WO2021162375A1 - 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용 - Google Patents

광 절단성 단백질을 포함하는 엑소좀 및 이의 이용 Download PDF

Info

Publication number
WO2021162375A1
WO2021162375A1 PCT/KR2021/001634 KR2021001634W WO2021162375A1 WO 2021162375 A1 WO2021162375 A1 WO 2021162375A1 KR 2021001634 W KR2021001634 W KR 2021001634W WO 2021162375 A1 WO2021162375 A1 WO 2021162375A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
exosome
mmaple3
cdna
target protein
Prior art date
Application number
PCT/KR2021/001634
Other languages
English (en)
French (fr)
Inventor
조동규
한지훈
설재훈
Original Assignee
성균관대학교산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020210015837A external-priority patent/KR102688170B1/ko
Application filed by 성균관대학교산학협력단 filed Critical 성균관대학교산학협력단
Priority to EP21752871.0A priority Critical patent/EP4104860A4/en
Priority to US17/798,524 priority patent/US20230211010A1/en
Priority to CN202180013300.1A priority patent/CN115103859A/zh
Priority to JP2022548161A priority patent/JP7479078B2/ja
Publication of WO2021162375A1 publication Critical patent/WO2021162375A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
    • A61K47/6905—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion
    • A61K47/6911—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion the form being a liposome
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5076—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving cell organelles, e.g. Golgi complex, endoplasmic reticulum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K41/00—Medicinal preparations obtained by treating materials with wave energy or particle radiation ; Therapies using these preparations
    • A61K41/0042—Photocleavage of drugs in vivo, e.g. cleavage of photolabile linkers in vivo by UV radiation for releasing the pharmacologically-active agent from the administered agent; photothrombosis or photoocclusion
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6425—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/10—Dispersions; Emulsions
    • A61K9/127—Liposomes
    • A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes, liposomes coated with polymers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/5005—Wall or coating material
    • A61K9/5063—Compounds of unknown constitution, e.g. material from plants or animals
    • A61K9/5068—Cell membranes or bacterial membranes enclosing drugs
    • C—CHEMISTRY; METALLURGY
    • C40—COMBINATORIAL TECHNOLOGY
    • C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B30/00—Methods of screening libraries
    • C40B30/06—Methods of screening libraries by measuring effects on living organisms, tissues or cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00—Screening for compounds of potential therapeutic value
    • G01N2500/10—Screening for compounds of potential therapeutic value involving cells

Definitions

  • the present invention relates to an exosome containing a photocleavable protein and its use, and more particularly, to an exosome containing a fusion protein comprising a target protein and a photocleavable protein, mMaple3, and use thereof.
  • lipid nanoparticles are not effectively separated from the therapeutic protein, and viruses
  • PTD protein transduction domain
  • an exosome is a vesicle composed of a lipid-bilayer, and is a constituent of a substance secreted by a cell to the outside of the cell.
  • exosomes transport (transport) proteins, bioactive lipids, and RNA (miRNA), which are biomolecules in cells. known to play a role.
  • miRNA RNA
  • These exosomes are also being studied as biomarkers for neurological diseases such as Alzheimer's, and have high selective permeability enough to penetrate the blood-brain barrier (BBB) that separates cerebrospinal fluid and blood, making them a nanocarrier for specific drugs. It is also used in the development of drug delivery systems such as
  • Korean Patent Application Laid-Open No. 10-2018-0036134 discloses a method for producing an exosome comprising a super-repressor-I ⁇ protein using a light-specific binding protein, and the method for producing A pharmaceutical composition for preventing and treating inflammatory diseases containing exosomes prepared by an active ingredient is known
  • Japanese Patent Application Laid-Open No. 2019-528674 discloses a method for mass production of exosomes including cargo proteins, preparing exosomes It is known for a method of loading a cargo protein into the cytosol by using a vector for, an exosome containing a cargo protein prepared by the above method, and an exosome prepared thereby.
  • the above documents disclose a light-specific binding protein as a fusion protein in the exosome, which uses two light-specific binding proteins as the CIBN-CRY2 system. Since it has to do so, the efficiency is lowered, and since light of 488 nm must be continuously applied to the cells while exosomes are generated, it can affect the cells, and the amount of transport proteins contained in the exosomes is lost.
  • the transport protein if the binding of CIBN and CRY2 is maintained under conditions of no light after exosome formation, the transport protein cannot move freely and may be bound to the exosome-specific protein, and the size of CRY2 fused to the transport protein is 65 kDa, so it can affect the intrinsic function of the transport protein.
  • a fluorescent protein such as EGFP must be fused separately and used.
  • the downside is that there is no way.
  • the present inventors have attempted to overcome the disadvantages of the conventionally known protein delivery technology using the CIBN-CRY2 system and develop a method for safely and efficiently delivering proteins into cells.
  • the present inventors found that when light is irradiated to an exosome containing a fusion protein bound to a target protein to be delivered into a cell by the photocleavable protein mMaple3, the mMaple3 is cleaved to safely and efficiently release the target protein in the exosome. It was confirmed that it can be delivered into the target cell, and the present invention was completed based on this.
  • an object of the present invention is to provide an exosome containing a fusion protein comprising a target protein, a photocleavable protein, and an exosome-specific marker protein, and use thereof.
  • the present invention provides an exosome containing a fusion protein comprising a target protein and mMaple3.
  • the present invention provides a composition for intracellular delivery of a target protein comprising the exosome as an active ingredient.
  • the present invention comprises the steps of irradiating light to an exosome containing a fusion protein comprising a target protein and mMaple3;
  • It provides a method for intracellular delivery of a target protein in vitro, comprising the step of treating the exosome irradiated with the light to the target cell.
  • the present invention comprises the steps of (a) irradiating light to an exosome containing a fusion protein comprising a protein candidate drug and mMaple3;
  • the fusion protein may further include an exosome-specific marker protein.
  • the present invention provides a method for producing the fusion protein, comprising the following steps:
  • the present invention provides a method for producing the exosome, comprising the following steps:
  • the amplified cDNA of mMaple3 and cDNA of the exosome-specific marker protein are converted into one cDNA It may include a step of combining.
  • the separation of the exosomes in (S3) of the exosome preparation method is tangential flow filtration (TFF), ultracentrifugation, size exclusion chromatography, and exosomes.
  • TMF tangential flow filtration
  • ultracentrifugation ultracentrifugation
  • size exclusion chromatography size exclusion chromatography
  • exosomes exosomes.
  • One method selected from the group consisting of exosome isolation kits may be used.
  • the mMaple3 may include the amino acid sequence of SEQ ID NO: 1.
  • the mMaple3 may be encoded by a gene comprising the nucleotide sequence of SEQ ID NO:2.
  • the target protein may be a protein to be delivered into a cell.
  • the target protein may be a protein for treating a disease or a protein for diagnosing a disease.
  • the exosome-specific marker protein may be at least one selected from the group consisting of CD9, CD63, and CD81.
  • mMaple3 in the exosome may be cleaved through the step of irradiating light to the exosome.
  • the light may have a wavelength of 401 nm to 480 nm.
  • the present invention provides a method for intracellular delivery of a target protein, including a method of administering to an individual a composition comprising an exosome containing a target protein and a fusion protein comprising mMaple3.
  • the present invention provides the use of a composition comprising an exosome containing a target protein and a fusion protein comprising mMaple3 for delivering the target protein into cells.
  • the present invention provides the use of an exosome containing a fusion protein comprising a target protein and mMaple3 for the production of a formulation for intracellular delivery of a target protein.
  • the exosome according to the present invention contains a fusion protein comprising a blue fluorescent protein (TagBFP), a photocleavable protein (mMaple3), and an exosome-specific marker protein (CD9), and 405 nm light is applied to the exosome.
  • a fusion protein comprising a blue fluorescent protein (TagBFP), a photocleavable protein (mMaple3), and an exosome-specific marker protein (CD9)
  • 405 nm light is applied to the exosome.
  • the photocleavable protein mMaple3 was cleaved to deliver the blue fluorescent protein in the exosome into the target cell.
  • 405 nm light was irradiated to the exosome containing the Cre fusion protein (Cre-mMaple3-CD9)
  • the Cre protein in the exosome could be delivered into the animal organ. Therefore, the exosome containing the photocleavable protein according to the present invention is expected to be usefully used in the field of protein therapy
  • FIG. 1 schematically shows the structure and characteristics of a fusion protein in which a target protein (blue fluorescent protein), a photocleavable protein, and an exosome-specific marker protein are bound according to an embodiment of the present invention.
  • Figure 2 shows the result of confirming the production process and the expression in cells of the fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention.
  • Figure 3a shows a simplified schematic diagram of the CIBN-CRY2 system.
  • Figure 3b shows a simplified schematic diagram of the mMaple system according to an embodiment of the present invention.
  • 4A is a result of confirming the cleavage effect of the fusion protein (TagBFP-mMaple3-CD9) by light irradiation in HEK293T cells according to an embodiment of the present invention through a confocal microscope.
  • FIG. 4B is a graph showing the measurement of the intensity of fluorescence shown in FIG. 4A.
  • 4c is a result confirming the cleavage effect of the fusion protein (TagBFP-mMaple3-CD9) by light irradiation in HEK293T cells according to an embodiment of the present invention through western blot.
  • 6a is a result of measuring the size of an exosome containing a fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention by NTA.
  • 6b is a result of measuring the size of an exosome containing a fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention by DLS.
  • 6c is a result of measuring the concentration of exosomes containing a fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention by microBCA.
  • Figure 6d is a result of measuring the zeta potential of the exosome containing the fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention.
  • 6e is a cryo-TEM image observation result of an exosome containing a fusion protein (TagBFP-mMaple3-CD9) according to an embodiment of the present invention.
  • Figure 6f is the result of confirming the cleavage effect of the light irradiation of the fusion protein (TagBFP-mMaple3-CD9) in the exosome according to an embodiment of the present invention through western blot.
  • 6g is a result of confirming the cleavage effect of the fusion protein (TagBFP-mMaple3-CD9) in the exosome according to an embodiment of the present invention by light irradiation and whether the blue fluorescent protein is contained in the exosome through fluorescence intensity measurement.
  • Figure 7 is a fusion protein (TagBFP-mMaple3-CD9) in accordance with an embodiment of the present invention in the exosome containing Triton X-100, proteinase (proteinase K), and decomposition of the target protein according to the presence or absence of light treatment It is the result of checking whether or not
  • 8A and 8B are results confirming the intracellular delivery effect of the blue fluorescent protein in the exosome according to an embodiment of the present invention.
  • the present invention provides an exosome containing a fusion protein comprising a target protein and mMaple3.
  • the present invention provides a composition for intracellular delivery of a target protein comprising the exosome as an active ingredient.
  • the present invention provides a method for producing the fusion protein, comprising the following steps:
  • the present invention provides a method for producing the exosome, comprising the following steps:
  • the step of combining the amplified cDNA of mMaple3 and the cDNA of the exosome-specific marker protein into one cDNA prior to combining the amplified target protein and cDNA of mMaple3 in (S2) into one cDNA may include.
  • the cDNA encoding the fusion protein is transfected into exosome-producing cells, the cell culture medium is replaced with a FBS-free DMEM medium containing penicillin/streptomycin, and the medium is It may be a step of collecting and separating and purifying the exosomes from the collected medium.
  • the separation of the exosomes in (S3) is TFF (tangential flow filtration), ultracentrifugation, size exclusion chromatography, and exosome separation kit (exosome isolation kit).
  • TFF tangential flow filtration
  • ultracentrifugation size exclusion chromatography
  • exosome separation kit exosome isolation kit
  • the “fusion protein” is a protein produced by fusion of two or more proteins, and may include a target protein and mMaple3, and may further include an exosome-specific marker protein.
  • the target protein, mMaple3, and the exosome-specific marker protein constituting the fusion protein may be in a combined form, for example, the target protein-mMaple3-exosome-specific marker protein may be sequentially in the order of the target protein. If tracking is required, it may be the order of the exosome-specific marker protein-mMaple3-target protein, but there is no limitation in the order of their binding.
  • the “target protein” refers to a protein present in the exosome in a form bound to a photocleavable protein, and a protein to be delivered into a target cell or tissue.
  • the target protein may be a protein for treating a disease or a protein for diagnosing a disease, and the type thereof is not limited.
  • a target protein, p53, a cancer-suppressing protein can be delivered to cancer cells to exhibit cancer therapeutic effects, and in Parkinson's disease, which is caused by failure to function normally due to a mutation occurring in parkin protein, normal parkin protein is delivered to neurons It can show the therapeutic effect of Parkinson's disease, and Oct4, Sox2, c-Myc, and Klf4 proteins as Yamanaka factors, which are necessary in the process of dedifferentiating patient somatic cells into stem cells, which is the most important process in the study of next-generation stem cell therapy By effectively delivering it to the patient's somatic cells, it is possible to reverse differentiate into stem cells without the virus currently being used for stem cell reverse differentiation.
  • muscle differentiation-inducing proteins such as Myogenin and MyoD as target proteins
  • it can exhibit therapeutic effects on degenerative muscle diseases such as progressive muscle weakness, atrophy, and muscular dystrophy characterized by necrosis of muscle fibers.
  • dementia which is one of the neurodegenerative brain diseases
  • it can exhibit a therapeutic effect on dementia through the delivery of NRF2 and BDNF proteins, which are known to have a protective effect on the cranial nerve, and PGC1 ⁇ and PPAR- ⁇ , which differentiate white adipocytes
  • Delivery of brown fat inducing factor can show the therapeutic effect of metabolic diseases.
  • TagBFP which is a blue fluorescent protein, and whether it was delivered into an animal organ using Cre protein.
  • intracellular delivery of the target protein means transporting the target protein present in the form of binding to the photocleavable protein in the exosome from the exosome to the inside of the target cell.
  • mappingle3 is a photo-cleavable protein
  • photo-cleavable protein refers to a protein that is cleaved when exposed to light of a specific wavelength.
  • the mMaple3 may include the amino acid sequence of SEQ ID NO: 1, and may be encoded by a gene including the nucleotide sequence of SEQ ID NO: 2.
  • the “exosome-specific marker protein” is a protein located in the outer membrane of the exosome, and may be, for example, at least one selected from the group consisting of CD9, CD63, and CD81, and according to one embodiment of the present invention, CD9 can, but is not limited thereto.
  • the CD9 may include the amino acid sequence of SEQ ID NO: 3, and may be encoded by a gene including the nucleotide sequence of SEQ ID NO: 4.
  • exosome is a vesicle having a membrane structure composed of a lipid bilayer that is secreted out of the cell while trapping proteins, DNA, RNA, etc. for signal transduction between cells, It is present in the body fluids of almost all eukaryotes.
  • the diameter of the exosomes is 10 nm to 400 nm, 10 nm to 350 nm, 10 nm to 300 nm, 10 nm to 250 nm, 10 nm to 200 nm, 10 nm to 150 nm, 50 nm to 350 nm, 50 nm to 300 nm, 50 nm to 250 nm, 50 nm to 200 nm, 50 nm to 150 nm, 100 nm to 300 nm, 100 nm to 200 nm, or 100 nm to 150 nm, which are released from the cell when the multivesicles fuse with the cell membrane, or are released directly from the cell membrane.
  • the exosome may be prepared using an exosome extraction method known in the art, and there is no limitation on the extraction method.
  • the present invention comprises the steps of irradiating light to an exosome containing a fusion protein comprising a target protein and mMaple3;
  • It provides a method for intracellular delivery of a target protein in vitro, comprising the step of treating the exosome irradiated with the light to the target cell.
  • the present invention comprises the steps of (a) irradiating light to an exosome containing a fusion protein comprising a protein candidate drug and mMaple3;
  • mMaple3 in the exosome may be cleaved through the step of irradiating light to the exosome, wherein the light is 401 nm to 480 nm, 401 nm to 470 nm, 401 nm to 460 nm, 401 nm to 450 nm, 401 nm to 440 nm , 401nm to 430nm, 401nm to 420nm, or may have a wavelength of 401nm to 410nm, and light of 400nm or less can damage cells or exosomes as ultraviolet (UV) light when processing, and a wavelength exceeding 480nm Light can also affect the treatment of cells.
  • the wavelength of the light is not limited as long as it is in the range of 401 nm to 480 nm, but according to an embodiment of the present invention, it may preferably be 405 nm.
  • mMaple3 may exhibit green fluorescence when uncleaved, and red fluorescence when cleaved.
  • the present invention provides a method for intracellular delivery of a target protein, including a method of administering to an individual a composition comprising an exosome containing a target protein and a fusion protein comprising mMaple3.
  • “individual” means a subject in need of the target protein, and more specifically, human or non-human primates, mice, mammals such as dogs, cats, horses, and cattle. means
  • “administration” means providing a given composition of the present invention to a subject by any suitable method.
  • the present invention provides the use of a composition comprising an exosome containing a target protein and a fusion protein comprising mMaple3 for delivering the target protein into cells.
  • the present invention provides the use of an exosome containing a fusion protein comprising a target protein and mMaple3 for the production of a formulation for intracellular delivery of a target protein.
  • a fusion protein in which blue fluorescent protein (TagBFP), photocleavable protein (mMaple3) and exosome-specific marker protein (CD9) are combined is prepared, and another photocleavage protein is prepared.
  • TLBFP blue fluorescent protein
  • mMaple3 photocleavable protein
  • CD9 exosome-specific marker protein
  • exosomes were separated and purified from the medium of HEK293T cells overexpressing the fusion protein (TagBFP-mMaple3-CD9), and when 405 nm light was irradiated, mMaple3 was cleaved by 405 nm light. was confirmed in the exosome (see Example 3).
  • the target protein was degraded according to the presence or absence of treatment with Triton X-100, proteinase K, and 405 nm light in the exosome containing the fusion protein (TagBFP-mMaple3-CD9).
  • the target protein was not degraded by proteolytic enzymes unless treated with Triton X-100 to artificially permeate the lipid bilayer of the exosome, and the light at 405 nm did not affect the lipid bilayer of the exosome. It was confirmed that it does not give (see Example 4).
  • a transgenic mouse in which a red fluorescent protein (tdTomato) is expressed when the Cre fusion protein (Cre-mMaple3-CD9) is irradiated with light at 405 nm to an exosome containing it, and the Cre protein is delivered.
  • tdTomato red fluorescent protein
  • Cre-mMaple3-CD9 Cre fusion protein
  • a cDNA encoding a fusion protein (TagBFP-mMaple3-CD9) in which blue fluorescent protein (TagBFP), photocleavable protein (mMaple3) and exosome-specific marker protein (CD9) are bound was prepared, and the cDNA prepared as described above
  • the structure of the fusion protein translated from and its characteristics are schematically shown in FIG. 1, and the amino acid sequences of TagBFP, mMaple3, and CD9, and the gene sequences encoding them are shown in Table 1 below.
  • cDNA encoding TagBFP, mMaple3, and CD9 was prepared and amplified through PCR, respectively, and the amplified cDNAs of mMaple3 and CD9 were combined into one cDNA (mMaple3-CD9) through PCR.
  • a cDNA encoding a fusion protein was prepared by combining mMaple3-CD9 cDNA and TagBFP cDNA into a single cDNA (TagBFP-mMaple3-CD9) through PCR.
  • Primers used in the present invention are shown in Table 2 below.
  • TagBFP-Linker F TATGCTGAATTCGCCACCATGAGCGAG 7
  • R GGAAGCTTGAGCTCGAGATCTGAGTCCGGAATTAAGCTTGTGCCCCAGTTTG 8
  • Linker-mmaple3-Linker F TCTCGAGCTCAAGCTTCCGTGAGCAAAGGCGAGGAG 9
  • R ACCTCCGCCTGAACCGCCACCTCCCGACTTATAGAGTTCGTCCATGCTGTC 10
  • Linker-CD9 F GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCCGGTCAAAGGAGGCAC 11
  • R CCCTCTAGTCTAGAGACCATCTCGCGGTTCC 12
  • cDNA encoding the fusion protein was cloned into pCMV14 vector using EcoR1 and Xba1 restriction enzymes so that the fusion protein could be expressed in Mammalia cells.
  • pCMV14-TagBFP-mMaple3-CD9 was transfected into HEK293T cells using PEI (polyethylenimine), the expression of the fusion protein was confirmed as shown in FIG. 2 .
  • KikGR and Kaede require light of 400 nm or less to be cleaved.
  • it is safer when it is expressed in cells and then cut or put into exosomes and cut, and it was confirmed that mMaple3 is cut with light of 400 nm or more.
  • photocleavable proteins expressed in cells there may be photocleavable proteins that are not fully folded until fluorescence is measured.
  • mMaple3 No. indicating the number of photoactivatable fluorescent protein (PAFP) detected by fluorescence per cell/actual PAFP expression level. It was confirmed that the efficiency of cleavage and fluorescence was superior to that of other photocleavable proteins due to the high level of localizations per cell.
  • PAFP photoactivatable fluorescent protein
  • the CIBN-CRY2 system shown in FIG. 3a uses two light-specific binding proteins, two constructs must always be used. It falls For example, if the transfection efficiency is 80%, the probability that both constructs will be transfected into one cell is 64%. On the other hand, since the mMaple system shown in FIG. 3B uses one construct, it is possible to express it in cells with better efficiency.
  • the CIBN-CRY2 system has to continuously apply 488 nm light to the cells while exosomes are being generated, so it can affect the cells.
  • the mMaple system cuts the photocleavable protein by applying light to the exosome after forming the exosome. At this time, the cleavage efficiency is very high, and if the cleavage efficiency is high, the transport protein that can move freely as much as the exosome is This means that there are a lot of
  • TagBFP-mMaple3-CD9 cDNA was transfected using PEI in the method of Example 1-1 to overexpress HEK293T cells, and then irradiated with light at 405 nm to effect cleavage by light was confirmed by confocal microscopy and Western blot in HEK293T cells.
  • FIG. 4a The results of the confocal microscope observation experiment are shown in FIG. 4a using a confocal microscope (LSM700) 24 hours after transfection to confirm the expression of the fusion protein with blue fluorescence (TagBFP) and green fluorescence (mMaple3), and 405 nm light After irradiation for 1 minute, 5 minutes, and 10 minutes, the cleavage of the fusion protein was confirmed by the reduced intensity of green fluorescence (maple3 before cleavage) and the intensity of red fluorescence (mmaple3 after cleavage) increased by measuring the intensity of the fluorescence. 4b.
  • LSM700 confocal microscope
  • Exosomes were isolated and purified from the medium of HEK293T cells overexpressing the fusion protein in Example 2 through a Tangential Fluid Filtration system.
  • TagBFP-mMaple3-CD9 cDNA was transfected using PEI. mycin)) medium. After 24 hours of medium replacement, the medium was first collected, and FBS-free DMEM (1% PS) medium was added again, and then the medium was collected secondly after 24 hours.
  • the exosomes from the medium collected in the first and second steps were separated and purified by TFF (tangential flow filtration) method. The separation and purification process of the exosome is shown schematically in FIG. 5 .
  • the concentration and size of the exosomes containing the fusion protein were measured by NTA (Nanoparticle Tracking Assay), DLS (Dyanmic Light Scattering) and microBCA (Bicinchoninic Acid Assay).
  • the average diameter of the exosomes was 132 nm as shown in FIG. 6a, and the average diameter of the exosomes was confirmed to be 117.7 ⁇ 10.28 nm as shown in FIG. 6b as a result of the DLS measurement, and the microBCA measurement results in FIG. 6c As shown, the protein concentration of the exosome containing the fusion protein was 1487 mg/mL, and it was confirmed that the amount of protein contained per exosome was 39.13 ng.
  • the intensity of blue fluorescence, green fluorescence, and red fluorescence in the exosome was measured with a BioTek microplate reader machine to confirm the cleavage effect of the fusion protein by the light of 405 nm and the blue fluorescent protein in the exosome. As shown in Fig., it was confirmed that there was no difference in the intensity of blue fluorescence before and after irradiation with 405 nm light, and the intensity of green fluorescence decreased significantly after irradiation with 405 nm light, whereas the intensity of red fluorescence increased by observing that exosomes The cleavage effect of the fusion protein and the presence of blue fluorescent protein in the exosome were confirmed.
  • Example 3 In order to confirm the location of the target protein (TagBFP) in the exosomes (+mMaple3 exosomes) containing the fusion protein (TagBFP-mMaple3-CD9) isolated in Example 3, a protease digestion assay was performed. .
  • the protein (ALIX) present inside the exosome including the target protein (TagBFP) is a protein It was found that it was well protected without being degraded by the degrading enzyme (proteinase k). On the other hand, it was confirmed that the protein (LAMP2) having a domain outside the exosome was degraded by the proteolytic enzyme regardless of whether Triton X-100 was treated. In addition, it was confirmed that the light of 405 nm does not affect the lipid bilayer of these exosomes.
  • Exosomes (+mMaple3 exosomes) containing the fusion protein (TagBFP-mMaple3-CD9) isolated in Example 3 and exosomes that do not contain specific proteins isolated and purified from HEK293T cell culture as a control (+Negative) exosomes) were treated with 405 nm light and then treated with HEK293T cells.
  • exosomes containing TagBFP-mMaple3-CD9 fusion protein were treated at a concentration of 5 x 10 9 particles/mL, and after 24 hours of exosome treatment, the HEK293T cells were treated with 4% paraformaldehyde. After fixing with the cytation 5 cell imaging machine, it was confirmed whether the blue fluorescent protein was delivered.
  • tdTomato red fluorescent protein
  • Cre-mMaple3-CD9 Cre fusion protein
  • exosomes containing the photocleavable protein according to the present invention are expected to be usefully used in the field of protein therapy by safely and efficiently delivering various therapeutic proteins into cells.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Dispersion Chemistry (AREA)
  • Hematology (AREA)
  • Organic Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Biochemistry (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biophysics (AREA)
  • Virology (AREA)
  • Botany (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용에 관한 것으로, 본 발명에 따른 엑소좀은 파랑 형광 단백질(TagBFP), 광 절단성 단백질(mMaple3), 및 엑소좀 특이적 마커 단백질(CD9)을 포함하는 융합단백질이 함유되어 있으며, 상기 엑소좀에 405nm의 빛을 조사할 경우, 광 절단성 단백질인 mMaple3가 절단되어 엑소좀 내 파랑 형광 단백질을 타겟 세포 내로 전달할 수 있음을 확인하였다. 또한, Cre 융합단백질(Cre-mMaple3-CD9)이 함유된 엑소좀에 405nm의 빛을 조사할 경우, 엑소좀 내 Cre 단백질을 동물 장기 내로 전달할 수 있음을 확인하였다. 이에, 본 발명에 따른 광 절단성 단백질을 함유한 엑소좀은 다양한 치료학적 단백질을 세포 내로 안전하고 효율적으로 전달함으로써 단백질 치료 분야에 유용하게 이용될 수 있을 것으로 기대된다.

Description

광 절단성 단백질을 포함하는 엑소좀 및 이의 이용
본 발명은 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용에 관한 것으로서, 보다 구체적으로는 목적 단백질 및 광 절단성 단백질인 mMaple3를 포함하는 융합단백질이 함유된 엑소좀 및 이의 이용에 관한 것이다.
본 출원은 2020년 02월 10일에 출원된 대한민국 특허출원 제10-2020-0015696호 및 2021년 02월 04일에 출원된 대한민국 특허출원 제10-2021-0015837호에 기초한 우선권을 주장하며, 해당 출원의 명세서 및 도면에 개시된 모든 내용은 본 출원에 원용된다.
현재 존재하는 단백질 치료법은 대부분 세포막 단백질을 타겟으로 한다. 하지만 많은 질병의 발병 인자들은 주로 세포 내부에 존재하며, 이러한 발병 인자를 타겟하기 위해서는 치료학적 단백질을 세포 내부로 전달하는 기술이 필요하다.
이에, 최근 목적 단백질을 세포 내로 직접 유입시키는 방법이 많이 연구되고 있는데, 이 중 하나인 지질 나노입자를 이용한 치료학적 단백질 전달 기술은 지질 나노입자가 치료학적 단백질로부터 효과적으로 분리되지 않는다는 문제점이 있으며, 바이러스의 세포 내부 침투 과정에 주요한 역할을 하는 단백질 전달체(PTD: Protein Transduction Domain)를 이용한 전달 기술은 단백질 전달체가 혈액이나 장액과 같은 체액에 노출될 경우 분해된다는 문제점이 있다.
따라서, 세포 내부에 존재하는 특정 질병의 발병 인자를 타겟하기 위해서는 치료학적 단백질을 효과적으로 세포 내부에 전달하는 기술이 필요한 실정이다.
한편, 엑소좀(Exosome)은 지질-이중층으로 구성된 소포(vesicle)로, 세포가 세포 외로 분비하는 물질의 구성체이다. 엑소좀은 세포-세포 간의 커뮤니케이션(cell-cell communication) 및 세포성 면역을 중재하는 기능적인 역할을 수행하기 위해, 세포 내의 생체분자인 단백질, 생체활성 지질 및 RNA(miRNA)를 수송(운반)하는 역할을 하는 것으로 알려져 있다. 이러한 엑소좀은 알츠하이머 등 신경질환의 바이오마커로도 연구되고 있으며, 뇌척수액과 혈액을 분리하는 혈액뇌관문(blood-brain barrier, BBB)을 투과할 정도로 선택적 투과성이 높아 특정 약물의 나노전달체(nanocarrier)와 같은 약물 전달 시스템의 개발에도 활용되고 있다.
치료학적 단백질을 전달하는 기술과 관련하여, 한국공개특허 제10-2018-0036134호에는 광 특이적 결합 단백질을 이용하여 super-repressor-Iκ단백질을 포함하는 엑소솜의 제조방법, 및 상기 제조 방법에 의해 제조된 엑소솜을 유효성분으로 함유하는 염증성 질환 예방 및 치료용 약학적 조성물이 공지되어 있으며, 일본공개특허 제2019-528674호에는 카고 단백질을 포함한 엑소좀의 대량 생성 방법, 엑소좀을 조제하기 위한 벡터, 상기 방법에 의해 조제된 카고 단백질을 포함한 엑소좀, 그로 인해 조제된 엑소좀을 사용함으로써 카고 단백질을 시토졸에 로딩하는 방법에 대해 공지되어 있다.
그러나, 상기 문헌들에는 엑소좀 내 융합단백질의 구성으로 광 특이적 결합 단백질을 개시하며, 이는 CIBN-CRY2 시스템으로서 광 특이적 결합 단백질 두개를 이용하기 때문에 세포에 발현시 두개의 construct를 co-transfection 시켜야 하므로 효율이 떨어지고, 엑소좀이 생성되는 동안 488nm의 빛을 계속 세포에 가해야 하므로 세포에 영향을 줄 수 있으며, 엑소좀에 담기는 수송 단백질 양의 손실이 생긴다. 또한, 엑소좀 형성 후 빛을 주지 않는 조건에서 CIBN과 CRY2의 결합이 유지되는 경우가 발생하면 수송 단백질이 자유롭게 움직이지 못하고 엑소좀 특이적 단백질에 묶여있을 수 있으며, 수송 단백질에 융합시키는 CRY2의 크기가 65kDa으로 크기 때문에 수송 단백질 고유의 기능에 영향을 줄 수가 있고, 세포에 발현이 잘 되었는지 확인하기 위해서는 EGFP 같은 형광 단백질을 따로 융합하여 사용해야 하며, 빛을 주지 않았을 때 CRY2와 CIBN의 결합이 떨어졌는지 확인할 방법이 없는 단점이 있다.
이에, 본 발명자들은 종래에 공지된 상기 CIBN-CRY2 시스템을 이용한 단백질 전달 기술의 단점을 극복하고 안전하고 효율적으로 단백질을 세포 내로 전달할 수 있는 방법을 개발하고자 하였다.
본 발명자들은 광 절단성 단백질인 mMaple3가 세포 내로 전달하고자 하는 목적 단백질에 결합된 융합단백질이 함유되어 있는 엑소좀에 빛을 조사할 경우, 상기 mMaple3가 절단되어 안전하고 효율적으로 엑소좀 내 목적 단백질을 타겟 세포 내로 전달할 수 있음을 확인하였는 바, 이에 기초하여 본 발명을 완성하였다.
이에, 본 발명의 목적은 목적 단백질, 광 절단성 단백질, 및 엑소좀 특이적 마커 단백질을 포함하는 융합단백질이 함유된 엑소좀 및 이의 이용을 제공하는 것이다.
그러나, 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 본 발명이 속하는 기술 분야의 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다.
상기와 같은 목적을 달성하기 위해 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 제공한다.
또한, 본 발명은 상기 엑소좀을 유효성분으로 포함하는, 목적 단백질의 세포 내 전달용 조성물을 제공한다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀에 빛을 조사하는 단계; 및
상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계를 포함하는, 시험관 내(in vitro) 목적 단백질의 세포 내 전달 방법을 제공한다.
또한, 본 발명은 (a) 단백질 후보약물 및 mMaple3를 포함하는 융합단백질을 함유한 엑소좀에 빛을 조사하는 단계;
(b) 상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계; 및
(c) 상기 목적 세포 내에서 mMaple3가 형광을 나타낼 경우, 단백질 후보약물이 세포 내로 전달된 것으로 확인하는 단계를 포함하는, 세포 내 전달용 단백질 후보약물의 스크리닝 방법을 제공한다.
본 발명의 일 구현예로서, 상기 융합단백질은 엑소좀 특이적 마커 단백질을 더 포함할 수 있다.
또한, 본 발명은 하기 단계를 포함하는, 상기 융합단백질의 제조방법을 제공한다:
(S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
(S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
(S3) 상기 융합단백질을 코딩하는 cDNA를 벡터에 도입한 후 세포에 트랜스펙션하여 융합단백질을 발현시키는 단계.
또한, 본 발명은 하기 단계를 포함하는, 상기 엑소좀의 제조방법을 제공한다:
(S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
(S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
(S3) 상기 융합단백질을 코딩하는 cDNA를 엑소좀 생산 세포에 트랜스펙션하고, 세포 배양 배지로부터 엑소좀을 분리 및 정제하는 단계.
본 발명의 일 구현예로서, 상기 (S2)에서 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하기 이전에, 증폭된 mMaple3의 cDNA 및 엑소좀 특이적 마커 단백질의 cDNA를 하나의 cDNA로 결합하는 단계를 포함할 수 있다.
본 발명의 다른 구현예로서, 상기 엑소좀 제조방법의 (S3)에서 엑소좀의 분리는 TFF(tangential flow filtration), 초원심분리(ultracentrifugation), 크기배제 크로마토그래피(size exclusion chromatography), 및 엑소좀 분리 키트(exosome isolation kit)로 이루어진 군으로부터 선택된 하나의 방법을 이용할 수 있다.
본 발명의 또 다른 구현예로서, 상기 mMaple3는 서열번호 1의 아미노산 서열을 포함할 수 있다.
본 발명의 또 다른 구현예로서, 상기 mMaple3는 서열번호 2의 염기서열을 포함하는 유전자에 의해 코딩될 수 있다.
본 발명의 또 다른 구현예로서, 상기 목적 단백질은 세포 내로 전달하고자 하는 단백질일 수 있다.
본 발명의 또 다른 구현예로서, 상기 목적 단백질은 질환 치료용 단백질 또는 질환 진단용 단백질일 수 있다.
본 발명의 또 다른 구현예로서, 상기 엑소좀 특이적 마커 단백질은 CD9, CD63, 및 CD81로 이루어진 군으로부터 선택된 하나 이상일 수 있다.
본 발명의 또 다른 구현예로서, 상기 엑소좀에 빛을 조사하는 단계를 통해 엑소좀 내 mMaple3가 절단될 수 있다.
본 발명의 또 다른 구현예로서, 상기 빛은 401nm 내지 480nm의 파장을 가질 수 있다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물을 개체에 투여하는 방법을 포함하는, 목적 단백질의 세포 내 전달 방법을 제공한다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물의, 목적 단백질을 세포 내로 전달하기 위한 용도를 제공한다.
또한, 본 발명은 목적 단백질의 세포 내 전달용 제제의 생산을 위한, 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀의 용도를 제공한다.
본 발명에 따른 엑소좀은 파랑 형광 단백질(TagBFP), 광 절단성 단백질(mMaple3), 및 엑소좀 특이적 마커 단백질(CD9)을 포함하는 융합단백질이 함유되어 있으며, 상기 엑소좀에 405nm의 빛을 조사할 경우, 광 절단성 단백질인 mMaple3가 절단되어 엑소좀 내 파랑 형광 단백질을 타겟 세포 내로 전달할 수 있음을 확인하였다. 또한 Cre 융합단백질(Cre-mMaple3-CD9)이 함유된 엑소좀에 405nm의 빛을 조사할 경우, 엑소좀 내 Cre 단백질을 동물 장기 내로 전달할 수 있음을 확인하였다. 따라서, 본 발명에 따른 광 절단성 단백질을 함유한 엑소좀은 다양한 치료학적 단백질을 세포 내로 안전하고 효율적으로 전달함으로써 단백질 치료 분야에 유용하게 이용될 수 있을 것으로 기대된다.
도 1은 본 발명의 일 구현예에 따른 목적 단백질(파랑 형광 단백질), 광 절단성 단백질, 및 엑소좀 특이적 마커 단백질을 결합시킨 융합단백질의 구조 및 이의 특징을 도식화하여 나타낸 것이다.
도 2는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)의 제조 과정 및 세포에서의 발현을 확인한 결과를 나타낸 것이다.
도 3a는 CIBN-CRY2 시스템을 간단하게 도식화하여 나타낸 것이다.
도 3b는 본 발명의 일 구현예에 따른 mMaple 시스템을 간단하게 도식화하여 나타낸 것이다.
도 4a는 본 발명의 일 구현예에 따른 HEK293T 세포 내에서 융합단백질(TagBFP-mMaple3-CD9)의 빛 조사에 의한 절단 효과를 공초점 현미경을 통해 확인한 결과이다.
도 4b는 상기 도 4a에 나타난 형광의 세기를 측정하여 그래프로 나타낸 것이다.
도 4c는 본 발명의 일 구현예에 따른 HEK293T 세포 내에서 융합단백질(TagBFP-mMaple3-CD9)의 빛 조사에 의한 절단 효과를 western blot을 통해 확인한 결과이다.
도 5는 본 발명의 일 구현예에 따른 엑소좀의 분리 및 정제 과정을 도식화하여 나타낸 것이다.
도 6a는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀의 크기를 NTA로 측정한 결과이다.
도 6b는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀의 크기를 DLS로 측정한 결과이다.
도 6c는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀의 농도를 microBCA로 측정한 결과이다.
도 6d는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀의 제타 전위를 측정한 결과이다.
도 6e는 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀의 초저온전자현미경(Cryo-TEM) 이미지 관찰 결과이다.
도 6f는 본 발명의 일 구현예에 따른 엑소좀 내에서 융합단백질(TagBFP-mMaple3-CD9)의 빛 조사에 의한 절단 효과를 western blot을 통해 확인한 결과이다.
도 6g는 본 발명의 일 구현예에 따른 엑소좀 내에서 융합단백질(TagBFP-mMaple3-CD9)의 빛 조사에 의한 절단 효과 및 엑소좀 내의 파랑 형광 단백질 함유 여부를 형광 세기 측정을 통해 확인한 결과이다.
도 7은 본 발명의 일 구현예에 따른 융합단백질(TagBFP-mMaple3-CD9)을 함유한 엑소좀에 Triton X-100, 단백질 분해 효소(proteinase K), 및 빛의 처리 유무에 따른 목적 단백질의 분해 여부를 확인한 결과이다.
도 8a 및 8b는 본 발명의 일 구현예에 따른 엑소좀 내 파랑 형광 단백질의 세포 내 전달 효과를 확인한 결과이다.
도 9는 본 발명의 일 구현예에 따른 융합단백질(Cre-mMaple3-CD9)을 함유한 엑소좀을 동물에 투여할 경우 엑소좀 내 Cre 단백질의 동물 장기 내 전달 효과를 확인한 결과이다.
본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 제공한다.
또한, 본 발명은 상기 엑소좀을 유효성분으로 포함하는, 목적 단백질의 세포 내 전달용 조성물을 제공한다.
또한, 본 발명은 하기 단계를 포함하는, 상기 융합단백질의 제조방법을 제공한다:
(S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
(S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
(S3) 상기 융합단백질을 코딩하는 cDNA를 벡터에 도입한 후 세포에 트랜스펙션하여 융합단백질을 발현시키는 단계.
또한, 본 발명은 하기 단계를 포함하는, 상기 엑소좀의 제조방법을 제공한다:
(S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
(S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
(S3) 상기 융합단백질을 코딩하는 cDNA를 엑소좀 생산 세포에 트랜스펙션하고, 세포 배양 배지로부터 엑소좀을 분리 및 정제하는 단계.
본 발명에 있어서, 상기 (S2)에서 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하기 이전에, 증폭된 mMaple3의 cDNA 및 엑소좀 특이적 마커 단백질의 cDNA를 하나의 cDNA로 결합하는 단계를 포함할 수 있다.
본 발명에 있어서, 상기 (S3)는 상기 융합단백질을 코딩하는 cDNA를 엑소좀 생산 세포에 트랜스펙션하고, 세포 배양 배지를 페니실린/스트렙토마이신을 포함하는 FBS-free DMEM 배지로 교체한 후 배지를 모으고, 상기 모은 배지로부터 엑소좀을 분리 및 정제하는 단계일 수 있다.
본 발명에 있어서, 상기 (S3)에서 엑소좀의 분리는 TFF(tangential flow filtration), 초원심분리(ultracentrifugation), 크기배제 크로마토그래피(size exclusion chromatography), 및 엑소좀 분리 키트(exosome isolation kit)로 이루어진 군으로부터 선택된 하나의 방법을 이용할 수 있으나, 이에 제한되지 않는다.
본 발명에 있어서, “융합단백질”은 두개 이상의 단백질 융합으로 생성된 단백질로서, 목적 단백질 및 mMaple3를 포함할 수 있으며, 엑소좀 특이적 마커 단백질을 더 포함할 수 있다. 상기 융합단백질을 구성하는 목적 단백질, mMaple3, 및 엑소좀 특이적 마커 단백질은 하나로 결합된 형태일 수 있으며, 예컨대 차례대로 목적 단백질-mMaple3-엑소좀 특이적 마커 단백질의 순서일 수 있고, 목적 단백질의 tracking이 필요할 경우 엑소좀 특이적 마커 단백질-mMaple3-목적 단백질의 순서일 수 있으나, 이들의 결합 순서에 제한은 없다.
본 발명에 있어서, “목적 단백질”은 광 절단성 단백질에 결합된 형태로 엑소좀 내에 존재하는 단백질로, 타겟하는 세포 내 또는 조직 내로 전달하고자 하는 단백질을 의미한다. 상기 목적 단백질은 질환 치료용 단백질 또는 질환 진단용 단백질일 수 있으며, 이의 종류에는 제한이 없다. 예컨대, 목적 단백질로 암 억제 단백질인 p53을 암 세포에 전달하여 암 치료 효과를 나타낼 수 있고, parkin 단백질에 발생하는 돌연변이로 인해 정상적인 기능을 하지 못하여 발생하는 파킨슨병에 있어서 정상적인 parkin 단백질을 뉴런으로 전달하여 파킨슨병 치료 효과를 나타낼 수 있으며, 차세대 줄기세포 치료법 연구에 있어 가장 중요한 과정인 환자 체세포를 줄기세포로 역분화 시키는 과정에서 필요한 단백질인 야마나카 인자로서 Oct4, Sox2, c-Myc, 및 Klf4 단백질을 효과적으로 환자의 체세포로 전달하여, 현재 줄기세포 역분화를 위해 사용되고 있는 바이러스 없이 줄기세포로의 역분화가 가능하다. 또한, 목적 단백질로서 Myogenin 및 MyoD와 같은 근육분화유도 단백질의 전달을 통해, 진행성 근력 저하, 위축, 및 근육섬유의 괴사를 특징으로 하는 근디스트로피(muscular dystrophy) 등의 퇴행성 근육병에 치료 효과를 나타낼 수 있고, 신경퇴행성 뇌질환 중 하나인 치매에서 뇌신경 보호효과가 있다고 알려진 NRF2 및 BDNF 단백질의 전달을 통해 치매 치료 효과를 나타낼 수 있으며, 백색지방세포를 갈색지방세포로 분화시키는 PGC1α, PPAR-γ와 같은 갈색지방유도인자의 전달을 통해 대사질환 치료 효과를 나타낼 수 있다. 본 발명의 일 구현예에서는 파랑 형광 단백질(blue fluorescent protein)인 TagBFP를 이용하여 이의 세포 내 전달 여부를 확인하였으며, Cre 단백질을 이용하여 이의 동물 장기 내 전달 여부를 확인하였다.
본 발명에 있어서, “목적 단백질의 세포 내 전달”은 엑소좀 내 광 절단성 단백질에 결합된 형태로 존재하는 목적 단백질을 엑소좀으로부터 타겟하는 세포의 내부로 이송하는 것을 의미한다.
본 발명에 있어서, “mMaple3”는 광 절단성 단백질로서, 상기 “광 절단성 단백질”은 특정 파장의 광(light)에 노출됐을 때 절단되는 단백질을 의미한다.
본 발명에 있어서, 상기 mMaple3는 서열번호 1의 아미노산 서열을 포함할 수 있으며, 서열번호 2의 염기서열을 포함하는 유전자에 의해 코딩될 수 있다.
본 발명에 있어서, “엑소좀 특이적 마커 단백질”은 엑소좀 외막에 위치하는 단백질로, 예컨대 CD9, CD63, 및 CD81로 이루어진 군으로부터 선택된 하나 이상일 수 있으며, 본 발명의 일 구현예에 따르면 CD9일 수 있으나, 이에 제한되지 않는다.
본 발명에 있어서, 상기 CD9은 서열번호 3의 아미노산 서열을 포함할 수 있으며, 서열번호 4의 염기서열을 포함하는 유전자에 의해 코딩될 수 있다.
본 발명에 있어서, “엑소좀(exosome)”은 세포 간 신호전달을 하기 위해, 단백질, DNA, RNA 등을 포집한 채로 세포 밖으로 분비되는 지질이중층으로 구성된 막 구조를 갖는 소낭(membrane vesicle)으로, 거의 모든 진핵 생물의 체액에 존재한다. 엑소좀의 직경은 10nm 내지 400nm, 10nm 내지 350nm, 10nm 내지 300nm, 10nm 내지 250nm, 10nm 내지 200nm, 10nm 내지 150nm, 50nm 내지 350nm, 50nm 내지 300nm, 50nm 내지 250nm, 50nm 내지 200nm, 50nm 내지 150nm, 100nm 내지 300nm, 100nm 내지 200nm, 또는 100nm 내지 150nm일 수 있으며, 다중소포체가 세포막과 융합될 때 세포로부터 방출되거나, 세포막으로부터 곧바로 방출된다.
상기 엑소좀은 당업계에 알려진 엑소좀 추출 방법을 이용하여 제조될 수 있으며, 추출 방법에 제한은 없다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀에 빛을 조사하는 단계; 및
상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계를 포함하는, 시험관 내(in vitro) 목적 단백질의 세포 내 전달 방법을 제공한다.
또한, 본 발명은 (a) 단백질 후보약물 및 mMaple3를 포함하는 융합단백질을 함유한 엑소좀에 빛을 조사하는 단계;
(b) 상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계; 및
(c) 상기 목적 세포 내에서 mMaple3가 형광을 나타낼 경우, 단백질 후보약물이 세포 내로 전달된 것으로 확인하는 단계를 포함하는, 세포 내 전달용 단백질 후보약물의 스크리닝 방법을 제공한다.
본 발명에 있어서, 상기 엑소좀에 빛을 조사하는 단계를 통해 엑소좀 내 mMaple3가 절단될 수 있으며, 이 때 상기 빛은 401nm 내지 480nm, 401nm 내지 470nm, 401nm 내지 460nm, 401nm 내지 450nm, 401nm 내지 440nm, 401nm 내지 430nm, 401nm 내지 420nm, 또는 401nm 내지 410nm의 파장을 가지는 것일 수 있으며, 400nm 이하의 빛은 자외선(UV)으로서 세포나 엑소좀에 처리시 데미지를 줄 수 있고, 480nm를 초과하는 파장을 가진 빛 또한 세포에 처리시 영향을 줄 수 있다. 본 발명에 있어서 상기 빛의 파장은 401nm 내지 480nm 범위라면 제한이 없으나, 본 발명의 일 구현예에 따르면 바람직하게는 405nm일 수 있다.
본 발명에 있어서, 상기 (c) 단계에서 mMaple3는 절단되지 않은 경우 초록 형광을 나타낼 수 있으며, 절단된 경우 빨강 형광을 나타낼 수 있다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물을 개체에 투여하는 방법을 포함하는, 목적 단백질의 세포 내 전달 방법을 제공한다.
본 발명에 있어서, “개체”란 상기 목적 단백질을 필요로 하는 대상을 의미하고, 보다 구체적으로는, 인간 또는 비-인간인 영장류, 생쥐(mouse), 개, 고양이, 말, 및 소 등의 포유류를 의미한다.
본 발명에 있어서, “투여”는 임의의 적절한 방법으로 개체에게 소정의 본 발명의 조성물을 제공하는 것을 의미한다.
또한, 본 발명은 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물의, 목적 단백질을 세포 내로 전달하기 위한 용도를 제공한다.
또한, 본 발명은 목적 단백질의 세포 내 전달용 제제의 생산을 위한, 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀의 용도를 제공한다.
본 발명의 일 실시예에서는 파랑 형광 단백질(TagBFP), 광 절단성 단백질(mMaple3) 및 엑소좀 특이적 마커 단백질(CD9)을 결합시킨 융합단백질(TagBFP-mMaple3-CD9)을 제조하고, 다른 광 절단성 단백질 종류와 비교하여 상기 mMaple3를 사용하였을 때 나타나는 장점 및 CIBN-CRY2 시스템과 비교하였을 때 mMaple 시스템이 나타내는 장점을 확인하였다(실시예 1 참조).
본 발명의 다른 실시예에서는 융합단백질(TagBFP-mMaple3-CD9)을 HEK293T 세포에 과발현 시킨 후, 405nm의 빛을 조사하였을 때, 405nm의 빛에 의해 mMaple3가 절단된 것을 HEK293T 세포 내에서 확인하였다(실시예 2 참조).
본 발명의 또 다른 실시예에서는 융합단백질(TagBFP-mMaple3-CD9)을 과발현시킨 HEK293T 세포의 배지로부터 엑소좀을 분리 및 정제하고, 405nm의 빛을 조사하였을 때, 405nm의 빛에 의해 mMaple3가 절단된 것을 엑소좀 내에서 확인하였다(실시예 3 참조).
본 발명의 또 다른 실시예에서는 융합단백질(TagBFP-mMaple3-CD9)이 함유된 엑소좀에 Triton X-100, 단백질 분해 효소(proteinase K), 및 405nm의 빛의 처리 유무에 따른 목적 단백질 분해 여부를 확인한 결과, Triton X-100을 처리하여 인위적으로 엑소좀의 지질 이중층을 투과 가능하게 하지 않는 한, 목적 단백질이 단백질 분해 효소에 의해 분해되지 않았으며, 405nm의 빛은 엑소좀의 지질 이중층에 영향을 주지 않는 것을 확인하였다(실시예 4 참조).
본 발명의 일 실험예에서는 융합단백질(TagBFP-mMaple3-CD9)이 함유된 엑소좀에 405nm의 빛을 조사하고 이를 HEK293T 세포에 처리하였을 때, 엑소좀 내 파랑 형광 단백질이 세포 내로 전달되는 것을 확인하였다(실험예 1 참조).
본 발명의 또 다른 실험예에서는 Cre 융합단백질(Cre-mMaple3-CD9)이 함유된 엑소좀에 405nm의 빛을 조사하고, 이를 Cre 단백질이 전달될 때 빨강 형광 단백질(tdTomato)이 발현되는 유전자변형 쥐에 투여하였을 경우, 엑소좀 내 Cre 단백질이 쥐의 장기 내로 전달되는 것을 확인하였다(실험예 2 참조).
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예 및 실험예를 제시한다. 그러나 하기의 실시예 및 실험예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예 및 실험예에 의해 본 발명의 내용이 한정되는 것은 아니다.
실시예 1. 융합단백질 제조 및 광 절단성 단백질 특징 비교
1-1. 융합단백질 제조
파랑 형광 단백질(TagBFP), 광 절단성 단백질(mMaple3) 및 엑소좀 특이적 마커 단백질(CD9)을 결합시킨 융합단백질(TagBFP-mMaple3-CD9)을 코딩하는 cDNA을 제조하고, 상기와 같이 제조한 cDNA로부터 번역되는 융합단백질의 구조 및 이의 특징을 도 1에 도식화하여 나타내었으며, 상기 TagBFP, mMaple3, 및 CD9 각각의 아미노산 서열 및 이를 코딩하는 유전자 서열을 하기 표 1에 나타내었다.
서열 서열번호
mMaple3 amino acid sequence MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPRKIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPKAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK 1
mMaple3 DNA sequence ATGGTGAGCAAAGGCGAGGAGACAATCATGTCCGTGATCAAGCCCGACATGAAGATCAAACTGAGGATGGAGGGCAACGTGAACGGCCACGCCTTCGTGATCGAGGGCGAAGGAAGCGGCAAGCCCTTCGAGGGCATCCAGACCATCGATCTGGAGGTCAAGGAGGGCGCTCCCCTCCCTTTCGCCTATGACATCCTGACCACCGCCTTCCACTACGGCAATAGGGTGTTCACCAAGTATCCCAGGAAGATCCCCGACTACTTCAAGCAGAGCTTCCCTGAGGGCTACAGCTGGGAGAGGAGCATGACATACGAGGACGGCGGCATCTGCAACGCCACCAACGACATCACAATGGAGGAGGACAGCTTCATCAACAAGATCCACTTCAAAGGCACAAACTTCCCCCCCAATGGCCCCGTGATGCAGAAGAGGACCGTGGGCTGGGAGGTGAGCACCGAGAAGATGTACGTGAGGGACGGCGTCCTGAAGGGCGACGTGAAGATGAAGCTCCTGCTCAAGGGCGGCAGCCACTACAGGTGCGACTTTAGGACCACCTATAAGGTGAAGCAGAAGGCTGTGAAGCTGCCCAAGGCCCACTTCGTCGACCATAGGATCGAGATCCTGTCCCACGACAAGGACTACAACAAGGTCAAGCTGTACGAGCACGCCGTCGCTAGGAACAGCACCGACAGCATGGACGAACTCTATAAG 2
CD9 amino acid sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV 3
CD9 DNA sequence ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGTCCTGTCCTGATGCCATCAAAGAGGTCTTCGACAATAAATTCCACATCATCGGCGCAGTGGGCATCGGCATTGCCGTGGTCATGATATTTGGCATGATCTTCAGTATGATCTTGTGCTGTGCTATCCGCAGGAACCGCGAGATGGTC 4
TagBFP amino acid sequence MSELIKENMHMKLYMEGTVDNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFLYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKLVGGSHLIANIKTTYRSKKPAKNLKMPGVYYVDYRLERIKEANNETYVEQHEVAVARYCDLPSKLGHKLN 5
TagBFP DNA sequence ATGAGCGAGCTGATTAAGGAGAACATGCACATGAAGCTGTACATGGAGGGCACCGTGGACAACCATCACTTCAAGTGCACATCCGAGGGCGAAGGCAAGCCCTACGAGGGCACCCAGACCATGAGAATCAAGGTGGTCGAGGGCGGCCCTCTCCCCTTCGCCTTCGACATCCTGGCTACTAGCTTCCTCTACGGCAGCAAGACCTTCATCAACCACACCCAGGGCATCCCCGACTTCTTCAAGCAGTCCTTCCCTGAGGGCTTCACATGGGAGAGAGTCACCACATACGAAGACGGGGGCGTGCTGACCGCTACCCAGGACACCAGCCTCCAGGACGGCTGCCTCATCTACAACGTCAAGATCAGAGGGGTGAACTTCACATCCAACGGCCCTGTGATGCAGAAGAAAACACTCGGCTGGGAGGCCTTCACCGAGACGCTGTACCCCGCTGACGGCGGCCTGGAAGGCAGAAACGACATGGCCCTGAAGCTCGTGGGCGGGAGCCATCTGATCGCAAACATCAAGACCACATATAGATCCAAGAAACCCGCTAAGAACCTCAAGATGCCTGGCGTCTACTATGTGGACTACAGACTGGAAAGAATCAAGGAGGCCAACAACGAGACCTACGTCGAGCAGCACGAGGTGGCAGTGGCCAGATACTGCGACCTCCCTAGCAAACTGGGGCACAAGCTTAAT 6
구체적으로, 먼저 TagBFP, mMaple3, CD9을 코딩하는 cDNA를 제조하여 각각 PCR을 통해 증폭시키고, 증폭시킨 mMaple3 및 CD9의 cDNA를 PCR을 통해 하나의 cDNA(mMaple3-CD9)로 결합하였다. 이어서, mMaple3-CD9 cDNA와 TagBFP cDNA를 PCR을 통해 하나의 cDNA(TagBFP-mMaple3-CD9)로 결합함으로써 융합단백질을 코딩하는 cDNA를 제작하였다. 본 발명에서 사용한 프라이머는 하기 표 2에 나타내었다.
DNA fragment for cloning Primer sequence 서열번호
TagBFP-Linker F: TATGCTGAATTCGCCACCATGAGCGAG 7
R: GGAAGCTTGAGCTCGAGATCTGAGTCCGGAATTAAGCTTGTGCCCCAGTTTG 8
Linker- mMaple3-Linker F: TCTCGAGCTCAAGCTTCCGTGAGCAAAGGCGAGGAG 9
R: ACCTCCGCCTGAACCGCCACCTCCCGACTTATAGAGTTCGTCCATGCTGTC 10
Linker-CD9 F: GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCCGGTCAAAGGAGGCAC 11
R: CCCTCTAGTCTAGAGACCATCTCGCGGTTCC 12
그런 다음, Mammalia 세포에서 상기 융합단백질이 발현할 수 있도록 융합단백질을 코딩하는 cDNA를 pCMV14 벡터에 EcoR1과 Xba1 제한효소를 이용하여 클로닝하였다. 상기 pCMV14-TagBFP-mMaple3-CD9을 HEK293T 세포에 PEI(polyethylenimine)을 이용하여 트랜스펙션 시켰을 때, 도 2에 나타낸 바와 같이 융합단백질의 발현이 확인되었다.
1-2. 광 절단성 단백질 종류에 따른 특징 비교
Dendra2, mEos2, tdEos, mKikGR, 및 Kaede 등 여러 종류의 광 절단성 단백질(PAFP) 및 mMaple3의 특성을 기존 문헌(S. Wang, et al, Proc. Natl. Acad. Sci. U.S.A. 111, 8452-8457 (2014))을 참고하여 비교함으로써 mMaple3가 상기 다른 광 절단성 단백질들과 비교하였을 때 나타내는 장점을 확인하였다.
그 결과, 하기 표 3에 나타낸 바와 같이 올리고머화 경향 및 응집력에서 많은 광 절단성 단백질은 보통 올리고머를 형성하려는 경향이 강한 반면, mMaple3는 모노머를 유지하려는 경향이 강하고 응집력이 약한 것을 확인하였다.
절단을 위한 빛의 파장을 나타내는 Switch λ결과와 관련하여, KikGR 및 Kaede는 절단되기 위해 400nm 이하의 빛을 필요로 하는데, 400nm 이하는 UV(자외선)로서 세포나 엑소좀에 처리시 데미지를 줄 수 있는 반면, 400nm 이상의 빛을 조사할 경우 세포에 발현 시킨 후 절단 시키거나 엑소좀에 넣어서 절단 시킬 때 더 안전하며, mMaple3는 400nm 이상의 빛으로 절단되는 것을 확인하였다.
세포 내에서 발현되는 광 절단성 단백질 중에는 형광을 측정할 때까지 폴딩이 다 이루어지지 않은 광 절단성 단백질이 존재할 수 있고, 폴딩이 완전이 다 이루어진 광 절단성 단백질 중에서도 일부만 빛에 의해 절단이 되어 형광을 나타내는데, mMaple3의 경우 세포당 형광으로 감지되는 PAFP(photoactivatable fluorescent protein) 수/실제 PAFP의 발현량을 나타내는 No. of localizations per cell 수치가 높아 다른 광 절단성 단백질에 비해 절단되어 형광을 나타내는 효율이 월등이 앞서는 것을 확인할 수 있었다.
또한, 대부분의 광 절단성 단백질이 산성 민감도를 가지고 있는 반면, mMaple3의 경우 보고된 산성 민감도가 없었다.
Figure PCTKR2021001634-appb-img-000001
1-3. CIBN-CRY2 시스템과 mMaple 시스템의 비교
도 3a에 나타낸 CIBN-CRY2 시스템은 광 특이적 결합 단백질 두개를 이용하기 때문에 항상 두개의 construct를 사용해야 하며, 이 경우 세포에 발현 시 두개의 construct를 공동-트랜스펙션(co-transfection) 시켜야 하므로 효율이 떨어진다. 예를 들면, 트랜스펙션 효율이 80%일 경우 두개의 construct가 모두 한 세포에 트랜스펙션될 확률은 64%가 된다. 반면, 도 3b에 나타낸 mMaple 시스템은 하나의 construct를 이용하기 때문에 세포에 더 좋은 효율로 발현시키는 것이 가능하다.
그리고, CIBN-CRY2 시스템은 엑소좀이 생성되는 동안 488nm의 빛을 계속 세포에 가해야 하므로 세포에 영향을 줄 수 있으며, 빛에 의한 CIBN과 CRY2의 결합 효율이 100% 일 수 없으므로 엑소좀에 담기는 수송 단백질 양의 손실이 생기는 단점이 있으나, mMaple 시스템은 애초에 수송 단백질이 광 절단성 단백질과 엑소좀 특이적 마커에 융합이 되어 있기 때문에 세포가 엑소좀을 형성할 때 손실되는 수송 단백질이 없고, 세포에 직접 빛을 가하지 않아도 되기 때문에 안전하다.
또한, CIBN-CRY2 시스템은 엑소좀을 형성한 후 빛을 주지 않는 조건에서 CIBN과 CRY2의 결합이 유지되는 경우가 발생할 수 있고 이럴 경우 수송 단백질이 자유롭게 움직이지 못하고 엑소좀 특이적 단백질에 묶여있을 수 있는 반면, mMaple 시스템은 엑소좀을 형성한 후 엑소좀에 빛을 가함으로써 광 절단성 단백질을 절단하는데 이 때 절단되는 효율이 매우 높고, 절단 효율이 높으면 그 만큼 자유롭게 움직일 수 있는 수송 단백질이 엑소좀에 많이 생긴다는 것을 의미한다.
아울러, CIBN-CRY2 시스템은 수송 단백질에 융합시키는 CRY2의 크기가 65kDa으로 크기 때문에 수송 단백질 고유의 기능에 영향을 줄 수가 있으며, 세포에 발현이 잘 되었는지 확인하기 위해서는 EGFP 같은 형광 단백질을 따로 융합하여 사용해야 하고, 빛을 주지 않았을 때 CRY2와 CIBN의 결합이 떨어졌는지 확인할 방법이 없는 단점이 있는 반면, mMaple 시스템은 절단된 후 수송 단백질에 붙어있는 광 절단성 단백질 파편의 크기가 불과 10kDa이여서 수송 단백질 고유의 기능에 영향을 줄 가능성이 매우 낮고, 광 절단성 단백질 자체가 형광 단백질이므로 세포에 발현이 제대로 되었는지 초록 형광으로 확인이 가능하며 엑소좀에 빛을 처리한 후 광 절단성 단백질이 잘 절단 되었는지도 빨강 형광으로 확인이 가능하다.
상기와 같이, 본 발명에 따른 광 절단성 단백질 mMaple3가 융합단백질에 포함될 경우 다른 종류의 광 절단성 단백질 및 CIBN-CRY2 시스템의 광 특이적 결합 단백질이 포함되는 경우에 비해 상기 실시예 1-2 및 1-3에서와 같은 장점을 나타내며, 이에 본 발명의 광 절단성 단백질 mMaple3를 포함하는 융합단백질을 이용하여 세포 내로의 단백질 전달 효과를 실험으로 확인하였다.
실시예 2. 융합단백질의 절단 확인
HEK293T 세포를 seeding하고 24시간 후에 상기 실시예 1-1의 방법으로 TagBFP-mMaple3-CD9 cDNA을 PEI를 이용하여 트랜스펙션 시켜 HEK293T 세포에 과발현 시킨 후, 405nm의 빛을 조사하여 빛에 의한 절단 효과를 HEK293T 세포 내에서 공초점 현미경과 웨스턴 블랏으로 확인하였다.
공초점 현미경 관찰 실험 결과는 도 4a에서 트랜스펙션 24 시간 뒤에 공초점 현미경(LSM700)을 이용하여 융합단백질의 발현 여부를 파랑 형광(TagBFP)과 초록 형광(mMaple3)으로 확인하고, 405nm의 빛을 1분, 5분, 및 10분간 조사한 후 융합단백질의 절단 여부를 감소한 초록 형광(절단 전 mMaple3)의 세기와 증가한 빨강 형광(절단 후 mMaple3)의 세기로 확인하였으며, 상기 형광의 세기를 측정하여 도 4b에 나타내었다.
그 결과, 도 4a 및 4b에 나타낸 바와 같이 405nm의 빛을 조사하기 전에는 mMaple3 자체의 초록 형광이 나타났으며, 405nm의 빛을 조사한 후 빨강 형광이 나타나는 것으로 보아 mMaple3 단백질이 절단된 것을 확인할 수 있었고, 405nm의 빛을 오래 조사할수록 광 절단성 단백질(mMaple3)이 절단되어 초록 형광이 줄어들고 빨강 형광이 증가하는 것을 확인하였다.
또한, 웨스턴 블랏을 이용하여 트랜스펙션 24시간 뒤에 405nm의 빛을 세포에 5분간 조사하고 T-per 버퍼를 이용하여 단백질을 추출하고, 추출한 단백질을 전기영동으로 분리한 후 융합단백질의 발현 및 405nm의 빛에 의한 융합단백질의 절단 여부를 확인하였으며, 그 결과 도 4c에 나타낸 바와 같이 405nm의 빛을 조사한 후 시간이 지날수록 절단되지 않은 융합단백질의 양이 감소하는 반면 절단된 융합단백질 절편의 양은 증가하는 것을 관찰함으로써 HEK293T 세포에서 mMaple3 단백질의 절단 효과를 확인하였다.
실시예 3. 엑소좀 분리 및 정제
상기 실시예 2에서 융합단백질을 과발현시킨 HEK293T 세포의 배지로부터 Tangential Fluid Filtration system을 통해 엑소좀을 분리 및 정제하였다.
구체적으로, HEK293T 세포를 seeding하고 24시간 후에 TagBFP-mMaple3-CD9 cDNA을 PEI를 이용하여 트랜스펙션 시켰으며, 트랜스펙션 24시간 뒤에 세포 배양 배지를 FBS-free DMEM (1% PS(페니실린/스트렙토마이신)) 배지로 교체하였다. 배지 교체 24시간 후 1차로 배지를 모으고 다시 FBS-free DMEM (1% PS) 배지를 넣어준 다음 24시간 후 2차로 배지를 모았다. 상기 1, 2차에서 모은 배지에서 엑소좀을 TFF(tangential flow filtration) 방법으로 분리 및 정제하였다. 상기 엑소좀의 분리 및 정제 과정은 도 5에 도식화하여 나타내었다.
상기 방법으로 엑소좀을 분리 및 정제한 후, 상기 융합단백질을 함유한 엑소좀의 농도 및 크기를 NTA(Nanoparticle Tracking Assay), DLS(Dyanmic Light Scattering) 및 microBCA(Bicinchoninic Acid Assay)로 측정하였다.
NTA 측정 결과, 도 6a에 나타낸 바와 같이 엑소좀의 평균 직경은 132nm로 나타났고, DLS 측정 결과 도 6b에 나타낸 바와 같이 엑소좀의 평균 직경이 117.7±10.28nm로 확인되었으며, microBCA 측정 결과 도 6c에 나타낸 바와 같이 융합단백질 함유 엑소좀의 단백질 농도는 1487mg/mL으로 나타났으며, 엑소좀 1개 당 함유하고 있는 단백질양은 39.13ng임을 확인하였다.
또한, 엑소좀의 제타 전위(zeta potential)를 측정한 결과, 도 6d에 나타낸 바와 같이 평균 -19.3±0.8mV로 확인되었으며, 엑소좀의 초저온전자현미경(Cryo-TEM) 이미지 관찰 데이터를 도 6e에 나타내었다(스케일 바: 100nm)
아울러, 상기 엑소좀에서 405nm의 빛에 의한 융합단백질의 절단 효과를 웨스턴 블랏으로 확인한 결과, 도 6f에 나타낸 바와 같이 405nm의 빛을 조사한 후 시간이 지날수록 절단되지 않은 융합단백질의 양이 감소하는 반면 절단된 융합단백질 절편의 양은 증가하는 것을 관찰함으로써 엑소좀에서 mMaple3 단백질의 절단 효과를 확인하였다.
405nm의 빛에 의한 융합단백질의 절단 효과 및 엑소좀 내의 파랑 형광 단백질 함유 여부를 한번 더 확인하기 위해 엑소좀에서 파랑 형광, 초록 형광, 빨강 형광의 세기를 BioTek microplate reader 기계로 측정한 결과, 도 6g에 나타낸 바와 같이 파랑 형광의 세기는 405nm의 빛을 조사하기 전과 후에 차이가 없음을 확인했고 초록 형광의 세기는 405nm의 빛을 조사한 후 크게 감소하는 반면 빨강 형광의 세기는 증가하는 것을 관찰함으로써 엑소좀에서 융합단백질의 절단 효과 및 엑소좀 내의 파랑 형광 단백질 함유 여부를 확인하였다.
실시예 4. 엑소좀에서 목적 단백질의 위치 확인
상기 실시예 3에서 분리한, 융합단백질(TagBFP-mMaple3-CD9)이 함유된 엑소좀(+mMaple3 exosomes)에서 목적 단백질(TagBFP)의 위치를 확인하기 위해 프로테아제 소화 분석(protease digestion assay)을 진행하였다.
구체적으로, 엑소좀의 지질 이중층을 투과 가능하게 하는 Triton X-100과 단백질 분해 효소(proteinase k)의 처리 여부에 따른 목적 단백질의 분해 여부를 확인하였다.
그 결과, 도 7에 나타낸 바와 같이, Triton X-100을 이용하여 인위적으로 엑소좀의 지질 이중층을 투과 가능하게 하지 않는 한 목적 단백질(TagBFP)을 비롯한 엑소좀 내부에 존재하는 단백질(ALIX)이 단백질 분해 효소(proteinase k)로 부터 분해되지 않고 잘 보호됨을 알 수 있었다. 반면 엑소좀 외부에 도메인을 가지고 있는 단백질(LAMP2)은 Triton X-100의 처리 여부와 상관없이 단백질 분해 효소로부터 분해됨을 확인하였다. 또한, 405nm의 빛은 이러한 엑소좀의 지질 이중층에 영향을 주지 않는 것을 확인하였다.
실험예 1. 엑소좀 내 단백질의 세포 내 전달 확인
상기 실시예 3에서 분리한, 융합단백질(TagBFP-mMaple3-CD9)이 함유된 엑소좀(+mMaple3 exosomes) 및 대조군으로 HEK293T 세포 배양액으로부터 분리 및 정제한 특정 단백질을 함유하고 있지 않은 엑소좀(+Negative exosomes)에 405nm의 빛을 처리하고 HEK293T 세포에 처리하였다.
구체적으로, HEK293T 세포를 seeding하고 24시간 후에 TagBFP-mMaple3-CD9 융합단백질 함유 엑소좀을 5 x 10 9 particles/mL의 농도로 처리하였고, 엑소좀 처리 24시간 후 상기 HEK293T 세포를 4% 파라포름알데히드로 고정시킨 후 cytation 5 세포 이미징 기계로 파랑 형광 단백질의 전달 여부를 확인하였다.
그 결과, 도 8a에 나타낸 바와 같이 mMaple3를 함유한 엑소좀을 처리했을 때 세포 내에 파랑 형광(TagBFP)이 나타난 것을 관찰하였으며, 엑소좀에 빛을 처리함에 따라 초록 형광(FL mMaple3)이 감소하고 빨강 형광(CL mMaple3)이 증가된 것을 확인하였다.
또한, 상기 엑소좀을 동일한 방법으로 HeLa 세포에 처리한 후 세포 내 파랑 형광 단백질의 전달 여부를 확인한 결과, 도 8b에 나타낸 바와 같이, HeLa 세포에서도 파랑 형광이 나타나는 것을 확인하였으며, 엑소좀에 빛을 처리하였을 때 초록 형광이 감소하고 빨강 형광이 증가된 것을 확인하였다.
이로부터 TagBFP-mMaple3-CD9이 함유된 엑소좀에서 405nm의 빛 처리에 의해 mMaple3가 절단되어 파랑 형광 단백질(TagBFP)이 세포 내로 전달된 것을 확인할 수 있었다.
실험예 2. 엑소좀 내 단백질의 동물 장기 내 전달 확인
상기 실시예 3과 같은 방법으로 분리한, Cre 융합단백질(Cre-mMaple3-CD9)이 함유된 엑소좀에 405nm의 빛을 처리하고, Cre 단백질이 전달될 때 빨강 형광 단백질(tdTomato)이 발현되는 유전자변형 쥐에 투여하였다.
구체적으로, 유전자변형 쥐에 인산완충생리식염수(PBS) 또는 빛을 처리한 엑소좀(Cre:MAPLEX) 500μg을 꼬리 혈관에 투여한 후 1, 6, 24시간 뒤에 빨강 형광의 세기를 IVIS 소형 동물 이미징 기계로 측정하였다.
그 결과, 도 9에 나타낸 바와 같이 빛을 처리한 엑소좀을 투여한 쥐의 간에서 빨강 형광의 세기가 증가된 것을 확인하였다. 이로부터 Cre-mMaple3-CD9이 함유된 엑소좀에서 405nm의 빛 처리에 의해 mMaple3가 절단되어 Cre 단백질이 장기 내로 효과적으로 전달됨을 확인할 수 있었다.
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야 한다.
본 발명에 따른 광 절단성 단백질을 함유한 엑소좀은 다양한 치료학적 단백질을 세포 내로 안전하고 효율적으로 전달함으로써 단백질 치료 분야에 유용하게 이용될 수 있을 것으로 기대된다.

Claims (24)

  1. 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀.
  2. 제1항에 있어서,
    상기 mMaple3는 서열번호 1의 아미노산 서열을 포함하는 것을 특징으로 하는, 엑소좀.
  3. 제1항에 있어서,
    상기 mMaple3는 서열번호 2의 염기서열을 포함하는 유전자에 의해 코딩되는 것을 특징으로 하는, 엑소좀.
  4. 제1항에 있어서,
    상기 융합단백질은 엑소좀 특이적 마커 단백질을 더 포함하는 것을 특징으로 하는, 엑소좀.
  5. 제1항에 있어서,
    상기 목적 단백질은 세포 내로 전달하고자 하는 단백질인 것을 특징으로 하는, 엑소좀.
  6. 제5항에 있어서,
    상기 목적 단백질은 질환 치료용 단백질 또는 질환 진단용 단백질인 것을 특징으로 하는, 엑소좀.
  7. 제4항에 있어서,
    상기 엑소좀 특이적 마커 단백질은 CD9, CD63, 및 CD81로 이루어진 군으로부터 선택된 하나 이상인 것을 특징으로 하는, 엑소좀.
  8. 제1항 내지 제7항 중 어느 한 항의 엑소좀을 유효성분으로 포함하는, 목적 단백질의 세포 내 전달용 조성물.
  9. 제8항에 있어서,
    상기 목적 단백질은 세포 내로 전달하고자 하는 단백질인 것을 특징으로 하는, 조성물.
  10. 제9항에 있어서,
    상기 목적 단백질은 질환 치료용 단백질 또는 질환 진단용 단백질인 것을 특징으로 하는, 조성물.
  11. 하기 단계를 포함하는, 제1항의 융합단백질의 제조방법:
    (S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
    (S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
    (S3) 상기 융합단백질을 코딩하는 cDNA를 벡터에 도입한 후 세포에 트랜스펙션하여 융합단백질을 발현시키는 단계.
  12. 제11항에 있어서,
    상기 (S2)에서 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하기 이전에, 증폭된 mMaple3의 cDNA 및 엑소좀 특이적 마커 단백질의 cDNA를 하나의 cDNA로 결합하는 단계를 포함하는 것을 특징으로 하는, 융합단백질의 제조방법.
  13. 하기 단계를 포함하는, 제1항의 엑소좀의 제조방법:
    (S1) 목적 단백질 및 mMaple3의 cDNA를 각각 증폭시키는 단계;
    (S2) 상기 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하여, 목적 단백질 및 mMaple3를 포함하는 융합단백질을 코딩하는 cDNA를 제조하는 단계; 및
    (S3) 상기 융합단백질을 코딩하는 cDNA를 엑소좀 생산 세포에 트랜스펙션하고, 세포 배양 배지로부터 엑소좀을 분리 및 정제하는 단계.
  14. 제13항에 있어서,
    상기 (S2)에서 증폭된 목적 단백질 및 mMaple3의 cDNA를 하나의 cDNA로 결합하기 이전에, 증폭된 mMaple3의 cDNA 및 엑소좀 특이적 마커 단백질의 cDNA를 하나의 cDNA로 결합하는 단계를 포함하는 것을 특징으로 하는, 엑소좀의 제조방법.
  15. 제13항에 있어서,
    상기 (S3)에서 엑소좀의 분리는 TFF(tangential flow filtration), 초원심분리(ultracentrifugation), 크기배제 크로마토그래피(size exclusion chromatography), 및 엑소좀 분리 키트(exosome isolation kit)로 이루어진 군으로부터 선택된 하나의 방법을 이용하는 것을 특징으로 하는, 엑소좀의 제조방법.
  16. 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀에 빛을 조사하는 단계; 및
    상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계를 포함하는, 시험관 내(in vitro) 목적 단백질의 세포 내 전달 방법.
  17. 제16항에 있어서,
    상기 엑소좀에 빛을 조사하는 단계를 통해 엑소좀 내 mMaple3가 절단되는 것을 특징으로 하는, 방법.
  18. 제16항에 있어서,
    상기 빛은 401nm 내지 480nm의 파장을 가지는 것을 특징으로 하는, 방법.
  19. (a) 단백질 후보약물 및 mMaple3를 포함하는 융합단백질을 함유한 엑소좀에 빛을 조사하는 단계;
    (b) 상기 빛을 조사한 엑소좀을 목적 세포에 처리하는 단계; 및
    (c) 상기 목적 세포 내에서 mMaple3가 형광을 나타낼 경우, 단백질 후보약물이 세포 내로 전달된 것으로 확인하는 단계를 포함하는, 세포 내 전달용 단백질 후보약물의 스크리닝 방법.
  20. 제19항에 있어서,
    상기 (a) 단계에서 빛을 조사하는 경우 엑소좀 내 mMaple3가 절단되는 것을 특징으로 하는, 스크리닝 방법.
  21. 제19항에 있어서,
    상기 빛은 401nm 내지 480nm의 파장을 가지는 것을 특징으로 하는, 스크리닝 방법.
  22. 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물을 개체에 투여하는 방법을 포함하는, 목적 단백질의 세포 내 전달 방법.
  23. 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀을 포함하는 조성물의, 목적 단백질을 세포 내로 전달하기 위한 용도.
  24. 목적 단백질의 세포 내 전달용 제제의 생산을 위한, 목적 단백질 및 mMaple3를 포함하는 융합단백질이 함유된 엑소좀의 용도.
PCT/KR2021/001634 2020-02-10 2021-02-08 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용 WO2021162375A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP21752871.0A EP4104860A4 (en) 2020-02-10 2021-02-08 EXOSOME WITH LIGHT-SPLITABLE PROTEIN AND USE THEREOF
US17/798,524 US20230211010A1 (en) 2020-02-10 2021-02-08 Exosome comprising photocleavable protein, and use thereof
CN202180013300.1A CN115103859A (zh) 2020-02-10 2021-02-08 包含可光切割蛋白的外排体及其用途
JP2022548161A JP7479078B2 (ja) 2020-02-10 2021-02-08 光切断性タンパク質を含むエクソソーム及びその用途

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20200015696 2020-02-10
KR10-2020-0015696 2020-02-10
KR10-2021-0015837 2021-02-04
KR1020210015837A KR102688170B1 (ko) 2020-02-10 2021-02-04 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용

Publications (1)

Publication Number Publication Date
WO2021162375A1 true WO2021162375A1 (ko) 2021-08-19

Family

ID=77292881

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/001634 WO2021162375A1 (ko) 2020-02-10 2021-02-08 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용

Country Status (5)

Country Link
US (1) US20230211010A1 (ko)
EP (1) EP4104860A4 (ko)
JP (1) JP7479078B2 (ko)
CN (1) CN115103859A (ko)
WO (1) WO2021162375A1 (ko)

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170190749A1 (en) * 2014-02-11 2017-07-06 The Governors Of The University Of Alberta Genetically encoded photocleavable proteins
KR20180036134A (ko) 2016-09-30 2018-04-09 한국과학기술원 super-repressor-IκB 단백질을 포함하는 엑소솜의 제조 방법 및 상기 제조 방법에 의해 제조된 엑소솜을 유효성분으로 함유하는 염증성 질환 예방 및 치료용 약학적 조성물
KR20190011279A (ko) * 2016-05-25 2019-02-01 에복스 테라퓨틱스 리미티드 치료학적 폴리펩타이드를 포함하는 엑소좀
JP2019528674A (ja) 2016-09-30 2019-10-17 セレックス ライフ サイエンシズ，インコーポレーテッド タンパク質をロードしたエキソソームを含む組成物、並びにその調製及び送達のための方法
KR20200015696A (ko) 2017-06-05 2020-02-12 우후 메이디 키친 앤드 바스 어플라이언스이즈 엠에프지 컴퍼니 리미티드 연소기 및 이를 구비하는 가스 온수기
KR20210015837A (ko) 2018-05-29 2021-02-10 신유알엑스 인터내셔널 (타이완) 코포레이션 D-아미노산 산화효소(daao)의 강력한 억제제 및 이의 용도

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015160690A1 (en) * 2014-04-14 2015-10-22 President And Fellows Of Harvard College Photoconvertible fluorescent proteins
CN107446052A (zh) 2017-06-09 2017-12-08 上海科技大学 多功能复合超分子纳米纤维自组装体系及其应用

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170190749A1 (en) * 2014-02-11 2017-07-06 The Governors Of The University Of Alberta Genetically encoded photocleavable proteins
KR20190011279A (ko) * 2016-05-25 2019-02-01 에복스 테라퓨틱스 리미티드 치료학적 폴리펩타이드를 포함하는 엑소좀
KR20180036134A (ko) 2016-09-30 2018-04-09 한국과학기술원 super-repressor-IκB 단백질을 포함하는 엑소솜의 제조 방법 및 상기 제조 방법에 의해 제조된 엑소솜을 유효성분으로 함유하는 염증성 질환 예방 및 치료용 약학적 조성물
JP2019528674A (ja) 2016-09-30 2019-10-17 セレックス ライフ サイエンシズ，インコーポレーテッド タンパク質をロードしたエキソソームを含む組成物、並びにその調製及び送達のための方法
KR20200015696A (ko) 2017-06-05 2020-02-12 우후 메이디 키친 앤드 바스 어플라이언스이즈 엠에프지 컴퍼니 리미티드 연소기 및 이를 구비하는 가스 온수기
KR20210015837A (ko) 2018-05-29 2021-02-10 신유알엑스 인터내셔널 (타이완) 코포레이션 D-아미노산 산화효소(daao)의 강력한 억제제 및 이의 용도

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
JRADI FADI M., LAVIS LUKE D.: "Chemistry of photosensitive fluorophores for single-molecule localization microscopy", ACS CHEMICAL BIOLOGY, vol. 14, no. 6, 21 June 2019 (2019-06-21), pages 1077 - 1090, XP055836320, ISSN: 1554-8929, DOI: 10.1021/acschembio.9b00197 *
KABERNIUK ANDRII A., MOHR MANUEL A., VERKHUSHA VLADISLAV V., SNAPP ERIK LEE: "moxMaple3: a Photoswitchable Fluorescent Protein for PALM and Protein Highlighting in Oxidizing Cellular Environments", SCIENTIFIC REPORTS, vol. 8, no. 1, 1 December 2018 (2018-12-01), pages 1 - 10, XP055836321, DOI: 10.1038/s41598-018-32955-5 *
RENEE WEI-YAN CHOW, JULIEN VERMOT: "The rise of photoresponsive protein technologies applications in vivo: a spotlight on zebrafish developmental and cell biology", F1000RESEARCH, vol. 6, 1 January 2017 (2017-01-01), pages 1 - 18, XP055476498, DOI: 10.12688/f1000research.10617.1 *
S. WANG ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 111, 2014, pages 8452 - 8457
See also references of EP4104860A4

Also Published As

Publication number Publication date
EP4104860A4 (en) 2024-03-06
CN115103859A (zh) 2022-09-23
JP7479078B2 (ja) 2024-05-08
JP2023513535A (ja) 2023-03-31
EP4104860A1 (en) 2022-12-21
US20230211010A1 (en) 2023-07-06

Similar Documents

Publication Publication Date Title
WO2018030608A1 (ko) Cas9 단백질 및 가이드 RNA의 혼성체를 함유하는 나노 리포좀 전달체 조성물
Uetsuki et al. Activation of neuronal caspase-3 by intracellular accumulation of wild-type Alzheimer amyloid precursor protein
WO2016133254A1 (ko) 세포의 지질막에서 유래된 나노소포체 및 이의 용도
WO2015137705A1 (ko) 세포 투과성 펩티드 및 이를 이용한 생물학적 활성 물질의 전달방법
WO2022065919A1 (ko) 펩티드 핵산 복합체를 유효성분으로 함유하는 치매 예방 또는 치료용 조성물
WO2020060128A1 (ko) 세포 침투 효과가 우수한 보툴리늄 유래 펩타이드를 포함하는 화장료 조성물
WO2012099448A2 (ko) αΑ-크리스탈린 유전자를 발현하는 재조합 아데노바이러스 및 이를 이용한 망막혈관 질환의 유전자 치료
WO2016126098A1 (en) Modified dkk2 protein, nucleic acid encoding the same, preparation method thereof, and use thereof
WO2021162375A1 (ko) 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용
WO2020091463A1 (ko) 분리된 미토콘드리아를 포함하는 건병증 예방 또는 치료용 약학 조성물
WO2022164288A1 (ko) 비염증성 식세포작용 유도 활성을 갖는 융합분자
WO2012161519A1 (en) An adult stem cell line introduced with hepatocyte growth factor gene and neurogenic transcription factor gene with basic helix-loop-helix motif and uses thereof
WO2018203613A1 (ko) 톨-유사 수용체(tlr) 억제를 위한 펩타이드 및 이를 포함하는 약학적 조성물
WO2023027317A1 (ko) 편도 중간엽 줄기세포 유래 엑소좀을 포함하는 근육 감소 관련 질환 치료용 조성물
KR20200138798A (ko) C-말단 cdnf 단편, 이를 포함하는 약학적 조성물 및 그 용도
WO2014109617A1 (ko) HtrA2 단백질을 유효성분으로 포함하는 자가면역질환의 예방 또는 치료용 조성물
WO2022139071A1 (ko) 신규한 세포 투과성 펩타이드 및 이의 용도
WO2021040473A1 (ko) 혈류 변화 부위 타겟팅 나노베지클을 이용한 동맥경화의 진단 및 치료 방법
KR20210102079A (ko) 광 절단성 단백질을 포함하는 엑소좀 및 이의 이용
WO2020241925A1 (ko) 세포투과성 물질이 융합된 앱타이드가 포집된 지질 나노 입자 복합체 및 이의 용도
WO2024106955A1 (ko) 고리형 단백질의 제조방법 및 이의 응용
WO2023038479A1 (ko) 생체분자의 안정적 발현 및 전달을 위한 플라스미드 플랫폼
WO2020242147A1 (ko) 마이셀 구조의 나노 전달체 및 이의 용도
WO2023106807A1 (en) Novel reconstituted high density lipoprotein nanoparticle
WO2023172101A1 (ko) 광유전학적으로 활성화 가능한 팔미토일화 조절 단백질 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21752871

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022548161

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021752871

Country of ref document: EP

Effective date: 20220912