, e.g., TfeGA, 2COOHF, 3COOHF, etc., to provide a second compound.
- each of the first and second compounds is independently or independently comprises a peptide.
- a second compound provides improved properties and/or activities (e.g., lipophilicity, LogD, etc.) compared to a first compound.
- a second compound provides, in addition to improved properties such as lipophilicity, one or more comparable or improved other properties and/or activities (e.g., solubility and/or target binding) compared to a first compound.
- an agent e.g., a peptide, a stapled peptide, a stitched peptide, etc.
- an agent is less than about 5000 Daltons in mass.
- an agent is greater than or equal to about 900 Daltons and less than about 5000 Daltons in mass.
- an agent is greater than or equal to about 1500 Daltons and less than about 5000 Daltons in mass.
- an agent is greater than or equal to about 2000 Daltons and less than about 5000 Daltons in mass. In some embodiments, an agent is greater than or equal to about 2500 Daltons and less than about 5000 Daltons in mass. In some embodiments, an agent is greater than or equal to about 1000 Daltons and less than about 3000 Daltons in mass. In some embodiments, an agent is greater than or equal to about 1500 Daltons and less than about 3000 Daltons in mass. In some embodiments, an agent is greater than or equal to about 1500 Daltons and less than about 2500 Daltons in mass. In some embodiments, an agent is greater than or equal to about 1600 Daltons and less than about 2200 Daltons in mass. In some embodiments, the agent is no more than about 900 Daltons in mass.
- an agent is no more than about 500 Daltons in mass. In some embodiments, an agent is no more than about 300 Daltons in mass. In some embodiments, an agent is no more than about 200 Daltons in mass. Characterization [0644] In some embodiments, agents, e.g., peptides, are characterized with respect to, for example, one or more characteristics such as binding characteristics – e.g., with respect to a particular target of interest (e.g., beta-catenin or a portion thereof), stability characteristics, for example in solution or in dried form, cell permeability characteristics, solubility, lipophilicity, etc.
- characteristics such as binding characteristics – e.g., with respect to a particular target of interest (e.g., beta-catenin or a portion thereof), stability characteristics, for example in solution or in dried form, cell permeability characteristics, solubility, lipophilicity, etc.
- a binding characteristic may be or comprise specificity, affinity, on- rate, off-rate, etc, optionally under (or over a range of) specified conditions such as, for example, concentration, temperature, pH, cell type, presence or level of a particular competitor, etc.
- assessments of characteristics as described herein may involve comparison with an appropriate reference (e.g., a positive or negative control) which may, in some embodiments, be a contemporaneous reference or, in some embodiments, a historical reference.
- desirable characteristics may be, for example: binding to a desired target (e.g., a dissociation constant (K D ) of at least less than about 1 ⁇ M, and preferably a K D of less than about 50 nM); cell penetration (e.g., as measured by fluorescence-based assays or mass spectrometry of cellular fractions, etc.); solubility (e.g., soluble at less than about 1000 uM agent, or soluble at less than about 500 uM agent, or soluble at less than about 100 uM agent, or less than about 50 uM, or less than about 35 uM); activity (e.g., modulating one or more functions of a target, which may be assessed in a cellular reporter assay (e.g., with an IC50 of less than a concentration, e.g., less than about 1 ⁇ M, less than about 500 nM, less than about 50 nM, less than about 10 nM, etc.),
- K D dissociation constant
- an agent of the invention comprises an affinity of less than about 10 nM, for example, an IC50 of 7 nM).
- provided agents can bind to targets, e.g., beta-catenin, with an EC 50 of no more than about 2000 nM.
- an EC50 is no more than about 1500 nM.
- an EC50 is no more than about 1000 nM.
- an EC50 is no more than about 500 nM.
- an EC50 is no more than about 300 nM.
- an EC50 is no more than about 200 nM.
- an EC50 is no more than about 100 nM. In some embodiments, an EC50 is no more than about 75 nM. In some embodiments, an EC50 is no more than about 50 nM. In some embodiments, an EC50 is no more than about 25 nM. In some embodiments, an EC50 is no more than about 10 nM. In some embodiments, an EC50 is no more than about 5 nM. In some embodiments, an EC50 is measured by fluorescence polarization as described in the Examples. [0649] In some embodiments, the present disclosure provides agents, e.g., stapled peptides, with suitable solubility for various purposes.
- solubility of provided agents is about or at least about 5-100 uM (e.g., about or at least about 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 uM). In some embodiments, solubility is about or at least about 25 uM. In some embodiments, solubility is about or at least about 30 uM. In some embodiments, solubility is about or at least about 40 uM. In some embodiments, solubility is about or at least about 50 uM.
- provided agents are protein bound in serum; in some embodiments, they are at least about 85%, 90%, or 95% protein bound in serum. In some embodiments, provided agents are over 95% protein bound in serum.
- provided agents can traverse a cell membrane of an animal cell. In some embodiments, provided agents can traverse a cell membrane of a human cell.
- provided agents can bind to motifs, residues, or polypeptides. In some embodiments, provided agents bind to beta-catenin. In some embodiments, a dissociation constant (K D ) is about 1 nM to about 1 uM.
- a K D is no more than about 1 uM. In some embodiments, a K D is no more than about 500 nM. In some embodiments, a K D is no more than about 250 nM. In some embodiments, a K D is no more than about 100 nM. In some embodiments, a K D is no more than about 50 nM. In some embodiments, a K D is no more than about 25 nM. In some embodiments, a K D is no more than about 10 nM. In some embodiments, a K D is no more than about 5 nM. In some embodiments, a K D is no more than about 1 nM.
- K D is measured by Surface Plasmon Resonance (SPR) as illustrated herein.
- SPR Surface Plasmon Resonance
- provided agents binds to a polypeptide whose sequence is or comprising SEQ ID NO: 2, or a fragment thereof: SVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKL IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLV QNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQ VGGIEALVRT (SEQ ID NO: 2).
- provided agents have one or more or all of the following interactions with beta-catenin: Direct interactions (Italic), water mediated (bold), non-polar contacts underlined LQILAYGNQESKLIILA (residue 301-317 of Uniprot P35222 sequence) (SEQ ID NO: 3) SRVLKVLSVCSSN (residue 341-353 of Uniprot P35222 sequence) (SEQ ID NO: 4) RLVQNCLWTLRNLSDA (residue 376-391 of Uniprot P35222 sequence) (SEQ ID NO: 5) LGSDDINVVTCAAGI (residue 409-423 of Uniprot P35222 sequence) (SEQ ID NO: 6) [0654]
- an agent e.g., a peptide, binds to beta-catenin and interacts with one or more residues that are or correspond to at least two, or at least three, or at least four, or
- an agent e.g., a peptide, binds to beta-catenin and interacts with one or more residues that are or correspond to at least two, or at least three, or at least four, or at least five, or at least six, or seven of the following amino acid residues in SEQ ID NO: 1 at the indicated positions: G307, K312, K345, W383, R386, N387, D413, and N415.
- an agent binds to beta-catenin and interacts with one or more residues that are or correspond to at least two, or at least three, or at least four, or at least five, or at least six, or seven of the following amino acid residues in SEQ ID NO: 1 at the indicated positions: G307, K312, K345, W383, N387, D413, and N415.
- provided agents interact with beta-catenin at one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) of G307, K312, K345, W383, R386, N387, D413 and N415.
- provided agents interact with beta-catenin at one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) of G307, K312, K345, W383, N387, D413 and N415. In some embodiments, provided agents interact with beta-catenin at one or both of K312 and R386. In some embodiments, provided agents interact with G307. In some embodiments, provided agents interact with K312. In some embodiments, provided agents interact with beta-catenin at one or more of K345, W383, D413 and N415. In some embodiments, provided agents interact with beta-catenin at one or more of K345 and W383.
- provided agents interact with beta-catenin at one or more of D413 and N415. In some embodiments, provided agents interact with K312. In some embodiments, provided agents interact with K345. In some embodiments, provided agents interact with W383. In some embodiments, provided agents interact with R386. In some embodiments, provided agents interact with D413. In some embodiments, provided agents interact with N415.
- provided agents interact with one or more of amino acid residues that are or correspond to K312, R386, K345 and W383 of SEQ ID NO: 1. In some embodiments, provided agents interact with one or more of amino acid residues that are or correspond to K312 and R386 of SEQ ID NO: 1. In some embodiments, interaction with an amino acid residue can be assessed through mutation of such an amino acid residue (e.g., mutation of K, R, etc. to D, E, etc.).
- interactions with beta-catenin may be assessed by contacting an agent with either a full- length or a portion of beta-catenin.
- a portion of beta-catenin comprises the interacting residues above.
- a portion of beta-catenin is or comprises SEQ ID NO: 2.
- a portion of beta-catenin is expressed with a tag (e.g., for purification, detection, etc.).
- a tag is a fluorescent tag.
- a tag is for detection.
- a tag is for purification and detection.
- a tag is a purification tag.
- a tag is or comprises biotin. Many other types of tags are available in the art and can be utilized in accordance with the present disclosure.
- a useful technology is or comprises fluorescence polarization.
- a useful technology assesses LogP or LogD.
- a useful technology is or comprises a CHI LogD assay.
- a useful technology assesses solubility.
- a useful technology is or comprises NanoBRET.
- a useful technology is or comprises a reporter assay (e.g., DLD1 reporter assay).
- a reporter assay e.g., DLD1 reporter assay
- a useful technology is or comprises alphascreen. Certain useful protocols are described in the Examples. Those skilled in the art appreciate that suitable adjustments may be made to such protocols, e.g., according to specific conditions, agents, purposes, etc.
- certain stapled peptides may be provided in and/or produced by a biological system and reacting with a provided reagent, e.g., one having the structure of R x ⁇ L s2 ⁇ R x , or a salt thereof, wherein R x can react with ⁇ SH groups under suitable conditions.
- a provided reagent e.g., one having the structure of R x ⁇ L s2 ⁇ R x , or a salt thereof, wherein R x can react with ⁇ SH groups under suitable conditions.
- each R x is a suitable leaving group.
- each R x is independently ⁇ Br.
- peptides are prepared on solid phase on a synthesizer using, typically, Fmoc chemistry.
- the present disclosure provides protected and/or activated amino acids for synthesis.
- staples are formed by olefin metathesis.
- a product double bond of metathesis is reduced/hydrogenated.
- CO 2 are extruded from a carbamate moiety of a staple.
- provided stapled peptides are further modified, and/or conjugated to other entities. Conditions and/or reagents of these reactions are widely known in the art and can be performed in accordance with the present disclosure to provide stapled peptides.
- a provided compound e.g., an amino acid or a protected form thereof, may be prepared utilizing the following technologies Those skilled in the art will appreciate that other leaving groups can be utilized in place of ⁇ Cl for the first reaction, such as -Br, -I, -OTs, Oms, etc.
- a provide compound may be prepared using one or more or all steps described below:
- a provide compound may be prepared using one or more or all steps described below:
- a provide compound may be prepared using one or more or all steps described below:
- a provide compound may be prepared using one or more or all steps [0671] Provided compounds can be provided in high purity. In some embodiments, a provided compound is at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% pure. In some embodiments, provided compounds, e.g., amino acids optionally protected/activated, are essentially free of impurities, including stereoisomers.
- compositions [0672] Among other things, the present disclosure provides compositions that comprise or otherwise relate to provided agents, e.g., small molecule agents, peptide agents (e.g., stapled peptides), as described herein.
- provided compositions are or comprise an assay system for characterizing (and optionally including) a stapled peptide as described herein.
- provided compositions are pharmaceutical compositions e.g., that comprise or deliver one or more provided agents.
- an agent is a peptide.
- an agent is a stapled peptide.
- an agent comprises a detectable moiety, e.g., fluorescent moiety, radioactive moiety, biotin, etc.
- a detectable moiety is directly detectable.
- a detectable antibody is detected indirectly, e.g., utilizing an antibody, an agent that can reacting with a detectable moiety to form a detectable product, etc.
- a pharmaceutical composition comprises a provided agent and a pharmaceutically acceptable excipient (e.g., carrier).
- a pharmaceutically acceptable excipient e.g., carrier
- a peptide composition may include or deliver a particular form (e.g., a particular optical isomer, diastereomer, salt form, covalent conjugate form [e.g., covalently attached to a carrier moiety], etc., or combination thereof) of an agent as described herein).
- a particular form e.g., a particular optical isomer, diastereomer, salt form, covalent conjugate form [e.g., covalently attached to a carrier moiety], etc., or combination thereof
- an agent included or delivered by a pharmaceutical composition is described herein is not covalently linked to a carrier moiety.
- a provided therapeutic composition may comprise one or more additional therapeutic agents and/or one or more stabilizing agents and/or one or more agents that alters (e.g., extends or limits to a particular tissue, location or site) rate or extent of delivery over time.
- a composition is a pharmaceutical composition which comprises or delivers a provided agent (e.g., a stapled peptide) or a pharmaceutically acceptable salt thereof and a pharmaceutically acceptable excipient.
- a composition comprises one and only stereoisomer of an agent (e.g., a stapled peptide) and/or one or more salts thereof.
- a composition comprises two or more stereoisomers of an agent (e.g., a stapled peptide) and/or one or more salts thereof.
- the two or more stereoisomers of an agent (e.g., a stapled peptide) or salts thereof elute as a single peak in a chromatography, e.g., HPLC.
- agents and compositions can be utilized for various purposes.
- certain compounds may be utilized as amino acids, either directly or for preparation of other compounds such as peptides.
- Certain agents, e.g., peptides may be utilized to prepare stapled peptides.
- Certain agents that are or comprise peptides, particularly stapled peptides, and compositions thereof, are biologically active and can be utilized for various purposes, e.g., as therapeutics toward various conditions, disorders or diseases, as tools for modulating biological functions, etc.
- the present disclosure provides agents and compositions thereof for modulating beta-catenin functions.
- beta-catenin is reported to have multiple cellular functions including regulation and coordination of cell-cell adhesion and gene transcription.
- agents described herein may inhibit beta-catenin activity and/or level and may, for example, inhibit neoplastic growth.
- agents described herein may activate and/or increase level of beta-catenin and may, for example, be used to treat male pattern baldness or alopecia.
- beta-catenin can interact with members of the TCF/LEF family at a TCF site on beta-catenin.
- provided technologies can decrease, suppress or block one or more of such interactions.
- the present disclosure provides methods for modulating an interaction between beta-catenin and its binding partner (e.g., a TCF/LEF family member) comprising contacting beta-catenin with a provided agent.
- binding of provided agents to beta-catenin competes or inhibits binding of another agent. In some embodiments, binding of provided agents to beta-catenin competes or inhibits binding of another agent. In some embodiments, binding of provided agents to beta-catenin competes or inhibits binding of TCF or a fragment thereof.
- provided agents compete with TCF7, LEF1, TCF7L1, TCF7L2,
- Axinl, Axin2, APC, CDH1, or CDH2, or a fragment thereof, for beta-catenin binding is included in the alpha-catenin binding.
- provided agents interfere with interactions of TCF7, LEF1, TCF7L1, TCF7L2, Axinl, Axin2, APC, CDH1, or CDH2, or a fragment thereof, with beta-catenin.
- the present disclosure provides methods for modulating interactions of beta-catenin with a partner, e.g., TCF7, LEF1, TCF7L1, TCF7L2, Axinl, Axin2, APC, CDH1, or CDH2, or a fragment thereof, comprising contacting beta-catenin with a provided agent or a composition that comprises or delivers a provided agent.
- a partner e.g., TCF7, LEF1, TCF7L1, TCF7L2, Axinl, Axin2, APC, CDH1, or CDH2, or a fragment thereof.
- the present disclosure provides methods for modulating interactions of beta-catenin with a partner, e.g., TCF7, LEF1, TCF7L1, TCF7L2, Axinl, Axin2, APC, CDH1, or CDH2, or a fragment thereof, comprising administering or delivering to a system comprising beta-catenin and the partner a provided agent or a composition that comprises or delivers a provided agent.
- a system is an intro system.
- a system is or comprises a cell, tissue or organ.
- a system is a subject.
- the present disclosure provides method for inhibiting cell growth, comprising administering or delivering to a population of cells an effective amount of a provided agent or a pharmaceutically acceptable salt thereof. In some embodiments, the present disclosure provides method for killing cells associated with a condition, disorder or disease (e.g., cancer), comprising administering or delivering to a population of such cells an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- a condition, disorder or disease e.g., cancer
- the present disclosure provides methods for preventing a condition, disorder or disease associated with beta-catenin (e.g., a cancer, a neurodegenerative disease, etc.), comprising administering or delivering to a subject susceptible thereto an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- the present disclosure provides methods for treating a condition, disorder or disease associated with beta-catenin (e.g., aberrant beta-catenin activity and/or expression level), comprising administering or delivering to a subject suffering therefrom an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- a provided agent is administered as a pharmaceutical composition that comprises or delivers an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- a condition, disorder or disease is associated with beta-catenin interaction with a partner, e.g., TCF7, LEF1, TCF7L1, TCF7L2, Axinl, Axin2, APC, CDH1, and/or CDH2.
- a condition, disorder or disease is associated with beta-catenin with TCF.
- a condition, disorder or disease is cancer.
- provided agents may be administered in combination with another therapy, e.g., immunotherapy.
- a condition, disorder, or disease is selected from cancer, cardiac disease, dilated cardiomyopathy, fetal alcohol syndrome, depression, and diabetes.
- a condition, disorder, or disease is a heart condition, disorder, or disease.
- a condition, disorder, or disease is cancer.
- a cancer is selected from: colon cancer, colorectal cancer, rectal cancer, prostate cancer familial adenomatous polyposis (FAP), Wilms Tumor, melanoma, hepatocellular carcinoma, ovarian cancer, endometrial cancer, medulloblastoma pilomatricomas, primary hetpatocellular carcinoma, ovarial carcinoma, breast cancer, lung cancer, glioblastoma, pliomatrixoma, medulloblastoma, thyroid tumors, and ovarian neoplasms.
- FAP familial adenomatous polyposis
- a condition, disorder or disease is a cancer, e.g., colorectal cancer, hepatocellular cancer, melanoma, gastric cancer, bladder cancer, and endometrial cancer.
- a cancer is colorectal cancer.
- a cancer is hepatocellular cancer.
- a cancer is prostate cancer.
- a cancer is melanoma.
- Various technologies can be utilized in accordance with the present disclosure to formulate, distribute, administer or deliver provided technologies such as agents, peptides, compounds, compositions, etc.
- administration may be ocular, oral, parenteral, topical, etc.
- administration may be bronchial (e.g., by bronchial instillation), buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc), enteral, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e. g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
- bronchial e.g., by bronchial instillation
- buccal which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc
- enteral intra-arterial, intradermal, intragastric
- administration may involve dosing that is intermittent (e.g., a plurality of doses separated in time) and/or periodic (e.g., individual doses separated by a common period of time) dosing. In some embodiments, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time. In some embodiments, provided technologies are administered intravenously.
- the present disclosure provides various structural moieties including designed amino acid residues that can be utilized to optimize various properties and activities, stability, delivery, pharmacodynamics, pharmacokinetics, etc. to provide various dosage forms, dosage regimen, therapeutic windows, etc.
- provided agents and compositions thereof may be utilized with improved dosage regimen and/or unit doses.
- administration of provided agents are adjusted based on conditions, disorders or diseases and/or subpopulations.
- administration and/or dosage regimen of provided technologies are adjusted according to certain biomarkers and genomic alterations.
- Provided agents may deliver biological effects, e.g., therapeutic effects, via various mechanisms.
- efficacy may be driven by AUC.
- efficacy may be driven by Cmax.
- a provided agent is utilized in combination with another therapy. In some embodiments, a provided agent is utilized in combination with another therapeutic agent. In some embodiments, another therapy or therapeutic agent is administered prior to an administration or delivery of a provided agent. In some embodiments, another therapy or therapeutic agent is administered at about the same time as an administration or delivery of a provided agent. In some embodiments, a provided agent and another agent is in the same pharmaceutical composition. In some embodiments, another therapy or therapeutic agent is administered subsequently to an administration or delivery of a provided agent. In some embodiments, a subject is exposed to both a provided agent and another therapeutic agent. In some embodiments, both a provided agent and another agent can be detected in a subject.
- a provided agent is administered before another agent is cleared out by a subject or vice versa. In some embodiments, a provided agent is administered within the half-life, or 2, 3, 4, 5 or 6 times of the half-life, of another agent or vice versa. In some embodiments, a subject is exposed to a therapeutic effect of a provided agent and a therapeutic effect of another therapeutic agent. In some embodiments, an agent may provide an effect after an agent is cleared out or metabolized by a subject. In some embodiments, a procedure, e.g., surgery, radiation, etc., may provide an effect after the procedure is completed.
- another therapy is a cancer therapy. In some embodiments, another therapy is or comprises surgery. In some embodiments, another therapy is or comprises radiation therapy. In some embodiments, another therapy is or comprises immunotherapy. In some embodiments, another therapeutic agent is or comprises a drug. In some embodiments, another therapeutic agent is or comprises a cancer drug. In some embodiments, another therapeutic agent is or comprises a chemotherapeutic agent. In some embodiments, another therapeutic agent is or comprises a hormone therapy agent. In some embodiments, another therapeutic agent is or comprises a kinase inhibitor. In some embodiments, another therapeutic agent is or comprises a checkpoint inhibitor (e.g., antibodies against PD1-, PD-L1, CTLA-4, etc.).
- a checkpoint inhibitor e.g., antibodies against PD1-, PD-L1, CTLA-4, etc.
- a provide agent can be administered with lower unit dose and/or total dose compared to being used alone.
- another agent can be administered with lower unit dose and/or total dose compared to being used alone.
- one or more side effects associated with administration of a provided agent and/or another therapy or therapeutic agent are reduced.
- a combination therapy provides improved results, e.g., when compared to each agent utilized individually.
- a combination therapy achieves one or more better results, e.g., when compared to each agent utilized individually.
- another agent is a checkpoint inhibitor, an EGFR inhibitor, a VEGF inhibitor, a VEGFR inhibitor, a kinase inhibitor, or an anti-cancer drug.
- an additional agent is a checkpoint inhibitor.
- an additional agent is an immune oncology agent.
- an additional agent is an antibody against a checkpoint molecules.
- an additional agent is an antibody of PD1, PDL-1, CTLA4, A2AR, B7-H3, B7-H4, BTLA, IDO, KIR, LAG3, TIM-s, C10orf54, etc.
- an antibody is an anti-PD1 antibody.
- an antibody is an anti-PD-L1 antibody. In some embodiments, an antibody is an anti-CTLA4.
- another agent is an EGFR inhibitor, e.g., erlotinib, gefitinib, lapatinib, panitumumab, vandetanib, cetuximab, etc.
- another agent is an VEGF and/or VEGFR inhibitor, e.g., pazopanib, bevacizumab, sorafenib, sunitinib, axitinib, ponatinib, regorafenib, vandetanib, cabozantinib, ramucirumab, lenvatinib, ziv-aflibercept, etc.
- another agent is a kinase inhibitor.
- another therapeutic agent is a chemotherapeutic agent.
- another therapeutic agent is an anti-cancer drug, e.g., cyclophosphamide, methotrexate, 5-fluorouracil (5-FU), doxorubicin, mustine, vincristine, procarbazine, prednisolone, dacarbazine, bleomycin, etoposide, cisplatin, epirubicin, capecitabine, folinic acid, actinomycin, all-trans retinoic acid, azacitidine, azathioprine, bortezomib, carboplatin, chlorambucil, cytarabine, daunorubicin, docetaxel, doxifluridine, fluorouracil, gemcitabine, hydroxyurea, idarubicin, imatinib, irinotecan, mechlorethamine, mercaptopurine, mitoxantrone, paclitaxel, pemetrexed,
- a agent having the structure of formula I R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein: R N is a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; each of L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 is independently L, wherein L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 comprise: a first R’ group and a second R’ group which are taken together to form ⁇ L s ⁇ which is bonded to the atom to
- the agent of any one of the preceding Embodiments, wherein L s formed by taking the third and the fourth R’ groups together is a staple as described herein. 8. The agent of any one of the preceding Embodiments, wherein L s formed by taking the third and the fourth R’ groups together has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms. 9. The agent of any one of the preceding Embodiments, wherein L s formed by taking the third and the fourth R’ groups together has a length of 10-20 (e.g., 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms. 10.
- L P1 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L P1 length of L P1 is 2-10 (2, 3, 4, 5, 6, 7, 8, 9, or 10) atoms.
- one or more methylene units of L P1 are independently replaced with ⁇ N(R’) ⁇ or ⁇ C(O) ⁇ .
- one or more methylene units of L P1 are independently replaced with ⁇ N(R’) ⁇ or ⁇ C(O)N(R’) ⁇ .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021314310A AU2021314310A1 (en) | 2020-07-22 | 2021-07-22 | Stapled peptides and methods thereof |
| EP21847152.2A EP4185599A4 (en) | 2020-07-22 | 2021-07-22 | STAPLED PEPTIDES AND RELATED USES |
| JP2023504288A JP2023535026A (ja) | 2020-07-22 | 2021-07-22 | ステープルペプチドおよびその方法 |
| CN202180064601.7A CN116323638A (zh) | 2020-07-22 | 2021-07-22 | 订书钉化肽及其方法 |
| US18/017,024 US20240116985A1 (en) | 2020-07-22 | 2021-07-22 | Stapled peptides and methods thereof |
| IL299907A IL299907A (en) | 2020-07-22 | 2021-07-22 | Paired peptides and their methods |
| KR1020237005577A KR20230057350A (ko) | 2020-07-22 | 2021-07-22 | 스테이플화된 펩티드 및 이의 방법 |
| MX2023000947A MX2023000947A (es) | 2020-07-22 | 2021-07-22 | Peptidos grapados y metodos para su obtencion. |
| CA3186681A CA3186681A1 (en) | 2020-07-22 | 2021-07-22 | Stapled peptides and methods thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063055308P | 2020-07-22 | 2020-07-22 | |
| US63/055,308 | 2020-07-22 | ||
| US202163208494P | 2021-06-08 | 2021-06-08 | |
| US63/208,494 | 2021-06-08 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022020652A2 true WO2022020652A2 (en) | 2022-01-27 |
| WO2022020652A3 WO2022020652A3 (en) | 2022-03-03 |
Family
ID=79728982
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/042856 Ceased WO2022020652A2 (en) | 2020-07-22 | 2021-07-22 | Stapled peptides and methods thereof |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20240116985A1 (https=) |
| EP (1) | EP4185599A4 (https=) |
| JP (1) | JP2023535026A (https=) |
| KR (1) | KR20230057350A (https=) |
| CN (1) | CN116323638A (https=) |
| AU (1) | AU2021314310A1 (https=) |
| CA (1) | CA3186681A1 (https=) |
| IL (1) | IL299907A (https=) |
| MX (1) | MX2023000947A (https=) |
| WO (1) | WO2022020652A2 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115260060A (zh) * | 2022-09-07 | 2022-11-01 | 康化(上海)新药研发有限公司 | (2s)-2-n-芴甲氧羰基氨基-5,5-二甲基正亮氨酸的合成方法 |
| US11834482B2 (en) | 2017-09-07 | 2023-12-05 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| WO2024054892A1 (en) * | 2022-09-09 | 2024-03-14 | Shape Therapeutics Inc. | Therapeutic peptides |
| WO2024130218A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130217A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| US12398178B2 (en) | 2018-08-20 | 2025-08-26 | Parabilis Medicines, Inc. | Collections of peptides, peptide agents, and methods of use thereof |
| EP4355350A4 (en) * | 2021-06-08 | 2025-10-01 | Parabilis Medicines Inc | STAPLED PEPTIDES AND RELATED USES |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU5671196A (en) * | 1996-03-28 | 1997-10-17 | Immulogic Pharmaceutical Corporation | Myelin oligodendrocyte glycoprotein peptides and uses thereof |
| US20040181830A1 (en) * | 2001-05-07 | 2004-09-16 | Kovalic David K. | Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement |
| US20050187147A1 (en) * | 2003-09-22 | 2005-08-25 | Newman Michael J. | Compositions and methods for increasing drug efficiency |
| EP2254592B1 (en) * | 2008-02-28 | 2019-06-05 | Dako Denmark A/S | Mhc multimers in borrelia diagnostics and disease |
| WO2010009987A2 (en) * | 2008-07-21 | 2010-01-28 | Probiodrug Ag | Diagnostic antibody assay |
| EP2337795A2 (en) * | 2008-10-01 | 2011-06-29 | Dako Denmark A/S | Mhc multimers in cancer vaccines and immune monitoring |
| WO2012040459A2 (en) * | 2010-09-22 | 2012-03-29 | President And Fellows Of Harvard College | Beta-catenin targeting peptides and uses thereof |
| WO2014026033A1 (en) * | 2012-08-08 | 2014-02-13 | University Of Florida Research Foundation, Inc. | Cross-reactive t cell epitopes of hiv, siv, and fiv for vaccines in humans and cats |
| GB2563875B (en) * | 2017-06-28 | 2020-08-19 | Sutura Therapeutics Ltd | Improvements in drug delivery |
| AU2018329956A1 (en) * | 2017-09-07 | 2020-08-20 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| WO2019178313A1 (en) * | 2018-03-14 | 2019-09-19 | Dana-Farber Cancer Institute, Inc. | Stabilized peptides for biomarker detection |
-
2021
- 2021-07-22 AU AU2021314310A patent/AU2021314310A1/en not_active Abandoned
- 2021-07-22 JP JP2023504288A patent/JP2023535026A/ja active Pending
- 2021-07-22 WO PCT/US2021/042856 patent/WO2022020652A2/en not_active Ceased
- 2021-07-22 CA CA3186681A patent/CA3186681A1/en active Pending
- 2021-07-22 IL IL299907A patent/IL299907A/en unknown
- 2021-07-22 MX MX2023000947A patent/MX2023000947A/es unknown
- 2021-07-22 KR KR1020237005577A patent/KR20230057350A/ko active Pending
- 2021-07-22 CN CN202180064601.7A patent/CN116323638A/zh active Pending
- 2021-07-22 US US18/017,024 patent/US20240116985A1/en active Pending
- 2021-07-22 EP EP21847152.2A patent/EP4185599A4/en active Pending
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834482B2 (en) | 2017-09-07 | 2023-12-05 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| US12398178B2 (en) | 2018-08-20 | 2025-08-26 | Parabilis Medicines, Inc. | Collections of peptides, peptide agents, and methods of use thereof |
| EP4355350A4 (en) * | 2021-06-08 | 2025-10-01 | Parabilis Medicines Inc | STAPLED PEPTIDES AND RELATED USES |
| CN115260060A (zh) * | 2022-09-07 | 2022-11-01 | 康化(上海)新药研发有限公司 | (2s)-2-n-芴甲氧羰基氨基-5,5-二甲基正亮氨酸的合成方法 |
| WO2024054892A1 (en) * | 2022-09-09 | 2024-03-14 | Shape Therapeutics Inc. | Therapeutic peptides |
| WO2024130218A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130217A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2023535026A (ja) | 2023-08-15 |
| MX2023000947A (es) | 2023-02-22 |
| WO2022020652A3 (en) | 2022-03-03 |
| AU2021314310A1 (en) | 2023-03-16 |
| CN116323638A (zh) | 2023-06-23 |
| KR20230057350A (ko) | 2023-04-28 |
| EP4185599A4 (en) | 2024-08-28 |
| CA3186681A1 (en) | 2022-01-27 |
| US20240116985A1 (en) | 2024-04-11 |
| IL299907A (en) | 2023-03-01 |
| EP4185599A2 (en) | 2023-05-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2022020652A2 (en) | Stapled peptides and methods thereof | |
| JP2023546369A (ja) | N-アセチルガラクトサミン(GalNAc)から誘導された化合物およびオリゴヌクレオチド | |
| KR20240031957A (ko) | 스테이플화된 펩티드 및 이의 방법 | |
| TW201120040A (en) | Bruton's tyrosine kinase inhibitors | |
| EP4460492A1 (en) | Compounds containing a hydroxyphenyl moiety and their use | |
| WO2022240978A1 (en) | Macrocyclic compounds and uses thereof | |
| EP4633657A1 (en) | Stapled peptides and methods thereof | |
| CN116113621A (zh) | 氨基酸 | |
| WO2024130217A1 (en) | Stapled peptides and methods thereof | |
| TWI717804B (zh) | 化合物之鹽及其晶體 | |
| WO2025265097A1 (en) | Stapled peptides and methods thereof | |
| CN113045567A (zh) | 基于蛋白磷酸酶5的磷酸酶募集嵌合体(PHORCs)化合物、其制备方法和医药用途 | |
| CN111943959A (zh) | 一种jak抑制剂的合成方法 | |
| HK40129655A (zh) | 订书钉化肽及其方法 | |
| EP4724080A2 (en) | Stapled peptides and methods thereof | |
| HK40128981A (zh) | 订书钉化肽及其方法 | |
| EP4644374A1 (en) | Naphthylamide compound, and preparation method therefor and use thereof | |
| HK40108355A (zh) | 订书钉化肽及其方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21847152 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3186681 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2023504288 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023001029 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202317010811 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021847152 Country of ref document: EP Effective date: 20230222 |
|
| ENP | Entry into the national phase |
Ref document number: 2021314310 Country of ref document: AU Date of ref document: 20210722 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023001029 Country of ref document: BR Free format text: APRESENTAR, EM ATE 60 (SESSENTA) DIAS, TRADUCAO COMPLETA DO PEDIDO, ADAPTADA A NORMA VIGENTE, CONFORME CONSTA NO DEPOSITO INTERNACIONAL INICIAL PCT/US2021/042856 DE 22/07/2021, POIS A MESMA NAO FOI APRESENTADA ATE O MOMENTO. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: ERR Ref document number: 112023001029 Country of ref document: BR Free format text: ANULADA A PUBLICACAO CODIGO 1.5 NA RPI NO 2725 DE 28/03/2023 POIS O CONTEUDO QUE DEU ORIGEM A MESMA FOI ENVIADO POR PETICAO 260 PROTOCOLADA EM DATA ANTERIOR A SUA PUBLICACAO. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023001029 Country of ref document: BR Free format text: APRESENTAR, EM ATE 60 (SESSENTA) DIAS, NOVAS FOLHAS DE RELATORIO DESCRITIVO ADAPTADAS AO ART. 39 DA INSTRUCAO NORMATIVA 31/2013 UMA VEZ QUE O CONTEUDO ENVIADO NA PETICAO NO 870230025073 DE 24/03/2023 ENCONTRA-SE FORA DA NORMA. |
|
| ENP | Entry into the national phase |
Ref document number: 112023001029 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230119 |