WO2021108693A1 - Combination therapies for treating cancer - Google Patents

Combination therapies for treating cancer Download PDF

Info

Publication number
WO2021108693A1
WO2021108693A1 PCT/US2020/062402 US2020062402W WO2021108693A1 WO 2021108693 A1 WO2021108693 A1 WO 2021108693A1 US 2020062402 W US2020062402 W US 2020062402W WO 2021108693 A1 WO2021108693 A1 WO 2021108693A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
domain variant
sirpa
polypeptide
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/062402
Other languages
English (en)
French (fr)
Inventor
Hong Wan
Bang Janet SIM
Sophia Randolph
Jaume Pons
Tracy Chia-Chien KUO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ALX Oncology Inc
Original Assignee
ALX Oncology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2020394204A priority Critical patent/AU2020394204A1/en
Priority to BR112022008817A priority patent/BR112022008817A2/pt
Priority to CN202080090447.6A priority patent/CN114845710A/zh
Priority to JP2022530167A priority patent/JP7713447B2/ja
Priority to MX2022006078A priority patent/MX2022006078A/es
Priority to CN202511210212.7A priority patent/CN121243368A/zh
Priority to KR1020227021105A priority patent/KR20220107223A/ko
Priority to CA3162633A priority patent/CA3162633A1/en
Application filed by ALX Oncology Inc filed Critical ALX Oncology Inc
Priority to EP20825371.6A priority patent/EP4065101A1/en
Priority to IL293199A priority patent/IL293199A/en
Publication of WO2021108693A1 publication Critical patent/WO2021108693A1/en
Anticipated expiration legal-status Critical
Priority to JP2025066099A priority patent/JP2025118648A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • A61K31/17Amides, e.g. hydroxamic acids having the group >N—C(O)—N< or >N—C(S)—N<, e.g. urea, thiourea, carmustine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/28Compounds containing heavy metals
    • A61K31/282Platinum compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/337Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/513Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/517Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • A61K31/52Purines, e.g. adenine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/555Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/63Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide
    • A61K31/635Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • A61K31/7072Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid having two oxo groups directly attached to the pyrimidine ring, e.g. uridine, uridylic acid, thymidine, zidovudine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00Medicinal preparations containing inorganic active ingredients
    • A61K33/24Heavy metals; Compounds thereof
    • A61K33/243Platinum; Compounds thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/55Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to methods of treating cancer that comprise administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPot) in conjunction with a chemotherapy agent and at least one additional anti-cancer agent and/or at least one additional mode of cancer therapy.
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g., hSIRPot
  • Tumor cells manipulate the myeloid compartment to evade the anti-tumor host immune response (Gabrilovich et al, Nat Rev Immunol (2012) I2(4):253-68).
  • CD47 expressed on the surface of normal cells binds SIRPa on macrophages and provides a “don't eat me” signal
  • tumor cells have also been found to overexpress CD47 to evade the macrophage component of immune surveillance (Oldenborg, ISRN Hematol (2013) 614619).
  • Macrophage-mediated destruction of cancer cells requires both the disruption of “don't eat me” signals ⁇ e.g., CD47- SIRPa) and the activation of “eat me” signals. Neither component alone is sufficient to trigger maximal phagocytic reaction against tumor cells.
  • CD47 provides a fundamental “don’t eat me” signal through its interaction with SIRPa on macrophages.
  • the pro-phagocytic “eat me” signal can be provided to the same macrophages by binding to their activating Fc gamma receptors.
  • the pro- phagocytic "‘eat me” signal can be provided by binding of anti-tumor antibodies to Fc receptors on macrophages.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRPa D1 domain variant and an Fc domain variant, and (b) a Bcl-2 inhibitor; wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii i) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat
  • the cancer is leukemia, multiple myeloma, or non-Hodgkin’s lymphoma in some embodiments, the non-Hodgkin’s lymphoma is diffuse large B-cell lymphoma (DLBCL), mantle cell lymphoma (MCL), or follicular lymphoma (FL).
  • die leukemia is acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), Chrome myeloid leukemia (CML), acute myeloid leukemia (AML), or myelodysplastic syndrome (MDS).
  • the leukemia is acute lymphoblastic leukemia.
  • the Bcl-2 inhibitor is venetoclax, ABT-737, navitoclax, BCL201, or AZD-0466. In some embodiments, the Bcl-2 inhibitor is venetoclax.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRPa D1 domain variant and an Fc domain variant, and (b) a platinum-based chemotherapy agent; wherein the SIRPa D1 domain variant comprises the ammo acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fe domain variant is (i) a human IgGl Fe region comprising L234A, L235 A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P3318, andN297A mutations, wherein numbering is according to the EU index of Kabat; (hi) a human IgG4 Fc region comprising S2.28P, E233P, F234V, L235A, and ddG2.36 mutations, wherein numbering is according to the
  • the cancer is a solid tumor in some embodiments, the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the colon cancer is colon carcinoma in some embodiments, the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, pieoplatin, or satrap! atin.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRPa Dl domain variant and an Fc domain variant, (b) a PD-1 inhibitor, (c) an antimetabolite, and (d) a platinum-based chemotherapy agent; wherein the SIRPa Dl domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, 1,2.35 A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A3308, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (hi) a human IgG4 Fc region comprising S228P, E233P, F234V, L235
  • the polypeptide comprising the SIRPa Dl domain variant and the Fc domain variant is administered at a dose of 10 mg/kg once a week (qw). In some embodiments, the polypeptide comprising the SIRPa Dl domain variant and the Fe domain variant is administered at a dose of 15 mg/kg once a week (qw).
  • the HNSCC is advanced and/or metastatic HNSCC.
  • the PD-1 inhibitor is an anti-PD-1 antibody, e.g., pernbrolizumab, nivolumab, pidilizumab, eemiplimab, or BMS-936559 In some embodiments, the anti-PD-1 antibody is pernbrolizumab.
  • the antimetabolite is 5-fluorouraeil, 6-mereaptopurme, eapeeitahine, eytarabme, floxuridine, fludarabine, gemcitabine, liydroxycarbamide, methotrexate, pemetrexed, phototrexate.
  • the antimetabolite is 5- f!uorouracil.
  • the platinum-based chemotherapy agent is carboplatin, cispiaiin, oxaiipiatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplaiin, or satraplatin.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a STRPa 131 domain variant and an Fc domain variant, (b) an anti-HER2 antibody, and (c) an anti-PD-Ll antibody (e.g., an anti-PD-Ll antagonist antibody); wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P,
  • the cancer is solid tumor.
  • the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the solid tiunor is HER2 + solid tumor.
  • the solid tumor is colon cancer (e.g.,
  • the anti-HER2 antibody is trasiuzumah.
  • the anti-PD-Ll antibody is atezolizumab, avelumab, or durvalumab.
  • a method of treating cancer in an indi vidual comprising administering to the individual an effective amount of: (a) a polypeptide comprising a SIRPa D1 domain variant and an Fc domain variant, (b) an anti-HER2 antibody, (c) an anti- VEGF2 antibody, and (d) paelitaxel; wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85: wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fe region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to die EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P
  • the gastric cancer or GEJ cancer is a HER2-overexpressing (e.g., HER2 + ) gastric cancer or a HER2 ⁇ overexpressing GEJ cancer.
  • the individual has received prior therapy with an anti-HER2 antibody, with an anti-HER2 antibody and a fluoropyrimidine, or with an anti HER2 antibody and a platinum-based chemotherapy agent.
  • the anti-HER2 antibody is trastuzumab.
  • the anti-VEGF antibody is ramucirumab.
  • the polypeptide comprising the SIRPa DI domain variant and the Fc domain variant is administered at a dose of 10 mg/kg once a week (qw). In some embodiments, die polypeptide comprising the SIRPa DI domain variant and the Fc domain variant is administered at a dose of 15 mg/kg once a week (qw).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of (a) a polypeptide comprising a SIRPa DI domain variant and an Fc domain variant, and (b) an anti-TROP2 antibody; wherein die SIRPa DI domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein die Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the ELJ index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human TgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU
  • the cancer is solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma.
  • the SIRPa DI domain variant comprises the amino acid sequence of SEQ ID NO: 85.
  • the SIRPa D I domain variant comprises the amino acid sequence of SEQ ID NO: 81.
  • the Fc domain variant is a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the Fc domain variant comprises the ammo acid sequence of SEQ ID NO:
  • the polypeptide comprising a SIRPa DI domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 136.
  • the polypeptide comprising a SIRPa Di domain variant and an Fe domain variant comprises the amino acid sequence of SEQ ID NO: 135.
  • the polypeptide comprising a STRPa Dl domain variant and an Fc domain variant forms a homodimer.
  • the individual is a human.
  • kits comprising a polypeptide comprising a SIRPa Dl domain variant and an Fe domain variant in a pharmaceutic ally acceptable carrier, for use in combination with a Bel -2 inhibitor for treating cancer in an individual in need, wherein die SIRPa DI domain variant comprises the amino acid sequence of SF1Q ID NO: 81 or SEQ ID NO: 85: wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Rabat; (ii) a human IgG2 Fc region comprising A330S, P33IS, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human TgG4 Fc region comprising S228P, E233P, F234V, L235A, and deIG236 mutations, wherein numbering is according to
  • kits comprising a polypeptide comprising a SIRPa Di domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with a platinum-based chemotherapy agent for treating cancer in an individual in need thereof, wherein the SIRPa Dl domain variant comprises tire amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human TgG2 Fc region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kab
  • the cancer is solid tiunor.
  • the solid tumor is colon cancer, colon carcinoma, lung cancer, head and neck cancer esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • kits comprising a polypeptide comprising a STRPa DI domain variant and an Fc domain variant in a pharmaceutically acceptable earner, for use in combination with a PD-1 inhibitor, an antimetabolite, and a platinum-based chemotherapy agent for treating cancer in an individual in need thereof, wherein the STRPa DI domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Rabat; (iii) a human IgG4 Fc region comprising S22.8P, E2.33P, F234V, L235A, and
  • kits comprising a polypeptide comprising a SIRPa D I domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-HER2 antibody, an anti-VEGFR2 antibody, and paclitaxel; wherein the SIRPa DI domain variant comprises the ammo acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, 1,235 A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E2.33P, F234V, L235A, and delG236 mutation
  • the gastric cancer or GEJ cancer is HER2 gastric cancer or HER2 ⁇ GEJ cancer in some embodiments, tire anti-HER2 antibody is trastuzumab. in some embodiments, the anti-VEGFR2 antibody is rarnucirurnab.
  • the individual received prior therapy (or therapies) with an anti-HER2 antibody (e.g., trastuzumab) and/or a fluoropyrimidine, and/or a platinum-based chemotherapeutic agent.
  • an anti-HER2 antibody e.g., trastuzumab
  • a fluoropyrimidine e.g., trastuzumab
  • a platinum-based chemotherapeutic agent e.g., trastuzumab
  • the gastric cancer or GEJ cancer in the individual progressed during or after prior therapy (or therapies) comprising anti-HER2 antibody (e.g., trastuzumab) and/or a fluoropyrimidine, and/or a platinum -based chemotherapeutic agent.
  • prior therapy (or therapies) comprised an anti-HER2 antibody and a fluoropyrimidine (e.g., administered during the same line of therapy or during different lines of therapy).
  • the prior therapy (or therapies) comprised an anti-HER2 antibody and a platinum-based chemotherapy agent (e.g., administered during the same line of therapy or during different lines of therapy)
  • kits comprising a polypeptide comprising a SIRPec D1 domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-TROP2 antibody for treating cancer in an individual in need thereof, wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P3318, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising 8228P, E233P, F234V, L235A, and de!G236 mutations, wherein numbering is according to the
  • the cancer is solid tiunor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer.
  • Hilar Cholangiocareinoma pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma.
  • kits comprising a polypeptide comprising a SIRPa D! domain variant and an Fc domain variant in a pharmaceutically acceptable carrier, for use in combination with an anti-HER2 antibody and an anti-PD-Ll antibody (e.g., an anti PD-L1 antagonist antibody) for treating cancer in an individual in need thereof
  • the SIRPa DI domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85
  • the Fc domain variant is (i) a human IgGl Fc region comprising L2.34A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index ofKabat; (ii) a human IgG2 Fc region comprising A3308, P33 IS, and N297A mutations, wherein numbering is according to the ELI index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V,
  • the cancer is colon cancer. In some embodiments, the colon cancer is HER2 colon cancer. In some embodiments, the anti-HER2 antibody is trastuzumab. In some embodiments, the anti-PD-Ll antibody is atezolizumab, avelumab, or durvalutnab.
  • the SIRPa Dl domain variant comprises the amino acid sequence of SEQ ID NO: 85.
  • the SIRPa DI domain variant comprises the amino acid sequence of SEQ ID NO: 81.
  • the Fc domain variant is a human IgGl Fc region comprising L234A, L235 A, G237A, and N297A mutations, wherein numbering is according to the EU index ofKabat.
  • the Fc domain variant comprises the amino acid sequence of SEQ ID NO: 91.
  • the polypeptide comprising a SIRPa Dl domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 136.
  • the polypeptide comprising a SIRPa DI domain variant and an Fc domain variant comprises the amino acid sequence of SEQ ID NO: 135. In some embodiments, the polypeptide comprising a SIRPa Dl domain variant and an Fc domain variant forms a homodimer. In some embodiments, the individual is a human.
  • FIG. IB provides tumor volumes (mm 3 ) at the indicated times post implant in NQD- SCID female mice injected with RS4; i 1 leukemia cells that had received treatment venetoclax, and which were subsequently re-heated with single agent venetoclax or with a venetoclax/Drug A combination.
  • FIGS. 2A-2D pro vide the tumor volume (mind) and body weight of BALB/c female mice injected with CT26 tumor cells following treatment with Drug A, Cispiatin, Cisplatin/Drag A combination, or vehicle (PBS) at the indicated times post implantation.
  • FIG. 2A provides the mean tumor volumes (+/- SEM) for the indicated treatments. Dashed arrows indicate dosing of Cispiatin (two 5 mg/kg doses given 10 days apart). Dotted arrows indicate dosing of Drug A (two 30 mg/kg doses given 10 days apart). Both drugs were administered intraperitoneally.
  • FIG. 2B provides the mean percent change in body weight from day 7 (D7) in mice treated according to the regimens shown in FIG. 2A.
  • FIG. 2C provides the mean tumor volumes (+/'- SEM) for the indicated treatments. Dashed arrows indicate dosing of Cispiatin (one 10 mg/kg dose). Dotted arrows indicate dosing of Drug A (two 30 mg/kg doses given 10 days apart).
  • FIG. 2D provides the mean percent change in body weight from day 7 (D7) in mice treated according to the regimens shown in FIG. 2C.
  • FIG. 3 pro vides the results of experiments that were performed to determine the effect of Drag A in combination with an anti-TKOP2 antibody on the phagocytosis of CF8E- labeled DLD-1 tumor cells by human monocyte-derived macrophages.
  • FIG. 4 provides the results of experiments that were performed to determine the effect of Drag A in combination with (a) an anti-HER2 antibody, (b) an anti-PD-L 1 antibody, or (c) an anti-HER2 antibody and an anti-PD-L I on tumor growth in a MC38 m/h colon cancer model.
  • FIG. 5A provides the results of experiments that were performed to assess the effects of the addition of Drug A, venetoclax, or both Drag A and venetoclax in die phagocytosis of HL60 cells by macrophages in an in vitro assay.
  • FIG. SB provides the results of experiments that were performed to assess the effects of the addition of Drag A, venetoclax, or both Drag A and venetociax in the phagocytosis of OCI-AML3 cells by macrophages in an in vitro assay.
  • FIG. 6A pro vides the results of experiments that were performed to assess tire effects of Drug A or Drug C on CD8 + dendritic cell activation.
  • FIG. 6B provides the results of experiments that were performed to assess the effects of Drug A or Drug C on CD8 dendritic cell activation.
  • FIG. 7 A provides the results of experiments that were performed to assess the effects of Drug A or Drug B on CD8 + dendritic cell activation.
  • FIG, 7B provides tire results of experiments that were performed to assess the effects of Drug A or Drug B on CDS dendritic cell activation.
  • FIG, 8A provides the results of experiments that were performed to assess the binding of Drag A, F59/magrolimab, TT ⁇ -621, and TTI-622 to hCD47.
  • FIG. SB provides the results of quantitative experiments that were performed to assess the effect of Drug A. F59/magrolimab, TTI-621, and TTI-622 on SIRPa signaling.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system .
  • “about” can mean within 1 or more than 1 standard de viation, per the practice in the art.
  • “about.” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1 % of a given value.
  • the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
  • the terms “treatment”, “treating”, and the like refer to administering an agent, or carrying out a procedure, for the purposes of obtaining an effect.
  • the effect is prophylactic in terms of completely or partially preventing a disease or symptom thereof.
  • the effect is therapeutic in terms of affecting a partial or complete cure for a disease or symptoms of the disease
  • antibody refers to intact antibodies: antibody fragments, provided that they exhibit the desired biological activity (e.g. epitope binding); monoclonal antibodies; polyclonal antibodies; monospecific antibodies; multi-specific antibodies (e.g , bispecific antibodies); and antibody-like proteins.
  • antibody variable domain refers to the postions of the light and heavy chains of an antibody that include amino acid sequences of complementary- determining regions (CDRs, e.g., CDR LI , CDR L2, CDR L3, CDR HI , CDR H2, and CDR H3) and framework regions (FRs).
  • CDRs complementary- determining regions
  • FRs framework regions
  • linker refers to a linkage between tw o elements, e.g. , protein domains.
  • a linker can be a covalent bond or a spacer.
  • spacer refers to a moiety (e.g., a polyethylene glycol (PEG) polymer) or an amino acid sequence (e.g., a 1-200 amino acid sequence) occurring between two polypeptides or polypeptide domains to provide space or flexibility (or both space and flexibility) between the two polypeptides or polypeptide domains.
  • an amino acid spacer is part of the primary sequence of a polypeptide (e.g., joined to the spaced polypeptides or polypeptide domains via the polypeptide backbone).
  • the term “effective amount” refers to an amount of a polypeptide or a pharmaceutical composition containing a polypeptide described herein, e.g., a polypeptide having a SIRPa D1 domain or variant thereof, that is sufficient and effective in achieving a desired therapeutic effect in treating a patient having a disease, such as a cancer, e.g., solid tumor or hematological cancer.
  • a disease such as a cancer, e.g., solid tumor or hematological cancer.
  • an effective amount of polypeptide will avoid adverse side effects.
  • the term “pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that includes an active ingredient as well as excipients or diluents (or both excipients and diluents) and enables the active ingredient to be administered by suitable methods of administration.
  • the pharmaceutical compositions disclosed herein include pharmaceutically acceptable components that are compatible with the polypeptide.
  • the pharmaceutical composition is in tablet or capsule form for oral administration or in aqueous form for intravenous or subcutaneous administration, for example by injection.
  • the terms “subject,” “individual,” and “patient” are used interchangeably to refer to a vertebrate, for example, a mammal. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed. None of the terms entail supervision of a medical professional.
  • binding affinity refers to the strength of the binding interaction between two molecules. Generally, binding affinity refers to the strength of the sum total of non-covending interactions between a molecule and Its binding partner, such as a SIRPot D1 domain variant and CD47. Unless indicated otherwise, binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair.
  • the binding affinity between tw o molecules is commonly described by the dissociation constant (K D ) or the association constant (K A ).
  • K D dissociation constant
  • K A association constant
  • TWO molecules that have low binding affinity for each oilier generally bind slowly, tend to dissociate easily, and exhibit a large K D .
  • TWO molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small K D.
  • the K D of two interacting molecules is determined using known methods and techniques, e.g., surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • K D can be calculated as the ratio of koflTkon.
  • K D less than refers to a numerically smaller K D value and an increasing binding affinity relative to the recited K D value.
  • K D greater than refers to a numerically larger K D value and a decreasing binding affinity relative to the recited K D value.
  • conjunction with refers to administration of one treatment modality in addition to another treatment modality.
  • in conjunction with refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the individual
  • kits for treating cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) a chemotherapy agent (e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents).
  • a chemotherapy agent e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents.
  • the method further comprises administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least tour therapeutic antibodies).
  • the method further comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents). Additionally or alternatively, in some embodiments, the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, ciyoablation, and bone marrow transplant.
  • an immunotherapeutic agent e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents.
  • the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, ciyoablation, and bone marrow transplant.
  • the agent that blocks the interaction between CD47 e.g. , hCD47
  • SIRPa e.g., hSIRPa
  • a small molecule inhibitor of the CD47-STRPa pathway e.g., RRX-0Q1 and others. See, e.g., Miller etas. (2019) "‘Quantitative high-throughput screening assays for the discovery and development of SIRPa-CD47 interaction inhibitors.”
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) binds CD47 (e.g., hCD47).
  • the agent binds CD47 (e.g., hCD47) with a K D of about 10 nM or beter (such as at least about any one of 9 nM, 8 nM, 7nM, 6nM, 5nM, 3nM, 2nM, InM, 750 pM, 500pM, 250pM, 200pM, lOOpM, 50 pM, 25 pM, 20 pM lOpM or less than 10 pM).
  • the agent that binds CD47 exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) m a human subject.
  • the agent that binds CD47 e.g., hCD47
  • the agent that binds CD47 is an anti-CD47 antibody (e.g., a therapeutic anti-CD47 antibody) or an antigen-binding fragment thereof in some embodiments, the antigen binding fragment is a Fab, a Fab’, a Fab’-SH, an F(ab’)2, an Fv, an scFv, a one-armed antibody, or a diabody.
  • the anti-CD47 antibody is a monospecific antibody.
  • the anti-CD47 antibody is a multispecific (e.g., bispecific) antibody.
  • tire term anti-CD47 antibody encompasses anti body -based constructs (such as multispecific constructs) including, without limitation triomabs, DARTs (i.e., dual-affinity re-targeting antibodies), TandAbs (i.e., tandem diabodies), tandem scFvs, CrossMabs, DNLs (i.e., dock and lock antibodies), DVD-Ig (i.e., dual variable domain immunoglobulins), tetravalent bispecific IgGs, nanobodies, dual targeting domains, and ART-Tgs (i.e., asymmetric reengineering technology-immunoglobulins).
  • DARTs i.e., dual-affinity re-targeting antibodies
  • TandAbs i.e., tandem diabodies
  • tandem scFvs tandem scFvs
  • CrossMabs i.e., dock and lock antibodies
  • DVD-Ig i.e., dual variable domain immunoglobulins
  • the anti-CD47 antibody is Hu5F9-G4, B6H12.2,
  • BRIG 126 CC-90002, SRF231, or 1BI188 (from Innovent Biologies) (see, e.g., Zhao et al.
  • the agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g , hSTRPa
  • SIRPa e.g., hSIRPa
  • the agent hinds SIRPa (e.g., hSIRPa) with a KD of about 10 nM or better (such as at least about any one of 9nM, 8 nM, 7nM, 6nM, 5nM, 3nM, 2nM, InM, 750 pM, 500pM, 250pM, 200pM, lOOpM, 50 pM, 25 pM, 20 pM lOpM or less than 10 pM).
  • SIRPa e.g., hSIRPa
  • the agent that binds SIRPa exhibits at least about 50% SIRPa receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject.
  • the agent that binds SIRPa e.g., hSIRPa
  • the agent that binds SIRPa is an anti- SIRPa antibody (e.g., a therapeutic anti-SIRPa antibody) or an antigen-binding fragment thereof in some embodiments, the antigen binding fragment is a Fab, a Fab) a Fab’-SH, an F(alr)2, an Fv, an scFv, a one-armed antibody, or a diabody.
  • the anti- SlRPa antibody is a monospecific antibody or monospecific antibody construct (including, but not limited to those described above).
  • the anti-SIRPa antibody is a multispecific (e.g., bispecific) antibody or a multispecific antibody construct (including, but not limited to those described above).
  • the anti-SIRPa antibody is KWAR23, SE12C3, 040, or MY-1 (see, e.g., Ring et al. (2017) PNAS USA 114(49): E10578-E10585); Murata et al. (2016) Cancer Sci 109(5): 1300-1308; and Yamgata et al. (2017) JCI Insight 2:e89140 for additional information about these anti-SIRPa antibodies).
  • the anti-SIRPa antibody is an antibody described in WO 2018/057669; US-2018-0105600-A1; US20180312587; W02018107058; WO2019023347; U820180037652; WO2018210795;
  • the agent that blocks the interaction between CD47 (e.g , hCD47) and SIRPot is an anti-SIRPp antibody or an anti-SIRPy antibody (e.g., an anti-SIRPp antibody or anti-SIRPy antibody that is capable of binding SIRPa), or an antigen binding fragment thereof
  • the agent is an antibody (or antigen binding fragment thereof) that is capable of bind two or more of SIRPa, SIRPp, and SIRPy.
  • such antibody binds SIRPa (e.g., hSIRPa) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 20 OpM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • SIRPa e.g., hSIRPa
  • the antibody exhibits at least about 50% SIRPa receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject in some embodiments, the antibody has an EC50 of about 80 ng/m! or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 2.0, 15, 10, or 5 ng/snl.
  • SIRPa receptor occupancy e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%
  • the antibody has an EC50 of about 80 ng/m! or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 2.0, 15, 10, or 5 ng/snl.
  • the antigen binding fragment is a Fab, a Fab’, a Fab’-SH, an F(ab’)2, an Fv, an seFv, a one-anned antibody, or a diabody.
  • the antibody is a monospecific antibody or monospecific antibody construct (including, but not limited to those described above) in some embodiments, the antibody is a multispecific (e.g., bispecific) antibody or a multispecific antibody construct (including, but not limited to those described above).
  • the agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g., hSI RPa
  • the agent that blocks the interaction between CD47 is a fusion polypeptide comprising a moiety that binds CD47.
  • the fusion polypeptide comprises an antibody Fc region and a moiety that binds CD47.
  • the portion of the fusion polypeptide that binds CD47 binds CD47 (e.g., hCD47) binds CD47 (e.g., hCD47) with a K D of about 10 nM or better (such as at least about any one of 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 3nM, 2 nM, 1 nM, 750 pM, 500 pM, 250 pM, 20 OpM, 100 pM, 50 pM, 25 pM, 20 pM, 10 pM or less than 10 pM).
  • the fusion polypeptide exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100%) in a human subject in some embodiments, the fusion polypeptide has an EC50 of about 80 ng/ml or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, or 5 ng/ml. In some embodiments, the fusion polypeptide comprises WT human antibody Fc region.
  • the fusion polypeptide comprises an Fc variant (e.g., a variant of a WT human antibody Fc region) that exhibits reduced (e.g., such as ablated) effector function as compared to a WT Fc region.
  • Fc variants are described in WO 2017/027422 and US 2017/0107270, the contents of which are incorporated herein by reference in their entireties.
  • moiety that binds CD47 e.g., hCD47
  • WT SIRPa e.g., hSIRPa
  • WT SIRPy e.g., hSIRPy
  • moiety that binds CD47 is a CD47-binding fragment (e.g., dl domain) of a WT SIRPa (e.g., hSIRPa), or a WT SIRPy (e.g., hSIRPy).
  • the moiety that binds CD47 is a SIRPa variant, a SIRPy variant, a SIRPp variant, or a CD47-binding fragment thereof (e.g., the dl domain).
  • SIRPy variants Exemplar ⁇ SIRPy variants, SIRPpi variant, and SIRPp2 variants are described in, e.g., WO 2013/109752; US 2015/0071905; USP 9,944,911; WO 2016/023040; WO 2017/027422; US 2017/0107270; USP 10,259,859; US9845345; WO2016187226; US20180I55405;
  • the agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) is a fusion polypeptide comprising an antibody Fc region and a SIRPa variant.
  • the SIRPa variant binds CD47 (e.g., hCD47) with a KD of about 10 nM or better (such as at least about any one of 9 riM, 8 nM, 7 nM, 6 nM, 5 nM,
  • the fusion polypeptide exhibits at least about 50% CD47 receptor occupancy (e.g., at least about any one of 50%, 55%, 60%, 65%, 70%, 75%,
  • the fusion polypeptide has an EC50 of about 80 ng/mi or less, e.g., about any one of 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, or 5 ng/ml. in some embodiments, the fusion polypeptide comprises WT human antibody Fc region.
  • the fusion polypeptide comprises an Fc variant (e.g., a variant of a WT human antibody Fc region) that exhibits reduced (e.g., such as ablated) effector function as compared to a WT Fc region, such as those described in the references cited herein in some embodiments, the fusion polypeptide comprises a SIRPa variant described in WO 2013/109752; US 2015/0071905; WO 2016/023040; WO 2017/027422; US 2017/0107270; USP 10,259,859; US9845345; WO2016187226;
  • the fusion polypeptide comprising an antibody Fc region and a SIRPa variant is TTI-621 , TTI-622, or IMM01 (see, e.g., Petrova et al. (2017) Clin Cancer Res 23:1086-1079; Russ et al.
  • the agent that blocks the interaction between CD47 (e.g , hCD47) and SIRPot is a fusion polypeptide comprising a SIRPa D1 domain variant (e.g., a SIRPa D1 domain variant described herein) and an Fe domain variant (e.g., an Fe domain variant described herein).
  • a method of treating cancer e.g., leukemia, such as acute lymphoblastic leukemia
  • an individual e.g., a human individual
  • administering comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) an RCL2 inhibitor (e.g., a selective BCL2 inhibitor, such as venetoclax).
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g., hSIRPa
  • an RCL2 inhibitor e.g., a selective BCL2 inhibitor, such as venetoclax
  • the agent is a polypeptide comprising a SIRPa D1 domain variant and an Fe domain variant) wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85, wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A3308, P33 IS, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fe region comprising S2.28P, E233P, F234V, L2.
  • a method of treating cancer e.g. , colon cancer in an individual (e.g., a human individual), comprising administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) , and (b) platinu -based chemotherapy agent (e.g., eispiatin).
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g., hSIRPa
  • platinu -based chemotherapy agent e.g., eispiatin
  • the agent is a polypeptide comprising a SIRPa D 1 domain variant and an Fc domain variant, wherein the SIRPa D 1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85; wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to die EU index of Kabat; (iii) a human IgG4 Fc region comprising S2.28P, E233P, F234V, L235 A , and delG2.36 mutations, -wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F
  • a method of treating cancer e.g. , head and neck cancer, such as head and neck squamous cell carcinoma
  • an individual e.g., a human individual
  • administering comprising administering to the indi vidual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPot (e.g., hSIRPa)
  • a PD-1 inhibitor e.g., a PD-1 inhibitor
  • an anti -metabolite e.g., platinum -based chemotherapy agent.
  • the agent that blocks the interaction between CD47 and SIRPa is a polypeptide comprising a SIRPa D1 domain variant and an Fc domain variant) wherein the SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID O: 85, wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Rabat; (ii) a human lgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Rabat; (iii) a human lgG4 Fe region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Rabat; or (iv) a human IgG4 Fc region comprising
  • a method of treating cancer e.g., gastric cancer or gastroesophageal cancer
  • an individual e.g., a human individual
  • administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa)
  • b) an anti-HER2 antibody e.g., hSIRPa
  • an anti-HER2 antibody e.g., hSIRPa
  • an anti-HER2 antibody e.g., hSIRPa
  • paclitaxel e.g., paclitaxel
  • the agent that blocks the interaction between CD47 and SIRPa is a polypeptide comprising a SIRPa D1 domain variant and an Fe domain variant) wherein tire SIRPa D1 domain variant comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85, wherein the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Rabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Rabat: (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Rabat; or (iv) a human IgG4 Fc region comprising S2
  • SIRPa Signal-Regulatory Protein a
  • polypeptides comprising a signal- regulatory protein a (SIRP-a) Dl variant comprising a SIRPa D1 domain, or a fragment thereof, that comprises an ammo acid mutation at residue 80 relati ve to a wild-type SIRPa D 1 domain (e.g., a wild-type SIRPa Dl domain set forth in 5EQ ID NO: 1 or 2); and at least one additional amino acid mutation relative to a wild-type SIRPa Dl domain (e.g., a wild-type SIRPa Dl domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP-a signal- regulatory protein a
  • polypeptides comprising an Fc domain variants, wherein an Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgGl Fc region consisting of mutations L2.34A, ! .23 Vv G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S andN297A; or (iii) a human lgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Signal-regulatory protein a (“SlRP-a” or “SIRP-alpha”) is a transmembrane glycoprotein belonging to the Ig superfamily that is widely expressed on the membrane of myeloid cells. SIRPa interacts with CD47, a protein broadly expressed on many cell types in the body. The interaction of SIRPa with CD47 prevents engulfinent of “self” cells, which can otherwise be recognized by the immune system. It has been observed that high CD47 expression on tumor cells can act, in acute myeloid leukemia and several solid tumor cancers, as a negative prognostic factor for survival.
  • Native SIRPa comprises 3 highly homologous immunoglobulin (Ig)-like extracellular domains . Dl, D2, and D3.
  • the SIRPa Dl domain (‘ ‘ Dl domain”) refers to the membrane distal, extracellular domain of SIRPa and mediates binding of SIRPa to CD47.
  • hie term “SIRPa polypeptide” refers to any SIRPa polypeptide or fragment thereof that is capable of binding to CD47.
  • Table 1 sho ws the amino acid sequences of tire D 1 domains of the naturally occurring wild-type human SIRPa Dl domain variants (SEQ ID NOs: land 2).
  • a SIRPa polypeptide comprises a SIRPa Dl domain. In some embodiments, a SIRPa polypeptide comprises a wild-type Dl domain, such as those provided in SEQ ID NOs: 1 and 2. In some embodiments, a SIRPa polypeptide includes a D2 or D3 domain (or both a D2 and a D3 domain) (see Table 3) of a wild-type human SIRPa. Table l. Sequences of Wild-Type SIRPa DI Domains
  • SIRPa D1 domain variant refers to a polypeptide comprising a SIRPa D1 domain or a CD47-binding portion of a SIRPa polypeptide that has a higher affinity to CD47 than wild-type SIRPa.
  • a SIRPa D1 domain variant comprises at least one amino acid substitution, deletion, or insertion (or a combination thereof) relative to a wild- type SIRPa.
  • SIRPa DI domain variants disclosed herein comprise a SIRPa DI domain or variant thereof in some embodiments, a SIRPa DI domain variant comprises one or more amino acid substitutions, insertions, additions, or deletions relative to a wild-type DI domain shown in SEQ ID NOs: 1 and 2.
  • Table 2 lists exemplary amino acid substitutions in each SIRPa DI domain variant (SEQ ID NOs: 13-14).
  • the SIRPa DI domain polypeptide or SIRPa DI domain variant comprises a fragment of the DI domain.
  • the SIRP polypeptide fragment or SIRPa DI domain variant fragment comprises an am o acid sequence of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 ammo acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 ammo acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length in some embodiments, the
  • SIRPa DI domain fragments retain the ability to bind to CD47.
  • a polypeptide of the disclosure comprising a SIRPa Di domain variant binds with higher binding affinity to CD47 than a wiid-type human SIRPa Dl domain.
  • the SIRPa Dl domain variant binds to human CD47 with at least 1-fold (e.g., at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold or greater than 5- fold) affinity than the affinity of a naturally occurring Dl domain.
  • the SIRPa Dl domain variant binds to human CD47 with at least 1-fold (e.g., at least 10-fold, 100- fold, 1000-fold or greater than 1000-fold) affinity than the affinity of a naturally occurring Dl domain.
  • the term “optimized affinity” or “optimized binding affinity” refers to an optimized strength of the binding interaction between a polypeptide d sclosed herein, including a SIRPa Dl domain variant, and CD47.
  • the polypeptide binds primarily or with higher affinity to CD47 on cancer ceils and does not substantially bind or binds with lower affinity to CD47 on non-cancer cells.
  • the binding affinity ' between foe polypeptide and CD47 is optimized such that the interaction does not cause clinically relevant toxicity ' or decreases toxicity' compared to a variant which binds with maximal affinity in some embodiments, in order to achieve an optimized binding affinity' between a polypeptide provided herein and CD47, the polypeptide including a SIRPa DI domain variant is developed to have a lower binding affinity to CD47 than which is maximally achievable.
  • the SIRPa Dl domain variants disclosed herein cross react with rodent, non-human primate (NHP), and human CD47.
  • immunogenicity refers to foe property' of a protein (e.g., a therapeutic protein) which causes an immune response in the host as though it is a foreign antigen.
  • a protein e.g., a therapeutic protein
  • the immunogenicity of a protein can be assayed in vitro in a variety of different ways, such as through in vitro T-cell proliferation assays.
  • minimal immunogenicity' refers to an immunogenicity' of a protein (e.g, a therapeutic protein) that has been modified, e.g., through amino acid substitutions, to be lower (e.g., at least 10%, 25%, 50%, or 100% lower) than the immunogenicity before foe amino acid substitutions are introduced (e.g., an unmodified protein).
  • a protein e.g., a therapeutic protein
  • a protein is modified to have minimal immunogenicity' and causes no or very little host immune response even though it is a foreign antigen.
  • the SIRPa D 1 domain variant demonstrates minimal immunogenicity.
  • a SIRPa polypeptide of foe disclosure administered to a subject has the same amino acid sequence as that of the SIRPa polypeptide in a biological sample of the subject, except for amino acid changes which increase affinity of the SIRPa Di domain variant.
  • the polypeptide variants disclosed herein lower the risk of side effects compared to anti-CD47 antibodies or wild-type SIRPa.
  • the polypeptide variants disclosed herein lower the risk of anemia compared to anti-CD47 antibodies or wild-type SIRPa.
  • the polypeptide variants disclosed herein do not cause acute anemia in rodent or non-human primates (NHP) studies.
  • a SIRPa DI domain variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 2.
  • a SIRPa DI domain variant includes at most fourteen amino acid substitutions relative to a wild-type DI domain in some embodiments, a SIRPa DI domain variant includes at most ten amino acid substitutions relative to a wild-type DI domain.
  • a SIRPa DI domain variant includes at most seven amino acid substitutions relative to a wild-type DI domain in some embodiments, a SIRPa DI domain variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D 1 domain.
  • a SIRPa DI domain variant is a chimeric SIRPa DI domain variant that includes a portion of two or more wild-type Di domains or variants thereof (e.g., a portion of one wild-type DI domain or variant thereof and a portion of another wild-type DI domain or variant thereof).
  • a chimeric SIRPa DI domain variant includes at least two portions (e.g., three, four, five or more portions) of wild-type DI domains or variants thereof, wherein each of the portions is from a different wild-type D i domain in some embodiments, a chimeric SIRPa D 1 domain variant further includes one or more amino acid substitutions listed in Table 2.
  • a polypeptide comprises a SiRPec D1 domain variant that comprises a sequence of:
  • EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8G XSFPRVTWSDXIOTXIIRNNMDFSIRIGNITPADAGTYYCXUKXDRKGSPDDVEXMKSGA GTELSVRAKPS (SEQ ID NO: 13), wherein Xi is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X is A, I, or L; X 5 is I, T, S, or F; X 9 is E, V, or L; X ?
  • X-. 4 is F or V; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRPa D! domain that comprises the sequence of SEQ ID NO: 1.
  • a polypeptide comprises a SIRPa D1 domain variant that comprises the sequence of SEQ ID NOs: 13, wherein X: is L, I, or V.
  • X is V, L, or, L
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X5 is I, T, S, or F.
  • Xe is E, V, or L.
  • X ? is K or R.
  • X 3 ⁇ 4 is E or Q.
  • X9 is H, P, or R.
  • X10 is L, T, or G.
  • Xu is K or R.
  • X12 is V or I.
  • X 13 is F, L, V.
  • X is F or V.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relati v e to the wild- type SIRPa D! domain that comprises die sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than tire wild-type SIRPa D1 domain that comprises the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide hinds CD47 with at least 100-fold greater binding affinity than the wiki-type SIRPa D I domain that comprises the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa D1 domain that comprises the sequence of SEQ ID NO: 1.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x 10 9 M, less than 1 x I O 9 M, less 5 x !0 ⁇ 0 M, less than 1 x 10 ! ° M or less than 1 x 10 ‘ l M.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 10011M and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRPa DI domain variant that comprises a sequence of:
  • die variant comprises at least one amino acid substitution relative to a wild-type SIRPa Dl domain that comprises the sequence of SEQ ID NO: 2.
  • the polypeptide comprises the sequence of SEQ ID NO: 14, wherein Xi is L, I, or V. in some embodiments, X2 is V, L, or, L in some embodiments, X 3 is A or V. In some embodiments, X 4 is V, I, or L. In some embodiments, Xs is I, T, S, or F. In some embodiments, Xe is E, V, or L. In some embodiments, X ? is K or R. In some embodiments, X* is E or Q. In some embodiments, X 9 is H, P, or R. In some embodiments, X 10 is S, T, or G.
  • Xu is K or R. In some embodiments, X is V or I. In some embodiments, Xu is F, L, or V. In some embodiments, X 14 is F or V.
  • the polypeptide of this aspect of die disclosure includes no more than six amino acid substitutions relative to the wild-type SIRPa D1 domain that comprises the sequence of SEQ ID MO: 2.
  • die polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRPa DI domain having the sequence of SEQ ID NO: 2 In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa DI domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity' than the wild-type SIRPa DI domain having the sequence of SEQ ID NO: 2.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a KD less than I x 1() 8 M, less than 5 x 1G 9 M, less than 1 x 1G 9 M, less 5 x !0 i0 M, less than 1 x 10 10 M or less than 1 x I0 u M.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 riM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 11M and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRPa DI domain variant having a sequence of:
  • Xi 8 TXi 9 RX 2 oNMDFX 2i IX 22 lX 23 NITPADAGTYYCX 24 KX 25 RK GSPDX 26 X 27 EX 2S KSGAGTELSVRX 29 KPS (SEQ ID NO: 23), wherein X, is E or G; X 2 is L, I, or V : X3 is V, L, or, I; X 4 is S or F; X 5 is L or S; 3 ⁇ 4 is S or T; X7 is A or V; Xs is I or T; X$ is H or R; Xio is A, V, I, or L; X is I, T, S, or F; X 12 is A or G; Xu is E, V, or L; Xu is K or R; Xu is E or Q; X 16 i s H, P, or R; X 17 i s D or E; X i8 is S, L, T, or G;
  • X 2 is L, I, or V.
  • X 3 is V, L, or, I.
  • X 4 is S or F.
  • X 5 is L or S.
  • Xe is S or T.
  • X ? is A or V.
  • Xs is I or T.
  • X ⁇ is H or R.
  • Xus is A, V, I, or L.
  • Xu is I, T, S, or F
  • X is A or G.
  • Xu is E, V, or L.
  • X14 is K or R.
  • Xu is E or Q.
  • X 1 ⁇ 2 is H, P, or R.
  • Xj ? is D or E
  • Xis is S, L, T, or G.
  • X19 is K or R.
  • X20 is E or D.
  • X2i is S or P.
  • X22 is S or R.
  • X23 is S or G.
  • X24 is V or I.
  • X2.5 is F, I,, V.
  • X2.6 is D or absent.
  • X27 is T or V.
  • Xis is F or V.
  • X29 is A or G.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRPec D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wiki-type SIRPa DI domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 5 or 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity' than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1 or 2.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x l(f 9 M, less than I x 10 ⁇ 9 M, less 5 x 10 i0 M, less than 1 x 10 10 M or less than 1 x 10 11 M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide of the disclosure including a SIRPa Dl domain variant further comprises a D2 domain having the sequence of SEQ ID NO: 24, a D3 domain having the sequence of SEQ ID NO: 25, or a D2 domain having the sequence of SEQ ID NO: 24 and a D3 domain having the sequence of SEQ ID NO: 25 of a wild-type human SIRPa as shown in Table 3.
  • the SIRPa Dl domain variant further comprises a fragment or variant of a D2 domain or a fragment or variant of a D3 domain.
  • the SIRPa D I domain variant further comprises a fragment or variant of a D2 domain and a fragment or variant of a D3 domain.
  • a SIRPa D I domain variant is joined to a D2 or D3 domain by way of a linker.
  • a SIRPa Dl domain variant is joined to a D2 and D3 domain by way of a linker.
  • a polypeptide of the disclosure including a SIRPa D1 domain variant is attached to an Fc domain variant in order to improve the pharmacokinetic properties of the polypeptide, e.g., increase serum half-life.
  • a SIRPa D1 domain variant is attached to an Fe domain variant that is unable to dimerize.
  • Fc domain variants serve to increase the serum half-life of the polypeptides described herein.
  • a polypeptide of the disclosure including a SIRPa DI domain variant does not include the sequence of any one of SEQ ID NOs: 26-36 shown in Table 4.
  • polypeptides and polypeptide constructs described herein are utilized in vitro for binding assays, such as immune assays.
  • the polypeptides and polypeptide constructs described herein are utilized in liquid phase or bound to a solid phase carrier.
  • polypeptides utilized for immunoassays are delectably labeled in various ways.
  • polypeptides and polypeptide constructs described herein are bound to various carriers and used to detect the presence of specific antigen expressing cells.
  • carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
  • the nature of the carrier can be either soluble or insoluble.
  • labels include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds.
  • Various techniques for binding labels to polypeptides disclosed herein are available.
  • the polypeptides are coupled to low molecular weight haptens. These haptens are then specifically detected by means of a second reaction.
  • tire hapten biotin is used with avidin or the haptens dinitroplienol, pyridoxal, or fluorescein are detected with specific anti-hapten antibodies (e.g., anti-dinitrophenoi antibodies, anti-pyridoxal antibodies, and anti-fluorescein antibodies respectively).
  • polypeptides comprising a signal- regulatory protein a (SIRP-a) Dl variant comprising a SIRPa D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRPa Dl domain (e.g., a wild-type SIRPa DI domain set forth in SEQ ID NO: I or 2); and at least one additional amino acid mutation relative to a wild-type SIRPa Dl domain (e.g., a wild-type SIRPa Dl domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92
  • polypeptides comprising an Fc domain variant, wherein an Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human TgG2 Fc region consisting of mutations A330S, P33 IS and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a polypeptide in a composition disclosed herein comprises a SIRPa Dl domain variant that has reduced or minimal glycosylation.
  • the Dl domain of SEQ ID NOs: 1 and 2 in Table 1 each contains a single potential N-linked glycosylation site at amino acid N80 in the sequence N80ITP.
  • Expression of a SIRPa Dl domain in Chinese Hamster Ovary (CHO) ceils results in a major band of 16 kDa (non-g!ycosylated) and a minor band of higher molecular weight that was removed by Endo Hf.
  • Endo Hf is a recombinant protein fusion of Endoglycosidase H and maltose binding protein.
  • Endo Hf cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. This implies that a proline at amino acid position 83 can reduce the efficiency of glycosylation, leading to a protein with different degrees of glycosylation and therefore heterogeneity. For drug development, heterogeneity can give rise to challenges in process development. Therefore, to investigate the possibility of generating homogenous, iion-giycosylated forms of SIRPa Dl domain variants, in some embodiments, ammo acid N8Q of a SIRPa Dl variant is mutated to Ala.
  • amino acid N80 in a SIRPa Dl domain variant is replaced by any amino acid, including any naturally and non-naturally occurring amino acid, e.g., N80A and N80Q.
  • a SIRPa Dl domain variant comprises an N80A mutation and at least 1 additional mutation (e.g. , at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 additional mutations or more).
  • the additional mutation is in die CD47 binding site.
  • the additional mutation is in the hydrophobic core of the D1 domain.
  • a polypeptide in a composition disclosed herein includes a SIRPa D1 domain variant that has increased glycosylation relative to a wild-type SIRPot D1 domain .
  • Another option to increase homogeneity of the final product is to enhance the efficiency of glycosylation at amino acid N80 and generate SIRPa D1 domain variants with increased glycosylation relative to a wild-type.
  • the amino acid P83 in the sequence NITP83 affects the degree of glycosylation at amino acid N 80.
  • changing P83 to any amino acid increases the efficiency of glycosylation at N80.
  • amino acid P83 in a SIRPa D1 domain variant is replaced by any amino acid, including naturally and non-naturally amino acids, e.g., P83V, P83A, P83I, and P83L.
  • a polypeptide of the disclosure is expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, for example by genetic engineering of the cell line (e.g., genetically engineered yeast or mammalian host) or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote (E. coh. etc ).
  • a SIRPa D1 domain variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 5.
  • the SIRPa D1 domain variants are not glycosylated or are minimally glycosylated.
  • the SIRPa D 1 domain variants are fully glycosylated or almost fully glycosylated.
  • a SIRPa D1 domain variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain.
  • a SIRPa D1 domain variant includes at most ten amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a SIRPa D1 domain variant includes at most seven ammo acid substitutions relative to a wiki-type D1 domain. In some embodiments, a SIRPa D1 domain variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D 1 domain.
  • a SIRPa D1 domain variant is a chimeric SIRPa D1 domain variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type DI domain or variant thereof and a portion of another wild-type D1 domain or variant thereof).
  • a chimeric SIRPa Dl domain variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D 1 domain.
  • a chimeric SIRPa D1 domain variant further includes one or more amino acid substitutions listed in Table 5.
  • a polypeptide includes a SiRPa D1 domain variant having a sequence of:
  • a polypeptide includes a SiRPa D1 domain variant having a sequence of SEQ ID NO: 37, wherein X is L, I, or V
  • X 2 is V, L, or, I. in some embodiments, X3 is A or V. in some embodiments, X4 is A, I, or L.
  • X5 is I, T, S, or F.
  • Ye is E, V, or L. in some embodiments, X ? is K or R.
  • Xs is E or Q.
  • X9 is H, P, or R.
  • X10 is L, T, or G.
  • Xu is K or R.
  • Xi 2 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X14 is V or I.
  • Xis is F, L, V. in some embodiments, X 6 is F or V.
  • a polypeptide provided herein includes no more than ten amino acid substitutions relative to the wild-type SiRPa DI domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide provided herein includes no more than seven amino acid substitutions relative to the wild-type SiRPa Dl domain having the sequence of SEQ ID NO: 1. [0095] In some embodiments, the polypeptide hinds CD47 with at least 10-fold greater binding affinity than the wild-type SIRPa D1 domain having die sequence of 8EQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than die wild-type SIRPa D1 domain having die sequence of SEQ ID NO: I.
  • the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 1.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x 10 9 M, less than 1 x 10 M, less 5 x 10 10 M, less than 1 x 0 i0 M or less than 1 x 10 i] M.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and I nM, between about I nM and 500 pM, betw een about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRPa DI domain variant having a sequence of:
  • Xs is K or R
  • Xs is E or Q
  • C ⁇ o is S, I, or G
  • Xu is K or R
  • Xi 3 IS P, A, C, D, E, F, G.
  • the variant comprises at least one amino acid substitution relative to a w ild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2.
  • a polypeptide includes a SIRPa DI domain variant having a sequence of SEQ ID NO: 38, wherein Xi is L, I, or V.
  • X is V, L, or, I.
  • X 3 is A or V.
  • X is V, 1, or L.
  • X5 is I, T, S, or F.
  • Xg is E, V, or L.
  • X ? is K or R.
  • Xg is E or Q.
  • X ⁇ is H, P, or R.
  • Xio is S, T, or G.
  • Xu is K or R.
  • Xi 2 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • C ⁇ 3 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X is V or L
  • X15 is F, L, or V.
  • Xig is F or V.
  • a polypeptide includes a SIRPa DI domain variant having no more than ten amino acid substitutions relative to the wild-type SIRPa Dl domain having die sequence of SEQ ID NO: 2. In some embodiments, a polypeptide includes a SIRPa Dl domain variant having no more than seven amino acid substitutions relative to the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wiki-type SIRPa DI domain having the sequence of SEQ ID NO: 2, In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a KD less than 1 x 10 S M, less than 5 x I0 ⁇ 9 M, less than 1 x 10 9 M, less 5 x 10 10 M, less than I x 10 ⁇ u M or less than lxlG !l M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and I nM, between about I nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRPa DI domain variant having a sequence of:
  • X 2 i s L, I, or V is E or G; X 2 i s L, I, or V ; X 3 is V, L, or, I; X 4 is S or F; X 5 is L or S; X* is S or T; X ? is A or V; X 8 is I or T; X 9 is H, R, or L: X 10 is A, V, 1, or L; Xu is 1, T, S, or F; X i2 is A or G; X 13 is E, V, or L; X i4 is K or R; Xis is E or Q; X !6 is H, P, or R; X 17 is D or E; X I8 is S, L, T, or G; X 19 is K or R; X 20 is E or N; X2 1 is S or P; X22 is S or R; X23 is S or G; X 24 is any amino acid; X25 is any amino acid; X
  • the polypeptide comprises the sequence of SEQ ID NO: 47, wherein Xi is E or G.
  • X2 is L, I, or V.
  • X3 is V, L, or, I in any of the aforementioned embodiments
  • X4 is S or F.
  • Xs is L or S.
  • Xe is S or T.
  • X ? is A or V.
  • Xs is I or T.
  • X is H or R.
  • Xio is A, V, I, or L.
  • Xu is I, T, S, or F.
  • X 12 is A or G.
  • Xn is E, V, or L.
  • Xu is K or R.
  • Xu is E or Q.
  • Xu is H, P, or R.
  • X s is S, L, T, or G.
  • Xi9 is K or R.
  • X20 is E or N.
  • X 2i is S or P.
  • X 22 is S or R.
  • X 2.3 is S or G.
  • X 24 is N, A, C, D, E, F, G, H, 1, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X? 6 is V or I.
  • X 27 is F, L, V.
  • X 28 is D or absent.
  • X 2.9 is T or V.
  • X30 is F or V.
  • X3 is A or G.
  • the polypeptide of th s aspect of the disclosure includes no more than ten ammo acid substitutions relative to the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 1 or 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wiid-type SIRPa Di domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1 or 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wiid-type SIRPa DI domain having the sequence of SEQ ID NO: 1 or 2.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x I O 9 M, less than I x I0 M, less 5 x 10 i0 M, less than I x 10 iy M or less than 1 x ICr 11 M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 50011M and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about I nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRPa D1 domain variant having a sequence of:
  • X10 is K or R: X i s E, D or Q; X i2 i s H or P; X i3 i s D or E; X 14 i s S, L or I; X i5 i s N or E; X 16 is R or S; Xn is G or S; XJS is N or A; X 19 is V or I; X 2 o is S, I or M; X 2j is P or absent; X 22 is D or P: and X 23 is V or T, or a fragment thereof.
  • the disclosure features a polypeptide including a SIRPa D1 domain variant having a sequence of:
  • EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX 7FPRVTTVSDX8TKRNNMDFSIRIGX9ITPADAGTYYCX10KFRKGSPDDVEFKSGAGTELS VRAKPS (SEQ ID NO: 49), wherein Xi is V, L, or 1; X 2 is A, I, V, or L; X 3 is 1, F, S, or I: X 4 is E, V, or L; X 5 is K or R; Xg is E or Q; X? is H, P, or R; Xs is L, T, S, or G; X ? is A; and Xio is V or 1; and wherein the variant comprises at least one amino acid substitution relative to a wild- type SIRPa D1 domain having the sequence of SEQ ID NO: I .
  • the polypeptide comprises the sequence of SEQ ID NO: 49, wherein Xs is V, L or I. in any of the aforementioned embodiments in this aspect of die disclosure, X 2 is A, 1, V, or L. In any of the aforeme tioned embodiments, X 3 is I, F, S, or T. In any of the aforementioned embodiments, X 4 i s E, V, or L. In any of the aforementioned embodimen ts, X 5 is K or R In any of the aforementioned embodiments, Xg is E or Q. In any of the aforementioned embodiments, X ? is H, P, or R. in any of the aforementioned embodiments, Xg is L, T, S or G. In any of the aforementioned embodiments, X ? is A. In any of the aforementioned embodiments, Xio is V or I.
  • the polypeptide comprises a SIRPa D1 domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 49, wherein each of Xy X 2, X 3, Xy Xs, Xg, X7. Xg. X9, and Xio are not a wild-type amino acid.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRPa D1 domain having hie sequence of any one of SEQ ID NO: I . In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to die wild-type SIRPa D1 domain having the sequence of any one of SEQ ID NO: I.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the w ild-type SIRPa D1 domain having die sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity' than die wild-type SIRPa D1 domain having die sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 1.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 a M, less than 5 x 10 9 M, less than 1 x 10 _V M, less 5 x 10 10 M, less than 1 x 10 i0 M or less than 1 x 1Q M.
  • a SIRPa D1 domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRPa D1 domain variant having a sequence of:
  • AKPS (SEQ ID NO: 50), wherein X s i s V or I; X 2 i s V or I; 3 ⁇ 4 is 1 or F; X 4 i s E or V; X 5 i s K or R; X 6 is E or Q; X ? is H or P; X» is S or T; X 3 ⁇ 4 is N or A; and Xio V or I: and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide comprises the sequence of SEQ ID NO: 50, w herein Xi is V or 1.
  • X ?. is V or I
  • X 3 is I or F.
  • X 4 is E or V.
  • X 5 is K or R.
  • Xg is E or Q.
  • X ? is H or P.
  • Xg is S or R.
  • X is N or A.
  • Xio is V or i.
  • the polypeptide comprises a SIRPa D1 domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 50, wherein each of Xi, X2 X3, X 4, X5, X. X?, Xs, Xs, and X10 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild -type SIRPa D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRPa D1 domain having the sequence of SEQ ID NO: 2. in some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x 10 9 M, less than I x I0 M, less 5 x 10 10 M, less than 1 x IO i0 M or less than 1 x 10 1! M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRPa DI domain variant having a sequence of:
  • EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5EGX6 FPRVTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSV RAKPS (SEQ ID NO: 51), wherein X t i s V or I; X 2 i s A or I; X 3 i s 1 or F; X is E or V; X 5 is K or R; Xe is H or P; X? is L or T; Xg is N or A; and X9 is V or I; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRPa Di domain having the sequence of SEQ ID NO: 1.
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein Xi is V or 1.
  • X2 is A or I.
  • X3 is I or F.
  • X4 is E or V
  • Xs is K or R.
  • Xs is H or P.
  • X? is L or T.
  • Xg is N or A.
  • X 9 is V or I.
  • X 4 is not V.
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein Xg is A.
  • Xs is A and Xi is V or I.
  • Xg is A and X 2 is A or I.
  • Xg is A and X 3 is I or F.
  • Xg is A and X 4 is E or V In some embodiments, X 4 is not V In any of the aforementioned embodiments, Xg is A and Xs is K or R.
  • Xg is A and Xs is H or P. In any of the aforementioned embodiments, Xg is A and X ? is A or V. In any of the aforementioned embodiments, Xg is A and X 9 is V or I
  • the polypeptide comprises the sequence of SEQ ID NO: 51, wherein Xg is A.
  • Xg is A and Xi is I.
  • Xg is A and X 2 is I.
  • Xg is A and X 3 is F.
  • Xg is A and X 4 is V.
  • Xg is A and Xs is R In any of the aforementioned embodiments, Xg is A and Xe is P In any of the aforementioned embodiments, Xg is A and X ? i s T. In any of the aforementioned embodiments, Xg is A and X 9 is I.
  • the polypeptide comprises a SIRPa DI domain variant that comprises at least 85% sequence identity ' (e.g., at least 86%, 87%, 88%, 89%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 51, wherein each of X t, X 2, X 3, X 4, Xs , Xs , X? , Xg , and Xg is not a wild-type ammo acid.
  • the polypeptide of this aspect of the disclosure comprises no more than ten amino acid substitutions relative to the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1 In some embodiments, the polypeptide of this aspect of the disclosure comprises no more than seven amino acid substitutions relative to the wild-type SIRPa DI domain having the sequence of S EQ ID NO: 1
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity' than the wild-type SIRPa D I domain having the sequence of SEQ ID NO: I In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity-' than tlie wild-type SIRPa Dl domain having the sequence of SEQ ID NOs: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity-' than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: I .
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a KD less than 1 x 10 8 M, less than 5 x lQ y M, less than 1 x 10 9 M, less 5 x 10 10 M, less than 1 x 10 ! ° M or less than 1 x S O 11 M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRPa DI domain variant having a sequence of:
  • PRVTTVSDXeTKRNNMDFSiRIGX-dTPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO: 222), wherein X ⁇ . is V, L, or I; X is A, I, or L; X 3 is I, T, S, or F; X 4 is K or R: Xs is H or P; Xe is L, T, or G; X? is N or A; and wherein the variant comprises at least one amino acid substitution relative to a wiki-type SIRPa Dl domain having a sequence according to SEQ ID NO: L
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X is V, L, or I.
  • X2 is A, I, or L.
  • X3 is L T, S, or F.
  • X4 is K or R.
  • Xs is H or P.
  • Xs is L, T, or G.
  • X ? is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein Xi is V or 1.
  • X2 is A or I
  • X 4 is K or R.
  • Xs is H or P in any of the aforementioned embodiments
  • Xs is L or T. in any of die aforementioned embodiments
  • X? is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X? is A.
  • X? is A and Xi is V or L in any of the aforementioned embodiments in this aspect of the disclosure, X? is A and X is A or I.
  • X ? is A and X 3 i s I or F.
  • X ? is A and X 4 is K or R. in any of the aforementioned embodiments, X ? is A and Xs is H or P. in any of the aforementioned embodiments, X ?
  • the polypeptide comprises the sequence of SEQ ID NO: 222, wherein X? is A.
  • X ? is A and Xi is I.
  • X? is A and X2 is I.
  • X ? is A and X3 is F.
  • X ? is A and X4 is R.
  • X? is A and X5 is P.
  • X ⁇ ; is A and X 3 ⁇ 4 is T.
  • the polypeptide comprises a SIRPa DI domain that comprises at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 222, wherein each of Xi, X3 ⁇ 4 X3, Xy X5, Xy and X? is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRPa Dl domain having die sequence of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRPa D l domain having the sequence of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 1.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 am o acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRPa DI domain variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRPa polypeptide binds to CD47.
  • a SIRPa DI domain variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 x 10 8 M, less than 5 x 10 9 M, less than I x 10 9 M, less 5 x 10 i0 M, less than 1 x lQ i0 M or less than I x 10 11 M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a K D between about 50011M and 10011M, between about 10011M and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM
  • the disclosure features a polypeptide including a SIRPct D1 domain variant having a sequence of:
  • RVTTVSEX 6 TKRENMDFSISISX7ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRA P
  • Xs is H, P, or R; Xe is S, T, or G; X? is N or A; and wherein the variant comprises at least one amino acid substitution relative to a wild-type SIRPa DI domain having the sequence of SEQ ID NO: 2.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein Xi is V, L, or I. in any of the aforementioned embodiments in this aspect of the disclosure, X 2 is V, I, or L. in any of the aforementioned embodiments, X3 is I, T, S, or F. In any of the aforementioned embodiments, X4 is K or R. In any of the aforementioned embodiments, Xs is H or P. In any of the aforementioned embodiments, Xe is S, T, or G. in any of the aforeme tioned embodiments, X ? is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X is V or I.
  • X 2 is V or I.
  • X3 is I or F.
  • X4 is K or R.
  • Xs is H or P.
  • Xs is S or T.
  • X ? is N or A.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X ? is A.
  • X ? is A and X t is V or I.
  • X ? is A and X 2 is V or I
  • X ? is A and X 3 is I or F.
  • X ? is A and X 4 is K or R.
  • X? is A and Xs is H or P.
  • X ? is A and Xe is S or T.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein X ? is A.
  • X ? is A and X t is I.
  • X ? is A and X 2 is I
  • X ? is A and X3 i s F.
  • X ? is A and X4 is R.
  • X ? is A and Xs is P.
  • X ? is A and X,. is T
  • the polypeptide comprises a SIRPa DI domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 212, wherein each of Xi , X 2, X3, X4, Xs, C ⁇ , and X? is not a wild-type amino acid.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild -type SIRPa Dl domain having the sequence of SEQ ID NO: 2. in some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRPa Dl domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRPa Dl domain having tire sequence of SEQ ID NO: 2.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 2.0 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRPa Dl domain variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRPa polypeptide binds to CD47.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a KD less than 1 x 10 s M, less than 5 x 10 9 M, less than 1 x IGr 9 M, less 5 x 1 O 10 M, less than I x 10 i0 M or less than 1 x 10 i! M.
  • a SIRPa Dl domain variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 n and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • Described herein, in some embodiments, is a polypeptide comprising a SIRPa Dl domain variant having a sequence according to:
  • SIRPec D1 domain variant comprises at least two amino acid substitutions relative to a wild-type SIRPa D1 domain having a sequence according to SEQ ID NO: 1.
  • the polypeptide comprises the sequence of SEQ ID NO: 212, wherein Xs, wherein Xs is A.
  • Xs is N.
  • Xio is L
  • X9 is N and X10 is P.
  • Xs is N and XI 1 is any ammo acid other than S, T, or C. in any of die aforementioned embodiments in this aspect of the disclosure Xu is T.
  • Xu is an amino acid other than T.
  • X 12 is P.
  • Xs is N and Xu is any amino acid other than P.
  • Described herein, in some embodiments, is a polypeptide comprising a SIRPec DI domain variant having a sequence according to:
  • EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX 3 PVGPIQWFRGAGPGRX4LIYNQX5X6GX sFPRVTTVSDXgTKRNNMDFSIRIGXsITXioADAGTYYCXnKFRKGSPDDVEFKSGAGTEL SVRAKPS (SEQ ID NO: 219), wherein X, is V, L, or I; X, is A, V, L, or I; X 3 i s I, S, I, or F;
  • X4 is E, L, or V ; Xs is K or R; Xs is E or Q; X ? is H, R, or P; Xg is S, G, L, or T; Xs is N; Xio is any amino acid other than P; and Xu is V or I; and wherein the SIRPa Dl domain variant comprises at least two am o acid substitutions relative to a wild-type SIRPa D I domain having a sequence according to SEQ ID NO: 1.
  • compositions which include a SIRPa Dl domain variant polypeptide having hie amino acid sequence of SEQ ID NO: 48, or a fragment thereof.
  • the SIRPa D I domain variant polypeptide or fragment thereof binds to CD47 with a higher affinity compared to the affinity that a SIRPa polypeptide binds to the CD47.
  • the SIRPa D I domain variant polypeptide binds to CD47 with a Ki> less than 1 x 10 8 M, or less than 1 x ICr 9 M, less than 1 x IQ 10 M or less than 1 x 10 u M.
  • the above-mentioned SIRPa Dl domain variant polypeptides are attached or fused to a second polypeptide.
  • the second polypeptide includes, without limitation, an Fc polypeptide, an Fc variant or a fragment of the foregoing.
  • a SIRPa Dl domain variant polypeptide is selected from any one of SEQ ID NOs: 53-87 and 213 shown in Table 6
  • the polypeptide comprises a SIRPa DI domain variant that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 6
  • the polypeptide comprises a SIRPa Dl domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ IDNOs: 80, 1, or 85 in Table 6
  • polypeptides comprising a signal- regulatory protein a (SIRP-a) Di variant comprising a SIRPa D l domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRPa Dl domain (e.g., a wild-type SIRPa Dl domain set forth in SEQ ID NO: 1 or 2); and at least one additional amino acid mutation relative to a wild-type SIRPa Dl domain (e.g., a wild-type SIRPa Dl domain set forth in SEQ ID NO: 1 or 2) at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP-a signal- regulatory protein a
  • Fc domain variant dimers wherein the Fc domain variant dimer comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S,
  • P331S and N297A or (hi) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, de!G236, and N297A.
  • Antibodies that target cell surface antigens can trigger immunostimulatory and effector functions that are associated with Fc receptor (FcR) engagement on immune cells.
  • FcR Fc receptor
  • Fe receptors There are a number of Fe receptors that are specific for particular classes of antibodies, including igG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of the Fc region to Fe receptors on cell surfaces can trigger a number of biological responses including phagocytosis of antibody-coated particles (antibody-dependent cell-mediated phagocytosis, or ADCP), clearance of immune complexes, lysis of antibody- coated cells by killer cells (antibody-dependent cell-mediated cytotoxicity, or ADCC) and, release of inflammatory' mediators, placental transfer, and control of immunoglobulin production. Additionally, binding of the Cl component of complement to antibodies can activate the complement system.
  • ADCP antibody-dependent cell-mediated phagocytosis
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • Activation of complement can be important for tire lysis of cellular pathogens. However, die activation of complement can also stimulate tire inflammatory- response and can also be involved in autoimmune hypersensitivity-' or other immunological disorders. Variant Fc regions with reduced or ablated ability' to bind certain Fc receptors are useful for developing therapeutic antibodies and Fc-fusion polypeptide constructs which act by targeting, activating, or neutralizing ligand functions while not damaging or destroying local cells or tissues.
  • a STRPa D1 polypeptide constract comprises a non-naturally occurring SIRPa Dl domain variant linked to an Fc domain variant which forms an Fc domain having ablated or reduced effector function
  • a Fc domain variant refers to a polypeptide chain that includes second and third antibody constant domains (e.g., CH2 and CH3).
  • an Fc domain variant also includes a hinge domain.
  • the Fc domain variant is of any immunoglobulin antibody isotype, including IgG, TgE, IgM, IgA, and IgD. Additionally, in some embodiments, an Fc domain variant is of any IgG subtype (e.g.,
  • an Fc domain variant comprises as many as ten amino acid modifications (e.g., insertions, deletions and/or substitutions) relative to a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof) that alter the interaction between an Fc domain and an Fc receptor.
  • amino acid modifications e.g., insertions, deletions and/or substitutions
  • a wild-type Fc domain monomer sequence e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof
  • Fc domain dimer refers to a dimer of two Fc domains in a wild-type Fc domain dimer, two wild-type Fc domains dimerize by the interaction between the two CH3 antibody constant domains, as well as one or more disulfide bonds that form between the hinge domains of the two dimerized Fc domains.
  • an Fc domain dimer variant comprises Fc domain variants that are mutated to lack effector functions, for example a “dead Fe domain dimer variant.”
  • each of the Fc domains in an Fc domain dimer variant includes amino acid substitutions in the CH2 antibody constant domain to reduce the interaction or binding between the Fe domain disner variant and an Fc receptor, such as an Fey receptor (FcyR), an Fca receptor (FcaR), or an FCE (FCER).
  • FcyR Fey receptor
  • FcaR Fca receptor
  • FCER FCE
  • a SIRPa D1 domain variant (e.g, any of the variants described in Tables 2, 5, and 6) is fused to an Fc domain variant of an immunoglobulin or a fragment of an Fc domain variant.
  • an Fc domain variant of an immunoglobulin or a fragment of an Fe domain variant is capable of forming an Fc domain dimer with another Fc domain variant.
  • an Fc domain variant of an immunoglobulin or a fragment of an Fc domain variant is not capable of forming an Fc domain dimer with another Fc domain variant.
  • an Fc domain variant or a fragment of an Fc domain variant is fused to a polypeptide of the disclosure to increase serum half-life of the polypeptide.
  • an Fc domain variant or a fragment of an Fc domain variant fused to a polypeptide of the disclosure dimerizes with a second Fc domain variant to form an Fc domain dimer variant which binds an Fc receptor, or alternatively, an Fc domain variant binds to an Fc receptor in some embodiments, an Fc domain variant or a fragment of the Fe domain variant fused to a polypeptide to increase serum half-life of the polypeptide does not induce any immune system-related response.
  • a SIRPa polypeptide or construct provided herein includes a SIRPa D1 domain or variant thereof joined to a first Fc domain variant and an antibody variable domain joined to a second Fe domain variant, in which the first and second Fc domain variants combine to form an Fe domain dimer variant (e.g., a heterodimeric Fc domain dimer variant).
  • An Fc domain dimer is the protein structure that is found at the C-terminus of an immunoglobulin.
  • An Fc domain dimer includes two Fc domains that are dimerized by the interaction between the CHS antibody constant domains.
  • a wild-type Fc domain dimer forms the minimum structure that binds to an Fe receptor, e.g., Fc RJ, FcyRIIa, FcyRIib, FeyRIIIa, FcyRIllb, and FcyRIV.
  • the Fc domain dimer is not involved directly in binding an antibody to its target, but can be involved in various effector functions, such as participation of the antibody in antibody- dependent cellular toxicity.
  • the Fc domain in a SIRPa polypeptide or constract of the disclosure comprises amino acid substitutions, additions or insertions, deletions, or any combinations thereof that lead to decreased effector function such as decreased antibody- dependent cell-mediated cytotoxicity' (ADCC), decreased complement-dependent cytolysis (CDC), decreased antibody-dependent cell-mediated phagocytosis (ADCP), or any combinations thereof.
  • the SIRPa polypeptides or constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to a human Fe receptor and decreased binding (e.g. , minimal binding or absence of binding) to complement protein Clq.
  • the SIRPa constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to human FcyRJ, FcyRTIA, FeyRIiB, FcyRIIIB, or any combinations thereof, and Clq.
  • the Fe domains in SIRPa constructs of the disclosure are of the IgG class and comprise one or more amino acid substitutions at E233, L234, L235, G236, G237, D265, D270, N297, E318, K320, K322, A327, A330, P331, or P329 (numbering according to the F/U index of Kabat (Sequences of Proteins of immunological Interest, 5 th Ed. Public Health Sendee, National Institutes of Health, Bethesda, MD. (1991))).
  • polypeptide constructs comprising a non-native Fc region described herein exhibit reduced or ablated binding to at least one of Fey receptors CD 16a, CD32a, CD32b, CD32c, and CD64 as compared to a polypeptide construct comprising a native Fc region in some cases, the polypeptide constructs described herein exhibit reduced or ablated binding to CD 16a, CD32a, CD32b, CD32c, and CD64 Fey receptors.
  • CDC refers to a form of cytotoxicity in which the complement cascade is acti vated by the complement component Clq binding to antibody Fc domains.
  • polypeptide constructs comprising a non-native Fc region described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in Clq binding compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction m CDC compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-natural Fc domain variants or Fc domain dimer variants as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • the Fc domain variants or Fe domain dimer variants described herein are minimally glycosylated or have reduced giycosylation relative to a wild-type sequence.
  • deg!ycosylation is accomplished with a mutation of N297A, or by mutating N297 to any ammo acid which is not N.
  • the N-Xaal-Xaa2-Xaa3 motif refers to residues 297-300 as designated according to Kabai et al., 1991.
  • a mutation to any one or more of N, Xaal , Xaa2, or Xaa3 results in deglycosy!ation of the Fc domain variant or Fc domain dimer variant.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fey receptors or have a reduced capacity to induce phagocytosis.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fey receptors and have a reduced capacity to induce phagocytosis.
  • an Fc domain variant is mutated to lack effector functions, typical of a “dead Fc domain variant.
  • an Fc domain variant includes specific amino acid substitutions that are known to minimize the interaction between the Fc domain dimer and an Fey receptor.
  • an Fc domain variant is from an IgGl antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al, 1991).
  • one or more additional mutations are included in such IgGl Fc domain variant.
  • additional mutations for human IgGl Fc domain variants include E318A and K322A.
  • a human IgGl Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer mutations in total as compared to wild- type human IgGl sequence in some embodiments, one or more additional deletions are included in such IgGl Fc domain variant.
  • the C-tenninal lysine of the Fc domain IgGl heavy chain constant region provided in SEQ ID NO: 88 in Table 7 is deleted, for example to increase the homogeneity of die polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgGl Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgGl sequence (see, e.g., SEQ ID NO: 161 below).
  • a IgGl Fc domain variant has a sequence according to any one of SEQ ID NO: 135, SEQ ID NO: 136 or SEQ ID NO: 137.
  • an Fc domain variant is from an IgG2 or IgG4 antibody and includes ammo acid substitutions A330S, P3315, or both A330S and P3318.
  • the aforementioned amino acid positions are defined according to Kabat, el al. (1991). The Kabat numbering of ammo acid residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the Fc domain variant comprises a human igG2 Fc domain sequence comprising one or more of A330S, P3318 and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • one or more additional mutations are included in such IgG2 Fc domain variants.
  • additional mutations for human IgG2 Fc domain variant include V234A, G237A, P238S, V309L and H268A (as designated according to the EU numbering system per Kabat et al. (1991)).
  • a human IgG2 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 or fewer mutations in total as compared to wild-type human IgG2 sequence.
  • one or more additional deletions are included in such TgG2 Fc domain variant.
  • the C -terminal lysine of the Fc domain IgG2 heavy chain constant region provided in SEQ ID NO: 89 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgG2 Fc domain variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human TgG2 sequence (see, e.g., SEQ ID NO: 162 below).
  • such Fc domain variant comprises a 8228P mutation (as designated according to Kabat, et al.
  • a human IgG4 Fc domain variant has up to 12, I I, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation(s) in total as compared to wild-type human IgG4 sequence in some embodiments, the Fc domain variant comprises a human IgG4 Fc sequence comprising one or more of S228P, E233P, F234V, L235A, and deIG236 amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • the Fc domain variant comprises a human IgG4 Fc sequence comprising one or more of S228P, E2.33P, F234V, L235A, delG236, and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • the Fc domain variant includes at least one of the mutations L234A, L235A, G237A or N297A of an IgGl Fc region or at least one of the mutations A330S, P331S or N297A of an IgG2 Fc region.
  • the Fc domain variant includes at least two of the mutations L234A, L235A, G237A or N297A of an IgGl Fc region or at least two of the mutations A330S, P33 IS or N297A of an IgG2 Fc region in some embodiments, the Fc domain variant includes at least three of the mutations L234A, L235A, G237A or N297A of an IgGl Fc region or consists of the mutations A330S, P33 IS and N297A of an lgG2 Fc region in some embodiments, the Fc domain v ariant consists of the mutations L234A, L235A, G237A and N297A.
  • the Fc domain variant exhibits reduced binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits ablated binding to an Fc receptor of the subject compared to the wiki-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits a reduction of phagocytosis compared to the wild-type human IgG Fc region. In some embodiments, the Fc domain variant exhibits ablated phagocytosis compared to the wild-type human IgG Fc region.
  • SEQ ID NO: 88 and SEQ ID NO: 89 provide amino acid sequences of Fc domain IgGl and IgG2 heavy chain constant regions.
  • an Fc domain variant is any variant of SEQ ID NOs: 90-95 as shown in Table 7.
  • Antibody -dependent cell-mediated cytotoxicity which is also referred to herein as ADCC, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) ceils and neutrophils) enabling these cytotoxic effector cells to bind specifically to an antigen-bearing target ceil and subsequently kill the target cell.
  • FcRs Fc receptors
  • Antibod -dependent cell-mediated phagocytosis which is also referred to herein as ADCP, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcKs) present on certain phagocytic cells (e.g., macrophages) enabling these phagocytic effector cells to bind specifically to an antigen-bearing target cell and subsequently engulf and digest the target cell
  • Ligand-specific high-affinity IgG antibodies directed to the surface of target cells can stimulate die cytotoxic or phagocytic cells and can be used tor such killing in some embodiments polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit reduced ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in ADCC or ADCP compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit ablated ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • Complement-directed cytotoxicity which is also referred to herein as CDC, refers to a form of cytotoxicity in which the complement cascade is activated by the complement component Clq binding to antibody Fc domains.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in Clq binding compared to a polypeptide constract comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%,
  • polypeptide constructs comprising an Fc domain variant or Fc domain dimer variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • Fc domain variants or Fc domain dimer variants herein include those that exhibit reduced binding to an Fey receptor compared to the wild-type human IgG Fc region.
  • an Fc domain variant or Fc domain dimer variant exhibits binding to an Fey receptor that is less than the binding exhibited by a wild-type human IgG Fc region to an Fey receptor, as described in the Examples.
  • an Fc domain variant or Fc domain dimer variant has reduced binding to an Fey receptor by a factor of 10%, 20%
  • the reduced binding is for any one or more Fey receptor, e.g., CD 16a, CD32a, CD32b, CD32c, or CD64.
  • the Fc domain variants or Fc domain dimer variants disclosed herein exhibit a reduction of phagocytosis compared to its wild-type human IgG Fc region.
  • Such Fe domain variants or Fc domain dimer variants exhibit a reduction in phagocytosis compared to its wild-type human IgG Fc region, wherein die reduction of phagocytosis activity is e.g., by a factor of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%.
  • an Fc domain variant or Fc domain dimer variant exhibits ablated phagocytosis compared to its wild-type human IgG Fc region.
  • the Fc domain variants or Fc domain dimer variants disclosed herein are coupled to one or more fusion partners in some cases the fusion partner is a therapeutic moiety in some eases, the fusion partner is selected to enable targeting of an expressed protein, purification, screening, display, and the like. In some embodiments, the fusion partner also affects the degree of binding to Fc receptors or the degree of phagocytosis reduction. As described herein, in some embodiments, when an Fc domain variant or Fc domain dimer variant is coupled to a fusion partner, it forms a polypeptide construct as described below.
  • fusion partners are linked to the Fc domain variant or Fc domain dimer variant sequence via a linker sequence.
  • the linker sequence generally comprises a small number of amino acids, such as less than ten amino acids, although longer linkers are also utilized.
  • the linker has a length less than 10, 9, 8, 7, 6, or 5 amino acids or shorter.
  • the linker has a length of at least 10, 11, 12, 13, 14, 15,
  • cleavabie linker is employed.
  • a fusion partner is a targeting or signal sequence that directs an Fc domain variant or Fc domain dimer variant protein and any associated fusion partners to a desired cellular location or to the extracellular media.
  • certain signaling sequences target a protein to be either secreted into the growth media, or into the periplasmic space, located between the inner and outer membrane of the ceil.
  • a fusion partner is a sequence that encodes a peptide or protein that enables purification or screening.
  • Such fusion partners include, but are not limited to, polyhistidine tags (His-tags) (for example His6 (SEQ ID NO: 223) and His 10 (SEQ ID NO: 224)) or other tags for use with immobilized Metal Affinity Chromatography (IMAC) systems (e.g., Ni+2 affinity columns), GST fusions, MBP fusions. Strep-tag, the BSP biotinylation target sequence of the bacterial enzyme BirA, and epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
  • His-tags polyhistidine tags
  • IMAC immobilized Metal Affinity Chromatography
  • Strep-tag the BSP biotinylation target sequence of the bacterial enzyme BirA
  • epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
  • such tags are useful for purification, for screening, or both.
  • an Fe domain variant or Fc domain dimer variant is purified using a His-tag by immobilizing it to a Ni+2 affinity column, and then after purification the same His-tag is used to immobilize the antibody to a Ni+2 coated plate to perform an ELISA or other binding assay as described elsewhere herein.
  • a fusion partner enables the use of a selection method to screen Fc domain variants or Fc domain dimer variants as described herein.
  • fusion partners that enable a variety of selection methods are available. For example, by fusing the members of an Fc domain variant or Fc domain dimer variant library to the gene III protein, phage display can be employed in some embodiments, fusion partners Fc domain variants or Fc domain dimer variants to be labeled. Alternatively, in some embodiments, a fusion partner binds to a specific sequence on the expression vector, enabling the fusion partner and associated Fc domain variant or Fc domain dimer variant to be linked covalently or noneovalently with the nucleic acid that encodes them.
  • the therapeutic moiety is, e.g., a peptide, a protein, an antibody, a siRNA, or a small molecule.
  • therapeutic antibodies that are coupled to the Fc domain variants or Fc domain dimer variants of the present disclosure include, but are not limited to antibodies that recognize CD47.
  • therapeutic polypeptides that are coupled to the Fc domain variants or Fc domain dimer variants of the present disclosure include, but are not limited to, CD47 binding polypeptides, including SIRPa polypeptides. In such instances, the CD47 binding polypeptide is attached or fused to an Fc domain variant or Fc domain dimer variant of the disclosure.
  • CD47 binding polypeptides include, but are not limited to, anti-CD47 antibodies or fragments thereof, and ligands of CD47 such as SIRPa or a fragment thereof. Additional examples of CD47 binding polypeptides include, but are not limited to naturally- occurring forms of SIRPa as well as mutants thereof.
  • a polypeptide comprising an Fc domain dimer variant, wherein the Fc domain dimer variant comprises two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P33 IS and N297A; or (fix) a human lgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc domain variants are identical (/. ⁇ ?., homodimer) in some embodiments, the Fc domain variants are different (/ £ , heterodimer).
  • at least one of the Fc domain variant in an Fc domain dimer is a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N 297A.
  • at least one of the Fc domain variants in an Fc domain dimer is a human IgG2 Fc region consisting of mutations A330S, P33IS and N297A.
  • the Fc domain dimer variant exhibits ablated or reduced binding to an Fey receptor compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc domain dimer variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32e, and CD64 Fey receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc domain dimer variant exhibits ablated or reduced binding to Clq compared to the wild-type version of the human IgG Fc fusion.
  • At least one of the Fc domain variants in an Fc domain dimer variant is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc domain dimer variant exhibits ablated or reduced binding to an Fey receptor compared to the wild-type human IgG4 Fc region.
  • the Fc domain dimer variant exhibits ablated or reduced binding to CD 16a and CD32b Fey receptors compared to the wild-type v ersion of its human igG4 Fc region.
  • the Fc domain dimer variant binds to an Fey receptor with a K D greater than about 5 x 10 f M.
  • the Fc domain dimer variant further comprises a CD47 binding polypeptide. In some embodiments, the Fc domain dimer variant exhibits ablated or reduced binding to an Fey receptor compared to a wild-type version of a human IgG Fc region.
  • the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans.
  • the CD47 binding polypeptide is a signal-regulatory' protein a (SIRP-a) polypeptide or a fragment thereof in some embodiments, the SIRPa polypeptide comprises a SIRPa DI domain variant comprising the amino acid sequence, EEELQXiIQPDKSVLVAAGETATLRCTXaTSLXiPVGPIQWFRGAGPGRXiLTYNQXsEGXe FPRVTTVSDX7TKRNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVEFKSGAGTELSV RAKPS (SEQ ID NO: 221), wherein X is V or I; X is A or I; X3 is I or F; X 4 is E or V ; X $ is K or R; Cb is H or P; X ?
  • the SIRPa polypeptide comprises a SIRPa DI domain variant wherein X ⁇ is V or I; X2 is A or I: X3 is i or F: X4 is E: X5 is K or R; Xr 3 is H or P: X ? is L or T; Xs is not N; and X9 is V.
  • a polypeptide comprising: a SIRPa DI domain variant, wherein the SIRPa DI domain variant is a non-naturaily occurring high affinity SIRPa DI domain, wherein the SIRPa DI domain variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring DI domain; and an Fc domain variant, wherein the Fc domain variant is linked to a second polypeptide compr sing a second Fc domain variant to form an Fc domain dimer variant, wherein the Fe domain dimer variant has ablated or reduced effector function.
  • the non -naturally occurring high affinity SIRPa D1 domain comprises an amino acid mutation at residue 80.
  • SIRPa D1 domain variant is a SIRPa D1 domain variant, wherein the SIRPa D1 domain variant binds CD47 from a first species with a K D less than 250 nM; and wherein die SIRPa D1 domain variant binds CD47 from a second species with a K D less than 250 nM; and the KD for CD47 from the first species and the KD for CD47 from the second species are within 100 fold of each other; wherein die first species and die second species are selected from the group consisting of: human, rodent, and non-human primate.
  • the SIRPa D I domain variant binds CD47 from at least 3 different species.
  • the non-human primate is cynomolgus monkey.
  • a polypeptide comprising (a) a SIRPa D1 domain that binds human CD47 with a K D less tiian 250 nM; and (b) an Fc domain or variant thereof linked to the N-terminus or the C-terminns of the SIRPa DI domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates.
  • the polypeptide is a non-naturally occurring variant of a human SIRP-a.
  • administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration.
  • the polypeptide further comprises at least one Fc domain dimer variant, wherein the Fc domain dimer variant comprises an Fc domain variant selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human lgG4 Fc region comprising mutations S228P, E233P, F234V, L2.35A, delG236, and N297A.
  • Fc domain dimer variant comprises an Fc domain variant selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human lg
  • the Fc domain variant is a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc domain variant is a human TgG2 Fc region consisting of mutations A330S, P331 S and N297A.
  • the SIRPa constructs of the disclosure include a SIRPa domain or variant thereof that has its C -terminus joined to the N-terminus of an Fc domain or variant thereof by way of a linker using conventional genetic or chemical means, e.g., chemical conjugation.
  • a linker e.g , a spacer
  • a polypeptide of the disclosure including a SIRPa Dl domain variant is fused to an Fc domain variant that is incapable of forming a dimer.
  • a polypeptide of the disclosure is fused to an Fc domain or variant thereof that is capable of forming a dimer, e.g.
  • a polypeptide of the invention is fused to an Fc domain or variant thereof and tiiis fusion protein forms a homodimer in some embodiments, a polypeptide of the disclosure is fused to a first Fc domain or variant thereof and a different protein or peptide (e.g., an antibody variable region) is fused to a second Fc domain or variant thereof.
  • a different protein or peptide e.g., an antibody variable region
  • a SiRPa Di domain or variant thereof is joined to a first Fc domain or variant thereof and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti inflammatory agent, or an immunomodulatory agent) is joined to a second Fc domain or variant thereof.
  • a therapeutic protein e.g., a cytokine, an interleukin, an antigen, a steroid, an anti inflammatory agent, or an immunomodulatory agent
  • the first and second Fc domains or variants thereof form a heterodimer.
  • a SIRPa Dl domain variant polypeptide (e.g , any of the variants described in Tables 2, 5, and 6) is fused to an Fc polypeptide or Fc variant polypeptide, such as an Fc domain or variant thereof.
  • Fc polypeptide or Fc variant polypeptide such as an Fc domain or variant thereof.
  • polypeptides comprising a SiRPa DI domain variant polypeptide and a fused Fc domain variant polypeptide include, but are not limited to, SEQ ID NOS: 96-137, 214, and 216 shown in Table 8
  • the polypeptide comprises a SIRPa DI variant domain that has at least 85% sequence identity (e.g, at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%,, or 100% sequence identity) to any variant provided in Table 8
  • the polypeptide comprises a SIRPa Dl domain variant that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 98-104, 107- 113, 116-122, or 135-137 in Table 8.
  • the polypeptide comprises (a) a signal-regulatory protein a (SIRP-a) Dl variant, wherein the SIRPa Dl domain variant comprises the amino acid sequence, EEX1X2QX3IQPDKX4 VXsVA A GEXeXrXsLXeCTXioTSLXi iPVGPIQWFRGA GPX l?
  • SIRP-a signal-regulatory protein a
  • X19 is K.
  • SIRPot D1 domain variant comprises at least two amino acid substitutions relative to a wild-type SIRPa D1 domain having a sequence according to any one of SEQ ID NOs: 1 to 10; and (b) an Fc domain dimer variant having two Fc domain variants, wherein each Fc domain variant independently is (i) a human IgGl Fe region comprising a N297A mutation; (ii) a human IgGl Fc region comprising L234A, L2.35A, and G237A mutations; (hi) a human
  • the polypeptide comprises a SIRPa D1 domain variant wherein the SIRPa DI domain variant comprises an am o acid sequence according to SEQ ID NO: 47: an Fc domain dimer having two Fc domains, wherein one of the Fc domains is an Fc domain variant comprising a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations.
  • a SIRPa D 1 domain variant polypeptide (e.g. , any of the variants described in Tables 2, 5, and 6) is fused to a first Fc domain (e.g., an Fe domain variant) either at the N-terminus or at the C-terminus.
  • a first Fc domain e.g., an Fe domain variant
  • the first Fc domain is a variant that is incapable of forming an dimer in some embodiments, the first Fe domain forms a dimer with a second Fc domain.
  • the first and second Fc domains comprise amino acid substitutions that promote heterodimerization between the first and second domain Fc domains.
  • each of the two Fc domains in an Fc domain dimer includes amino acid substitutions that promote the heterodimerization of the two monomers.
  • a SIRPa construct is formed, for example, from a first subunit including a SIRPa Di domain variant polypeptide fused to a first Fe domain and a second subunit including a second Fe domain (e.g., without a SIRPa D1 domain variant polypeptide or any other polypeptide).
  • a construct has a single SIRPa D1 domain variant polypeptide linked to an Fc domain dimer (e.g., single arm).
  • a construct has two SIRPa D1 domain variant polypeptides linked to an Fc domain dimer (e.g., double arm).
  • a SIRPa D1 domain variant having a K D of about 500 nM is particularly useful in a double arm construct.
  • a SIRPa D1 domain variant having a KD of about 50 nM is particularly useful in a double arm construct.
  • a SIRPa D1 domain variant having a KD of about 5 nM is useful in a double ami construct and a single arm construct.
  • a SIRPa D1 domain variant having a KD of about 500 pM is useful in a double arm construct and a single ami construct.
  • a SIRPa D1 domain variant having a KD of about 100 pM is useful in a double arm construct and a single arm construct.
  • a SIRPa D I domain variant ha ving a KD of about 50 pM is useful in a double arm construct and a single arm construct.
  • a SIRPa D1 domain variant having a K D of about 10 pM is useful in a double arm construct and a single ami construct.
  • heterodimerization of Fc domains is promoted by introducing different, but compatible, substitutions in the two Fe domains, such as “knob-into-hole” residue pairs and charge residue pairs.
  • the knob and hole interaction favors heterodimer formation, whereas the knob-knob and the hole-hole interaction hinder homodimer formation due to steric clash and deletion of favorable interactions.
  • a hole refers to a void that is created when an original amino acid in a protein is replaced with a different amino acid having a smaller side- chain volume
  • a knob refers to a bump that is created when an original amino acid in a protein is replaced with a different amino acid having a larger side-chain volume.
  • an amino acid being replaced is in the CH3 antibody constant domain of an Fc domain and involved in the dimerization of two Fc domains.
  • a hole in one CH3 antibody constant domain is created to accommodate a knob in another CH3 antibody constant domain, such that the knob and hole ammo acids act to promote or favor the heterodimerization of the two Fc domains.
  • a hole in one CH3 antibody constant domain is created to beter accommodate an original ammo acid in another CH3 antibody constant domain in some embodiments, a knob in one CH3 antibody constant domain is created to form additional interactions with original amino acids in another CH3 antibody constant domain.
  • a hole is constructed by replacing amino actds having larger side chains such as tyrosine or tryptophan with amino acids having smaller side chains such as alanine, valine, or threonine, for example a Y407V mutation in the CH3 antibody constant domain.
  • a knob is constructed by replacing amino acids having smaller side chains with amino acids having larger side chains, for example a T366W mutation in the CHS antibody constant domain.
  • one Fc domain includes the knob mutation T366W and the other Fc domain includes hole mutations T366S, L358A, and Y407V.
  • a polypeptide of the disclosure including a SIRPa D1 domain variant is fused to an Fc domain including the knob mutation T366W to limit unwanted knob-knob hoinodimer formation.
  • knob-into-hole amino acid pairs are included, without limitation, in Table 9 and examples of knob-into-hole Fc domain variants and SIRPa -- Fc fusions are provided in Table 10.
  • electrostatic steering is also used to control the dimerization of Fc domains.
  • Electrostatic steering refers to the utilization of favorable electrostatic interactions between oppositely charged amino acids in peptides, protein domains, and proteins to control the formation of higher ordered protein molecules.
  • one or more amino acid residues that make up the CH3-CH3 interface are replaced with positively- or negatively-charged ammo acid residues such that the interaction becomes electrostatically favorable or unfavorable depending on the specific charged amino acids introduced.
  • a positively-charged am o acid in the interface such as lysine, arginine, or histidine, is replaced with a negattvely-charged amino acid such as aspartic acid or glutamic acid.
  • a negatively -charged amino acid in the interface is replaced with a positively-charged amino acid.
  • the charged amino acids are introduced to one of the interacting CH3 antibody constant domains, or both in some embodiments, introducing charged amino acids to the interacting Cl 13 antibody constant domains of the two Fc domains promotes the selective formation of heterodimers of Fc domains as controlled by the electrostatic steering effects resulting from the interaction between charged amino acids. Examples of electrostatic steering amino acid pairs are included, without limitation, in Table 11. Table 11 Electrostatic Steering Amino Acid Pairs
  • a first Fc domain and a second Fc domain each includes one or more of the following ammo acid substitutions: T366W, T366S, L368A, Y407V, T366Y , T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, 1,35 IK, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, 1 4051.
  • an Fc domain comprises: (a) one of the following amino acid substitutions relative to wild type human IgGl: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, 1,35 IK, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, 1 4051.
  • G237A, and N297A mutation relative to a human IgGl Fc region (iv) a N297A mutation relative to a human IgG2 Fc region; (v) a A330S and P33IS mutation relative to a human IgG2 Fc region; (vi) a A330S, P33 IS, and N297A mutation relative to a human lgG2 Fc region; (vii) a S228P, E233P, F234V, L235A, and delG236 mutation relative to a human IgG4 Fc region; or (viii) a S228P, E233P, F234V, L2.35A, delG236, and N297A mutation relative to a human IgG4 Fc region.
  • an Fc domain variant comprises: (a) one of the following amino acid substitutions relative to wild type human IgGl : T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395M, P396T, V397T, V397Q, L398T.
  • the first and second Fc domains include different amino acid substitutions in some embodiments, the first Fe domain includes T366W. In some embodiments, the second Fe domain includes T366S, L368A, and Y4Q7V. in some embodiments, the first Fc domain includes D399K. In some embodiments, the second Fc domain includes K409D.
  • polypeptides comprising a signal- regulatory protein a (SIRP-a) D1 variant comprising a SIRPa DI domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRPa Di domain; and at least one additional amino acid mutation relative to a wild-type SIRPa DI domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP-a signal- regulatory protein a
  • polypeptides comprising an Fe variant, wherein the Fc variant comprises an Fe domain dimer comprising two Fc domain variants, wherein each Fc domain variant independently is selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A3308, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a linker is used to describe a linkage or connection between polypeptides or protein domains or associated non-protein moieties.
  • a linker is a linkage or connection between an Fe domain (or variant thereof) and a SIRPa Di domain variant.
  • the linker connects the C-terminus of the SIRPa DI domain variant and the N-terminus of the Fc domain variant, such that the two polypeptides are joined to each other in tandem series.
  • a linker is a simple covalent bond, e.g. , a peptide bond, a synthetic polymer, or any kind of bond created from a chemical reaction, e.g. chemical conjugation.
  • a linker is a peptide bond
  • the carboxylic acid group at the C-termmus of one protein domain reacts with the amino group at the N-terminus of another protein domain in a condensation reaction to form a peptide bond.
  • the peptide bond is formed from synthetic means through a con ventional organic chemistry ⁇ reaction, or by natural production from a host ceil, wherein a nucleic acid molecule encoding the DNA sequences of both proteins (e.g., an Fc domain variant and a SFRPa Di domain variant) in tandem series can be directly transcribed and translated into a contiguous polypeptide encoding both proteins by the necessary molecular machineries (e.g., DNA polymerase and ribosome) in the host cell
  • a linker is a synthetic polymer
  • the polymer is functionalized with reactive chemical functional groups at each end to react with the terminal amino acids at the connecting ends of two proteins.
  • a linker (except peptide bond mentioned above) is made from a chemical reaction
  • chemical functional groups e.g., amine, carboxylic acid, ester, azide, or other functional groups
  • the two functional groups then react through synthetic chemistry means to form a chemical bond, thus connecting the two proteins together.
  • a linker between an Fc domain monomer and a SIRPa Dl variant polypeptide of the disclosure is an amino acid spacer including about 1-200 amino acids.
  • Suitable peptide spacers include peptide linkers containing flexible amino acid residues such as glycine and serine. Examples of linker sequences are provided in Table 12.
  • a spacer contains motifs, e.g., multiple or repeating motifs, of GS, GG, GGS, GGG, GGGGS (SEQ ID NO: 163), GGSG (SEQ ID NO: 164), or SGGG (SEQ ID NO: 165).
  • a spacer contains 2 to 12 amino acids including motifs of GS, e.g., GS, GSGS (SEQ ID NO: 166), GSGSGS (SEQ ID NO: 167), GSGSGSGS (SEQ ID NO: 168), GSGSGSGSGS (SEQ ID NO: 169), or GSGSGSGSGSGSGS (SEQ ID NO: 170).
  • a spacer contains 3 to 12 amino acids including motifs of GGS, e.g., GGS, GGSGGS (SEQ ID NO: 171), GGSGGSGGS (SEQ ID NO: 172), and GGSGGSGGSGGS (SEQ ID NO: 173).
  • a spacer contains 4 to 12 amino acids including motifs of GGSG (SEQ ID NO: 164), e.g., GGSG (SEQ ID NO: 164), GGSGGGSG (SEQ ID NO: 174), or GGSGGGSGGGSG (SEQ ID NO: 175).
  • a spacer contains motifs of GGGGS (SEQ ID NO: 163), e.g., GGGGSGGGGSGGGGS (SEQ ID NO: 176).
  • a spacer contains amino acids other than glycine and serine, e.g., AAS (SEQ ID NO: 177), AAAL (SEQ ID NO: 178), AAAK (SEQ ID NO: 179), AAAR (SEQ ID NO: 180), EGKSSGSGSESKST (SEQ ID NO: 181), GSAGSAAGSGEF (SEQ ID NO: 182), AEAAAKEAAAKA (SEQ ID NO: 183), KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), GGGGAGGGG (SEQ ID NO: 185), GENLYFQSGG (SEQ ID NO: 186), SACYCELS (SEQ ID NO: 187), RSIAT (SEQ ID NO: 188), RPACKIPNDLKQKVMNH (SEQ ID NO: 189), GGSAGGSGSG8SGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 190),
  • AAAN S SIDLIS V P VDSR (SEQ ID NO: 191), or
  • a spacer contains motifs, e.g. , multiple or repeating motifs, of EAAAK (SEQ ID NO: 193).
  • a spacer contains motifs, e.g., multiple or repeating motifs, of proline-rich sequences such as (XP)n, in which X is any amino acid (e.g., A, K, or E) and n is from 1-5, and PAPAPiSEQ ID NO: 194).
  • the length of die peptide spacer and the amino acids used is adjusted depending on the two proteins involved and the degree of flexibility desired in the final protein fusion polypeptide in some embodiments, the length of the spacer is adjusted to ensure proper protein folding and avoid aggregate formation.
  • a spacer is A or
  • AAAL (SEQ ID NO: 178). Vectors, Host Cells, and Protein Production
  • polypeptides comprising a signal- regulatory protein a (SIRP-a) Dl variant comprising a SIRPa D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRPa D 1 domain; and at least one additional amino acid mutation relative to a wild-type SIRPa Dl domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP-a signal- regulatory protein a
  • polypeptides comprising an Fc variant, wherein the Fe variant comprises an Fe domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgGl Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fe region consisting of mutations A330S, P331 S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the polypeptides of the disclosure are produced from a host cell.
  • a host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and fusion polypeptides described herein from their corresponding nucleic acids.
  • the nucleic acids are included nucleic acid vectors introduced into the host cell by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc. in some embodiments, die choice of nucleic acid vector depends on the host cell to be used.
  • host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.
  • a polypeptide for example a polypeptide construct comprising a SIRPa Dl domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are produced by culturing a host cell transformed with a nucleic acid, preferably an expression vector, containing a nucleic acid encoding the polypeptide construct (e.g., Fc variant, linker, and fusion partner) under the appropriate conditions to induce or cause expression of the polypeptide construct.
  • a nucleic acid preferably an expression vector, containing a nucleic acid encoding the polypeptide construct (e.g., Fc variant, linker, and fusion partner) under the appropriate conditions to induce or cause expression of the polypeptide construct.
  • the conditions appropriate for expression varies with the expression vector and the host cell chosen in some embodiments, a wide variety of appropriate host cells are used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • a wide variety of appropriate host cells are used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • a variety of cell lines that find use in the present disclosure are described in the ATCC ® ceil line catalog, available from the American Type Culture Collection
  • Fc domain variants of this disclosure are expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, either by genetic engineering of the cell line or modifications of cell culture conditions such as addition ofkifunensine or by using a naturally non-glycosylating host such as a prokaryote (E. coli, etc.), and in some cases, modification of the glycosyiation sequence in the Fc is not be needed.
  • a nucleic acid sequence encoding die amino acid sequence of a polypeptide of the disclosure can be prepared by a variety of methods. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis in some embodiments, a nucleic acid molecule encoding a polypeptide of the disclosure is obtained using standard techniques, e.g., gene synthesis.
  • nucleic acid molecule encoding a wild- type SIRPa D1 domain is mutated to include specific amino acid substitutions using standard techniques, e.g., QuikChangeTM mutagenesis in some eases, nucleic acid molecules are synthesized using a nucleotide synthesizer or PCR techniques.
  • the nucleic acids that encode a polypeptide construct for example a polypeptide construct comprising a SIRPa D1 domain variant ⁇ e.g , any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are incorporated into an expression vector in order to express the protein.
  • a variety of expression vectors can be utilized for protein expression.
  • Expression vectors can comprise self-replicating, extra- chromosomal vectors or vectors which integrate into a host genome
  • a vector can also include various components or elements.
  • the vector components include, but are not limited to, transcriptional and translational regulator ⁇ ' sequences such as a promoter sequence, a ribosomal binding site, a signal sequence, transcriptional start and stop sequences, translational start and stop sequences, 3’ and 5’ untranslated regions (UTRs), and enhancer or activator sequences; an origin of replication; a selection marker gene; and the nucleic acid sequence encoding the polypeptide of interest, and a transcription termination sequence.
  • expression vectors comprise a protein operably linked with control or regulatory sequences, selectable markers, any fusion partners, additional elements, or any combinations thereof.
  • operably linked means that the nucleic acid is placed into a functional relationship with another nucleic acid sequence.
  • these expression vectors include transcriptional and translational regulator ⁇ ' nucleic acid operably linked to the nucleic acid encoding the Fc variant, and are typically appropriate to the host cell used to express the protein.
  • a selection gene or marker such as, but not limited to, an antibiotic resistance gene or fluorescent protein gene, can be used to select for host cells containing the expression vector, for example by antibiotic or fluorescence expression. Various selection genes are available.
  • the components or dements of a vector are optimized such that expression vectors are compatible with the host cell type.
  • Expression vectors which find use in the present disclosure include, but are not limited to, those which enable protein expression in mammalian cells, bacteria, insect cells, yeast, and in in vitro systems.
  • mammalian cells are used as host cells to produce polypeptides of the disclosure.
  • mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK 293 F), Chinese hamster ovary (CHO), l iel.a.
  • HEK human embryonic kidney
  • CHO Chinese hamster ovary
  • E. coli cells are used as host cells to produce polypeptides of the disclosure.
  • E. coli strains include, but are not limited to, E. coli 294 (ATCC ® 31,446), E. coli l 1776 (ATCC ® 31,537, E coli BL21 (DE3) (ATCC ® BAA- 1025), and E. coli RV308 (ATCC ® 31,608).
  • Different host cells have characteristic and specific mechanisms for the posttranslaiional processing and modification of protein products (e.g., gl cosylation).
  • appropriate cell lines or host systems are chosen to ensure the correct modification and processing of the polypeptide expressed.
  • a polypeptide construct for example a polypeptide construct comprising a SIRPa Dl domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are expressed in mammalian expression systems, including sy stems in which the expression constructs are introduced into the mammalian cells using virus such as retrovirus or adenovirus.
  • virus such as retrovirus or adenovirus.
  • human, mouse, rat, hamster, or primate cells are utilized.
  • Suitable cells also include known research cells, including but not limited to Jurkat T cells, NIH3T3, CHO, COS, and 293 cells. Alternately, in some embodiments, proteins are expressed in bacterial cells.
  • Bacterial expression systems are well known in the art, and include Escherichia coli (E. coli), Bacillus subtilis, Streptococcus cremoris, and Streptococcus lividans.
  • polypeptide constructs comprising Fc domain variants are produced in insect cells such as but not limited to Sf9 and S£21 cells or yeast cells .such as but not limited to organisms from the genera Saccharomyces, Pichia, K!uyveromyces, Hansemla and Yarrowia.
  • polypeptide constructs comprising Fc domain variants are expressed in vitro using cell free translation systems. In vitro translation systems derived from both prokaryotic (e.g., E.
  • the Fe domain variants are produced by chemical synthesis methods such as, but not limited to, liquid-phase peptide synthesis and solid-phase peptide synthesis.
  • the Fc will not be glycosylated even in presence of die natural glycosylaiion site and therefore inactivation of the Fc will he equivalently obtained.
  • a polypeptide construct includes non-natural amino acids, amino acid analogues, amino acid mimeties, or any combinations thereof that function in a manner similar to the naturally occurring ammo acids.
  • Maturaily encoded amino acids generally refer to the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleueine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norieucine, methionine sulfoxide, methionine methyl sulfonium.
  • such analogs have modified R groups (such as, norieucine) or modified peptide backbones, but generally retain the same basic chemteal structure as a naturally occurring ammo acid.
  • host cells used to produce polypeptides of the disclosure are grown in media suitable for culturing of the selected host cells.
  • suitable media for mammalian host cells include Minimal Essential Medium (MEM), Duibecco’s Modified Eagle’s Medium (DMEM), Expi293TM Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-164Q.
  • suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicilim.
  • host cells are cultured at suitable temperatures, such as from about 20 °C to about 39 °C, e.g., from about 25 °C to about 37 °C, preferably 37 °C, and CCfi levels, such as about 5% to 10%.
  • the pH of the medium is from about pH 6.8 to pH 7.4, e.g., pH 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector, protein expression can be induced under conditions suitable for the activation of the promoter.
  • protein recovery involves disrupting the host cell, for example by osmotic shock, sonication, or lysis.
  • a polypeptide of the disclosure is purified by various methods of protein purification, for example, by chromatography (e.g., ion exchange chromatography, affinity chromatography, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • chromatography e.g., ion exchange chromatography, affinity chromatography, and size-exclusion column chromatography
  • centrifugation e.g., centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the protein is isolated and purified by appropriately selecting and combining affinity columns such as Protein A column (e.g., POROS Protein A chromatography) with chromatography columns (e.g., POROS HS-50 cation exchange chromatography), filtration, ultra-filtration, de-salting and dialysis procedures.
  • a polypeptide is conjugated to marker sequences, such as a peptide to facilitate purification.
  • marker ammo acid sequence is a hexa-histidine peptide (His6-tag (SEQ ID NO: 223)), which can bind to a nickel-functionalized agarose affinity column with micromolar affinity.
  • a hemagglutinin “HA” tag which corresponds to an epitope derived from the influenza hemagglutinin protein can be used.
  • poly peptides of the disclosure for example a poly peptide construct comprising a SIRPa D1 domain variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant are produced by the cells of a subject (e.g., a human), e.g., in the context of gene therapy, by administrating a vector such as a viral vector (e.g., a retroviral vector, adenoviral vector, poxvira!
  • a viral vector e.g., a retroviral vector, adenoviral vector, poxvira
  • vector e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MV A)), adeno-associated viral vector, and alphaviral vector
  • the vector once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc.) can be used for the expression of a polypeptide disclosed herein.
  • the polypeptide is secreted from the cell in some embodiments, if treatment of a disease or disorder is the desired outcome, no further action is required in some embodiments, if collection of the protein is desired, blood is collected from the subject and the protein purified from the blood by various methods.
  • kits for treating cancer in an individual that comprises administering to die individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) a chemotherapy agent (e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents).
  • a chemotherapy agent e.g., at least one chemotherapy agent, such as at least two, at least three, or at least four chemotherapy agents.
  • a method of treating cancer in an individual e.g., a human individual
  • a method of treating cancer in an individual that comprises administering to the individual an effective amount of (a) a polypeptide comprising a SIRPa D1 domain variant (e.g., a SIRPa D!
  • the method further comprises administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies). Additionally or alternatively, in some embodiments the method further comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g. , at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents).
  • a therapeutic antibody e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies.
  • an immunotherapeutic agent e.g. , at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents.
  • the method comprises administering the polypeptide and the chemotherapy agent in combination with one or more additional modes of therapy, including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • additional modes of therapy including, but not limited to, e.g., radiation therapy, surgery, cryoablation, and bone marrow transplant.
  • Exemplary chemotherapy agent(s) that can be used in a method of treating cancer described herein include, without limitation, e.g., methotrexate (RHEUMATREX®, Amethopterin), cyclophosphamide (CYTOXAN®), abiraterone, abemaciclib, altretamine, thalidomide (THAL1DOM1D®), acridine carboxamide, actimid®, actinomycin, aetinomycin-D, afatmib, 17-N-allylamiiio-17 ⁇ demethoxygeldanamyciii, alectinib, alpelisib, aminopterin, amsacrine, anlotinib, anthraeycime, antineoplastic, antineoplaston, apartinib, 5-azaeitidine, 6- mercaptopurine, 6-thioguanine, arabinosyieytosine, axitin
  • innoimiquimod irinotecan, irofulven, ivosidenib, ixabepilone, laniquidar, lapatinih, larotrectinib, lenalidomide, lenvaiinib, lorlatinib, lomustine, lurtotecan, mafosfamide, masoprocol, mechlorethamine, melphalan, mercaptopurine, methotrexate, methyiprednisoione, mitomycin, mitotane, mitoxantrone, neiarabine, neratinib, niraparib, nilotinib, nintedanib, obiimersen, olaparib, osimertinib, oxaliplatin, nedaplatin, phenanthriplatin, pieopiatm, PAC-L paclitaxel, palbociclib,
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with chemotherapeutic agent(s)s of a particular class.
  • the agent that blocks the interaction between CD47 and SIRPa is a polypeptide described herein (e.g., a fusion polypeptide comprising a SIRPa dl domain variant and an Fc variant; a fusion polypeptide comprising a SIRPy variant, a SIRPpi variant, or a SIRP]12 variant and an Fc variant).
  • the method of treating cancer comprises administering a polypeptide (e.g. fusion polypeptide) described herein in combination with an adrenal inhibitor (including, but not limited to adrenal inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an an thracy cline (including, but not limited to anthracyclines described herein).
  • the method of treating cancer comprises admin stering a polypeptide described herein in combination with an alkylating agent (including, but not limited to alkylating agents described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an androgen inhibitor (including, but not limited to androgen inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with an antimetabolite, e.g., a purine analog, (including, but not limited to antimetabolites, e.g., purine analogs, described herein).
  • an antimetabolite e.g., a purine analog, (including, but not limited to antimetabolites, e.g., purine analogs, described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an antitumor antibiotic (including, but not limited to antitumor antibiotics described herein in some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a BLC-2 inhibitor (including, but not limited to BLC-2 inhibitors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a BTK inhibitor (including, but not limited to BTK inhibitors described herein in some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a CDK 4/6 inhibitor (including, but not limited to CDK 4/6 inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a colony stimulating factor (including, but not limited to colony stimulating factors described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with a corticosteroid (including, but not limited to corticosteroids described herein). In some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with an EGFR inhibitor (including, but not limited to EGFR inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a gonadotropin releasing hormone (GnRH) agonist (including, but not limited to GnRH agonists described herein).
  • GnRH gonadotropin releasing hormone
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a mitotic inhibitor/microtubuie inhibitor (including, but not limited to mitotic inhibitors/microtubule inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an mTQR kinase inhibitor (including, but not limited to mTQR kinase inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a proteasorne inhibitor (including, but not limited to proteasome inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a signal transduction inhibitor, e.g., a protein-tyrosine kinase inhibitor, a PAK4 inhibitor, a PI3K inhibitor, (including, but not limited to signal transduction inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a topoisomerase inhibitor, (including, but not limited to topoisomerase inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a tyrosine kinase inhibitor, (including, but not limited to tyrosine kinase inhibitors described herein).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a VEGF inhibitor, such as a VEGF1 inhibitor, a VEGF2 inhibitor, and/or a VEGF3 inhibitor (including, but not limited to VEGF inhibitors described herein.
  • the method of treating cancer comprises administering a polypeptide described herein in combination with an agent that modulates apoptosis, e.g., by modulating the activity of Bcl-2, Mcll, Bel -lx, etc., (including, but not limited to agents that modulate apoptosis, e.g., by modulating the activity of Bcl-2, Mcll, Bcl-lx, etc, described herein).
  • an agent that modulates apoptosis e.g., by modulating the activity of Bcl-2, Mcll, Bel -lx, etc.
  • agents that modulate apoptosis e.g., by modulating the activity of Bcl-2, Mcll, Bcl-lx, etc, described herein.
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a platinum-based agent, (including, but not limited to platinum-based agents described herein) in some embodiments, the method of treating cancer comprises administering a polypeptide described herein in combination with an inhibitor of NTRKi, NTRK2, and/or NTRK3, an ALK inhibitor, a ROS inhibitor, a FLT3 inhibitor, a BRAF inhibitor, an inhibitor of MEK1 and/or MEK2, an inhibitor of HER2, HER3, and/or HER 4, an inhibitor of RET/PTC, an inhibitor of BCR- ABE, a c-KIT inhibitor, an inhibitor of PDGFR- alpha and/or PDGFR-beta, an inhibitor of FGFR1, FGFR2, FGFR3, and/or FGFR4, an Smoothened inhibitor and/or an inhibitor of PARP 1 , P ARP 2, and/or PARP3 (including, but not limited to inhibitors described herein) in some embodiments, the inhibitor is
  • the chemotherapeutic agent is a small molecule anti-cancer agent (such as a small molecule inhibitor).
  • the method of treating cancer comprises administering a polypeptide described herein in combination with a small molecule inhibitor of VEGFR and/or PDGFR, a small molecule EGFR inhibitor, a small molecule ALK inhibitor, a small molecule CDK4/6 inhibitor, a small molecule PARP inhibitor, a small molecule PAK4 inhibitor, a small molecule mTGR inhibitor, a small molecule KRAS inhibitor, a small molecule IRK inhibitor, a small molecule BCL2 inhibitor, a small molecule B-raf inhibitor, a small molecule IDH inhibitor, a small molecule PI3K inhibitor, a small molecule DDR (DMA damage response) inhibitor, or a small molecule hypomethylation agent in other cases, the targeted small molecule modulates a cellular signaling pathway of the cell expressing CD47, e.g., VEGFR and/or PDGFR
  • the method of treating cancer comprises administering a polypeptide described herein (e.g., a fusion polypeptide comprising a SIRPa dl domain variant and an Fe variant) in combination with at least one, at least two, at least three, or at least four chemotherapeutic agents.
  • a polypeptide described herein e.g., a fusion polypeptide comprising a SIRPa dl domain variant and an Fe variant
  • the two or more chemotherapeutic agents are from different classes (as described above) and/or exert their anti-cancer effects via different mechanisms of action.
  • a method of treating cancer provided herein compri ses administering to the individual an effective amount of a therapeutic antibody (e.g., at least one therapeutic antibody, such as at least two, at least three, or at least four therapeutic antibodies), i.e. , in combination with agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., a fusion polypeptide described herein) and a chemotherapeutic agent described herein (e.g., at least one chemotherapeutic agent, such as at least two, at least three, or at least tour chemotherapeutic agents).
  • the therapeutic antibody is conjugated to a drug (i.e., an antibody-drug conjugate, or “ADC).
  • Exemplary therapeutic antibodies for use in a method herein include, but are not limited to, e.g., 3F8, 8H9, Abagovomab, Abciximab, Abituzumab, Abriiumab, Aetoxumab, Adalimumab, Adecatumimiab, Aducanumab,
  • Afe!imomab Afutuzumab, Alacizumab pegol, ALD518, Alemtuzumab, Alirocumab, Aitumomab pentetate, Amatuximab, Anatumomab mafenatox, Anetumab ravtansine, Anifrolumab, Anrukinzumab (lMA-638), Apolizumab, Arcitumomab, Ascrinvacumab, Aselizumab, Atezolizumab, Atinumab, Atlizumab (tocilizumab), Atorolimumab, Avdumab, Bapineuzumab, Basiiiximab, Bavituximab, Bectumomab, Begelomab, Belimumab, Benralizumab, Bertiiimumah, Bcsilesomab, Bevacizumab, Bez
  • Brontietuzumab Cabiralizumab (FPA008), Camreiizumab, Canakinumab, Cantuzumab mertansine, Cantuzumab ravtansine, Caplacizumab, Capromab pendetide, Carlumab, Catumaxomab, cBR96-doxonibicin immunoconjugate, CC49, Cedehzumab, Certolizumab pegol, Cetuximab, Ch.14.18, Citatuzumab communicatingox, Cixutumumab, Clazakizumab,
  • Clenoliximab Clivatuzumab tetraxetan, Codrituzumab, Coltuximab ravtansine, Conatumumab, Concizumab, Crenezumab, CR6261, Daceiiizumab, Daclizutnab, Dalotuzumab, Dapirolizumab pegol, Daratumumab, Decfrekumab, Demcizumab, Denintuzumab niafodotin, Denosumab, Derlotuximab biotin, Detumomab, Dinutuximab, Diridavumab, Dorlimomab aritox, Drozitumab, Duligotumab, Dupilumab, Durvalumab, Dusigitumab, Ecromeximab, Eculizumab, Edobacomab, Edreco!om
  • Enavatuzumab Enfortumab vedotin, Enlimomab pegol, Enoblituzumab, Enokizumab, Enoticumab, Ensituximab, Epitumomab eitiixetan, Epratuzumab, Eriizumab, Ertumaxomab, Etaracizmnab, Etrolizumab, Evinaeumab,
  • Evolocumab Exbivinunab, Fanolesomab, Faralimomab, Farletuzumab, Fasinumab, FBTA05, Felvizumab, Fezakinumab, Ficlatuzumab, Figitumumab, Firivumab, Flanvotumab.
  • Fletikumab Fontolizumab, Foralumab, Foravirumab, Fresolimumab, Fuiranumab, Futuximab, Galiximab, Ganitumab, Gantenerumab, Gavilimomab, Gemtuzumab ozoganiiein, Gevokizumab, Girentiiximab, Glembatumumab vedotin, Golimumab, Gomiiiximab, Guseikumab, Ibalizumab, Ibritumomab tiuxetan, Icrucumab, Idarucizumab, Igovomab, IMAB362, Imalumab, Imciromab, imgatuzumab, Inclacumab, Indatuximab ravtansme, Indusatumab vedotin, infliximab, Tntetumumab,
  • Naptumomab estafenatox N amatumab, Natalizumab, Nebacumab, Necitumumab, Nemolizumab, Nerelimomab, Nesvaeumab, Nimotuzumab, Nivolumab, Nofetumomab merpentan, Obiitoxaximab, Obinutuzumab, Qcaratuzumab, Ocreiizumab, Odulimomab, Ofatumumab, Olaratumab, Olokizumab, Omalizumab, Onartnzumab, Gntuxizumab, Opicinumab, Oportuzumab monatox, Gregovomab, Orticumab, Otelixizumab, Otlertuzumab, Oxelumab, Ozanezumab, Ozoralizumab, Pagibaxim
  • Sacituzumab govitecan Samalizumab, SAR650984 (Isatuximab) Sarilumab, Satumomab pendetide, Secukinumab, Seribantumab, Setoxaximab. Sevirumab, Sibrotuzumab, SGN-CD19A, SGN- CD33A, Sifalimumab, Siltuximab,
  • Simtuzumab Sintilimab, Siplizumab, Sirukumab, Sofituzumab vedotin, Solanezumab, Soiitomab, Sonepcizumab, Sontuzumab, Stamulumab, Sulesomab, Suvizumab, Tabalumab, Tacatuzumab tetraxetan, Tadoeizumab, Talizumab, Tanezumab, Taplitumomab paptox, Tarextumab, Tefibazumab, Tdmiomab aritox, Tenatumomab, Teneliximab, Teplizumab, Teproiumumab, Tesidolumab, TGN1412, Ticilimumab (tremeiimumab), Tildrakizumab, Tigatuzumab, TNX-650, Tocilizumab (atliz
  • an antibody include, but are not limited to, e.g., an anti- CD20 antibody, an anti-EGFR antibody, an anti ⁇ Her2/Neu (ERBB2) antibody, an anti-EPCAM antibody, an anti-GL2 antibody, anti-GD2, anti-GD3, anti-CD2, anti-CD3, anti-CD4, anti-CD8, anti-CD I 9, anii-CD22, anti-CD30, anti-CD33, anti-CD39, anti-CD45, anti-CD47, anti-CD52, anti-CD56, anti-CD70, anti-CD73, anti-CD 117, an anti-SIRPa antibody, an anti-LILRBI, an anti-LlLRB2, an anti-LlLRB4 antibody, an anti-PD-1 antibody (e.g., an anti PD-1 antagonist antibody), an anti-PD-Ll antibody (e.g., an anti PD-L1 antagonist antibody
  • the therapeutic antibody used in a method herein is an antibody that binds to, e.g., CS1/SLAMF7, Trop-2, VWF, vimentm, VEGFR2, VEGFR-1, VEGF, VEGF-A, TYRP1 (glycoprotein 75), TWEAK receptor, tumor specific giycosylation of MUCl, tumor antigen CTAA 16.88, TRAIL-R2, TRAIL-R1, TNF-alpha, TGF-beta, TGF beta 2, TGF beta 1, TFPI, tenasein C, TEM1, TAG-72, T-cell receptor, STEAP1, sphingosine- 1 -phosphate, SOST, SLAMF7, BCL-2, selectin P, SDCl, selerostin, RTN4, RON, Rhesus factor, RHD, respirator ⁇ ' syncytial virus, RANKL, rabies virus glycoprotein, platelet-derived growth factor receptor beta,
  • IL-22 IL- 1 , IL- 1 7A, IL-I 7, TL-13, IL- 12, IL- 1, IL 20, IGHE, IgG4, IGF-I, IGF- 1 receptor, IgE Fc region, 1FN -gamma, IFN-alpha, ICAM-1 (CD54), human TNF, human scatter factor receptor kinase, Hsp90, FINGF, FILA-DR, HIV-1, histone complex, HHGFR, HGF,
  • HERS HERS, HER2, HER2/neu, HER1, hepatitis B surface antigen, hemagglutinin, GUCY2C, GPNMB, GMCSF receptor alpha-chain, glypican 3, GD3 ganglioside, GD2, ganglioside GD2, Frizzled receptor, folate receptor I, folate hydrolase, fibroneetin extra domain-B, fibrin II, beta chain, FAP, F protein of respiratory syncytial vims, ERBB3, episialin, EpCAM, endotoxin, EGFR, EGFL7, E.
  • coli slriga toxin type-2 E eoli shiga toxin type- I, DRS, DPP4, DLL4, dabigatran, cytomegalovirus glycoprotein B, CTLA-4, CSF2, CSF1R, clumping factor A, CLDN18.2, ch4DS, CFD, CEA-related antigen, CEA, CD80, CD79B, CD74, CD73, CD70,
  • CD 19 CD 137, CD154, CD152, CD15, CD147 (basigin), CD 140a, CD125, GDI 1, CD-18, CCR5, CCR4, CCLI1 (eotaxin-I ), cardiac myosin, carbonic anhydrase 9 (CA-TX).
  • the therapeutic antibody used in a method herein binds to an antigen expressed by a cancer cell (e.g., expressed on the surface of a cancer cell).
  • exemplary antigens expressed by cancers are known in the art and include, without limitation, e.g., CD 19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, GDI 23, CDI38, CS1/SLAMF7, Trop-2, 5T4, BCMA, Mucin 1, Mucin 16, PTK7, PD-L1, STEAP1, Endothelin B Receptor, mesothelin, EGFRvill, ENPP3, SLC44A4, GNMB, neetin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin aUb3, integrin aSpi, MET,
  • TAG72 a mucin, CAIX, EPHA3, folate receptor a, GD2, GD3, and an MHC/peptide complex comprising a peptide from NY -ESO- 1 L AGE, SSX-2, a MAGE family protein, MAGE-A3, gpl00/pmell7, Melan- A/MART 1 , gp75/TRPl, tyrosinase, TRP2, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MIJC1,
  • an polypeptide described herein is administered in combination with a chemotherapeutic agent (e.g., at least one chemotherapeutic agent) and a monoclonal antibody that hinds CD! 23 (also known as IL-3 receptor alpha), such as talaeotuzumab (also known as C8L362 and JNJ-56022473).
  • a chemotherapeutic agent e.g., at least one chemotherapeutic agent
  • a monoclonal antibody that hinds CD! 23 also known as IL-3 receptor alpha
  • talaeotuzumab also known as C8L362 and JNJ-56022473
  • the therapeutic antibody used in a method herein is an antibody that binds an antigen expressed by an NK cell.
  • exemplary antigens expressed by an NK cell include, without limitation, NKR-P1A (KLRB1), CD94 (NKG2A), KLRGT, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DSI, CD94 (NKG2C/E), NKG2D, CD 160 (BY55), CD16 (FcyRIIIA), NKp46 (NCR1), NKp30 (NCR3), NKp44 (NCR2), DNAM1 (CD226), CRT AM, CD27, NTB-A (SLAMF6), PSGL1, CD96 (Tactile), CD100 (SEMA4D), NK
  • a method of treating cancer comprises administering to the individual an effective amount of an immunotherapeutic agent (e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents), i.e., in combination with an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g , a polypeptide described herein) and a chemotherapeutic agent described herein (e.g., at least one chemotherapeutic agent, such as at least two, at least three, or at least four chemotherapeutic agents).
  • an immunotherapeutic agent e.g., at least one immunotherapeutic agent, such as at least two, at least three, or at least four immunotherapeutic agents
  • an immunotherapeutic agent refers to any therapeutic that targets the immune system and promotes a therapeutic redirection of the immune system, such as a modulator of a costimulatory pathway, cancer vaccine, recombinantiy modified immune cell, etc. Exemplary and non-limiting immunotherapeutic agents are described infra.
  • the immunotherapeutic agent is or comprises an antibody.
  • Exemplary targets of immunotherapeutic antibodies include, without limitation, BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Sig!ec-10, Siglec-15, FGL-I, CD200, CD2Q0R, CSF-1R, CD24, CD40, CD40L, CD163,
  • CD206 DEC2Q5, CD47, CD 123, argmase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-b RI, TGF-b RII, c-Kit, CD244, L-selectin/CD62L, CDllb, CDl lc, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, 0X40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, Klrgl, Nrpl, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS.
  • Immuno therapeutic agents that are approved or in late-stage clinical testing include, without limitation, ipilimumab, pembrolizumab, nivolumab, atezohzumab, avelumab, durvalumab, and the tike in certain embodiments, the agent that blocks the interaction between CD47 and SIRPa (such as a polypeptide described herein) is administered in combination with an inhibitor of the PD-LI/PD-1 pathway, e.g., an antibody, a small molecule, or polypeptide that blocks the interaction between PD-L1 and PD-1 (e.g., by binding to PD-1 or PD-L1 ).
  • an inhibitor of the PD-LI/PD-1 pathway e.g., an antibody, a small molecule, or polypeptide that blocks the interaction between PD-L1 and PD-1 (e.g., by binding to PD-1 or PD-L1 ).
  • the inhibitor of the PD-Ll/PD-1 pathway is an antisense polynucleotide. In some embodiments, the inhibitor of the PD-Ll/PD-l patliway is an anti-PD-Ll or anti-PD-1 antagonist antibody (e.g., an anti-PD-1 or anti-PD-Ll antagonist antibody described elsewhere herein).
  • tire immunotherapeutic agent is or comprises a vaccine, oncolytic virus, adoptive cell therapy, cytokine, or small molecule immunotherapeutic agent.
  • immunotherapeutic agents are known in the art.
  • adoptive cell therapies and therapeutics can include without limitation chimeric antigen receptor T-edl therapy (C AR-T), tumor infiltrating lymphocytes (TILs), TCR engineered T ceils, TCR engineered NK cell, and macrophage cell products.
  • Vaccines can include without limitation polynucleotide vaccines, polypeptide vaccines, or cell-based (e.g., tumor or dendritic cell -based) vaccines.
  • Various cytokines useful for the treatment of cancer are known and include without limitation IL-2, IL- 15, IL-7, IL- 10, IL-12, 1L2I, TNFa, IFNs, GM-CSF, and engineered cytokine mutants.
  • Small molecule immunotherapeutic agents can include without limitation IDO/TDO inhibitors, AhR inhibitors, arginase inhibitors, A2a R inhibitors, TLR agonists, STING agonists, and Rig-1 agonists.
  • agent that blocks the interaction between CD47 and SIRPa such as a polypeptide described herein
  • the chemotherapeutic agent e.g., at least one chemotherapeutic agent
  • tire further agent(s) are from different classes and/or exert their anti-cancer effects via different mechanisms of action.
  • the method of heating cancer comprises administering an agent that blocks the interaction between CD47 and SIRPa (such as a polypeptide described herein) in combination with a chemotherapeutic agent (including, but not limited to those described herein) and a therapeutic antibody (including, but not limited to those described herein, e.g., an anti ⁇ HER2 antibody).
  • a chemotherapeutic agent including, but not limited to those described herein
  • a therapeutic antibody including, but not limited to those described herein, e.g., an anti ⁇ HER2 antibody
  • the agent that blocks the interaction between CD47 and SIRPa is administered in combination with a chemotherapeutic agent (including, but not limited to those described herein) and a small molecule inhibitor (including, but not limited to those described herein).
  • chemotherapeutic agent including, but not limited to those described herein
  • a small molecule inhibitor including, but not limited to those described herein.
  • the agent that blocks the interaction between CD47 and SIRPa (such as a polypeptide described herein) is administered in combination with one or more agents including, without limitation, e.g., anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agent.
  • agents including, without limitation, e.g., anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agent.
  • the agent that blocks the interaction betw een CD47 and SIRPa is administered in combination with at least one chemotherapy agent and one or more additional modes of therapy.
  • the one or more additional modes therapy comprises radiotherapy (e.g., gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells, microwaves, UV radiation, or gene therapy.
  • radiotherapy e.g., gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells, microwaves, UV radiation, or gene therapy.
  • therapeutic genes for gene therapy include, but are not limited to, an antisense version of an inducer of cellular proliferation (oncogene), an inhibitor of cellular proliferation (tumor suppressor), or an inducer of programmed cell death (pro-apoptotic gene).
  • any one or more of the combination therapies described herein are administered in conjunction with a surgery (e.g., resection).
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with nivolumab and one or agents selected from: ienalidomide, ibrutinib, palbocieiib, enzaiutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzaiutamide, cyclophosphamide, carboplatin, cisplatin, oxalipiatin, 5-fiuorouracil, 6-merc aptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxei, estramu stine, pae
  • SIRPa e.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with pembrolizumab and one or agents selected from: lenalidomide, ibmtinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, isnatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mereaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, remedyorabiein, doxorubicin, docetaxel, estramustme, paciitaxel, vinblastine, etopo
  • CD47 e.g
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with trastuzumab and one or agents selected from: lenalidomide, ibmtinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatimb, palbociclib, erlotinib, bortezomib, enzalutamide, cyclophosphamide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubiein, doxorubicin, docetaxel, estramustme, paciitaxel, vinblastine, etoposide,
  • SIRPa e.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with bevaciz imab and one or agents selected from: lenalidomide, ibmtinib, palbociclib, enzalutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociclib, erlotinib, bortezomib, enzalutamide, cyelopliosph mide, carboplatin, cisplatin, oxaliplatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubiein, doxorubicin, docetaxel, estramu stine, paciitaxel, vinblast
  • SIRPa e.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., liCD47) and SIRPa (e.g., hSIRPa) in combination with rituximab and one or agents selected from: lenalidomide, ibrutinib, palbociciib, enzaiutamide, pemetrexed, nilotinib, abiraierone, imatinib, palbociciib, erlotinib, bortezomib, enzaiutamide, cyclophosphamide, carboplatin, eisplatin, oxalipiatin, 5-fluorouraeil, 6-merc aptop urine, cytarabine, gemcitabme, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxei, estramustine, paclitaxei
  • SIRPa e.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., !iCD47) and SIRPa (e.g., hSIRPa) in combination with pertuzumab and one or agents selected from: lenalidomide, ibrutinib, palbociciib, enzaiutamide, pemetrexed, nilotinib, abiraierone, imatinib, palbociciib, erlotinib, bortezomib, enzaiutamide, cyclophosphamide, carboplatin, eisplatin, oxalipiatin, 5-fluorouracil, 6-merc aptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxei, estramustine, paclitaxei, vinblast
  • SIRPa e.
  • the method of treating cancer comprises administering an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) in combination with denosumab and one or agents selected from: lenalidomide, ibrutinib, palbociciib, enzaiutamide, pemetrexed, nilotinib, abiraterone, imatinib, palbociciib, erlotinib, bortezomib, enzaiutamide, cyclophosphamide, carboplatin, cispiatm, oxalipiatin, 5-fluorouracil, 6-mercaptopurine, cytarabine, gemcitabine, methotrexate, bleomycin, daunorubicin, doxorubicin, docetaxei, estramustine, paclitaxei, vinblastine,
  • SIRPa e.g
  • the cancer treated by a method provided herein is breast cancer, lung cancer, adenocarcinoma of the lung, squamous cell lung cancer, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), head and neck cancer, mesothelioma, brain cancer, brain tumor, abdominal cancer, colon cancer, colorectal cancer, esophageal cancer, parapharyngeal cancer, gastrointestinal cancer, glioma, liver cancer, gastric cancer, oral cancer, tongue cancer, neuroblastoma, osteosarcoma, ovarian cancer, renal cancer, urinary bladder cancer, urinary tract cancer, pancreatic cancer, retinoblastoma, cervical cancer, uterine cancer, Wilm's tumor, multiple myeloma, skin cancer, lymphoma, leukemia, blood cancer, thyroid cancer, bone cancer, adenoeystic tumor, chondrosar-coma, pancreatic islet cell tumor, neuroendocrine
  • the cancer treated by a method provided herein is a hematological cancer in some embodiments, the hematological cancer is multiple myeloma, or a leukemia, iucludiug, but not limited to, e.g., acute or chronic myelogenous leukemia acute or chronic lymphoblastic leukemia, acute lymphocytic leukemia (ALL) chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), acute myeloid leukemia (AML), mydodysplastic syndrome (MDS), chronic myeloid leukemia (CML), hairy cell leukemia, chronic rnyeiornonocytic leukemia (CMML), juvenile myelomonocytic leukemia (JMML), large granular lymphocytic (LGL) leukemia, plasmacytoma, blastic plasmacytoid dendritic cell neoplasm (BPDCN),
  • ALL acute lymphocy
  • a method of treating leukemia e.g. , acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myeloid leukemia (CML), hairy cell leukemia, chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia (JMML), large granular lymphocytic (LGL) leukemia, blastic plasmacytoid dendritic cell neoplasm (BPDCN), B-eeil prolymphocytic leukemia (B- PLL), T-cell prolymphocytic leukemia (T-PLL), multiple myeloma (MM), and Non-Hodgkin lymphomas (such as diffuse large B-cell lymphoma (DLBCL), Burkitt
  • ALL acute lymphoblastic leuk
  • the Ik: 1.1 inhibitor is venetoclax (also known as ABT-199), ABT-737, navitoclax (also known as ABT-263), BCL201, or AZD-0466.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SIRPa D1 domain variant described herein) and an Fe domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fe domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Rabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Rabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the ELI index of Rabat: or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Rabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide) and the Bel 2 inhibitor (e.g., venetoclax) are administered simultaneously, concurrently, or sequentially.
  • Bc!2 inhibitors are a class of anticancer drugs that are believed to exert their cytotoxic effects by competing with proapoptotie Bcl2s to occupy BH3 docking grooves on the surfaces of antiapoptotic family members. By binding to one or more Bcl2 family members, these inhibitors induce apoptosis by mimicking the activity of natural antagonists of BCL-2 and other related proteins and restore apoptosis in tumor cells.
  • Venetoclax (also known as GDC-0199, ABT-199, and RG7601) is an exemplary selective Bel2 inhibitor used m the methods described herein. Venetoclax is a light yellow to dark yellow ' solid with the empirical formula C45H50CIN7O7S and a molecular weight of 868.44 g/inoi. Venetoclax has very low aqueous solubility.
  • Venetoclax is described chemically as 4-(4- ⁇ [2-(4-chlorophenyl)-4,4dimethylcyclohex-l-en-l-yl]methyl ⁇ piperazin-l-yl)-N-( ⁇ 3-nitro-4- [(tetraliydro-2H-pyran-4y]metiiyl)amino]phenyl ⁇ suIfonyl)-2-(lH-pyrro1o[2,3-b]pyridin-5- yloxyjbenzamide) and has the following chemical structure:
  • Venetoclax is administered orally and is sold under the trade names Venclexta and Venclyxto.
  • Complete information about venetoclax preparation, dispensing, dosage, and administration schedule can he found in hie local package insert (for the United States, see, e.g., www(dot)accessdata(dot)fda(dot)gov/dmgsatfda_docs/label/2017/208573s000ib3(dot)pdf; for Europe, see, e.g., www(dot)ema(dot)europa(dot)eu/en/medicines/human/EPAR/venclyxto#product-mformation- section).
  • the venetoclax is administered in accordance with the dosing and frequency recommended in hie local package insert.
  • ABT-737 is another exemplary selective Bcl2 inhibitor used in the methods described herein.
  • ABT-737 which inhibits both Bcl2 and Bcl-xL, has the empirical formula C47 . H45CIN6O5S2 and a molecular weight of 813.43 g/mol .
  • the CAS Registry' Number for ABT- 737 is 852-808-04-9.
  • ABT-737 is described chemically as 4- ⁇ 4-j(4’-Chloro-2- hiphenyTyl)metliyT]-l-piperazin ⁇ T ⁇ -N-[(4 ⁇ [ ⁇ 2R)-4-(dimethyiamino)-l -(pheny!suifanyT) ⁇ 2- butany!]amino ⁇ -3-nitrophenyi)siilfony3]benzam3de and has tire following chemical structure:
  • navitoclax also known as ABT-263.
  • Navitoclax which inhibits both Bcl2, Bcl-xL, and Bcl-w, has the empirical formula C47H55CIF3N5O6S3 and a molecular weight of 9746 g/mol.
  • the CAS Registry Number for navitoclax is 923564-51-6.
  • ABT-737 is described chemically as 4-[4-
  • S55746 (also known as BCL20I and Servier-I).
  • S55746 occupies the hydrophobic groove of BCL-2. Its selectivity profile demonstrates no significant binding to MCL-1, BFL-1 S55746 occupies the hydrophobic groove of BCL-2. Its selectivity profile demonstrates no significant binding to MCL-1, BFL-1 (BCL2A1/A1) and poor affinity for BCL-XL.
  • S55746 has no cytotoxic activity on BCL-XL-dependent cells, such as platelets ⁇ see, e.g., Casara et al.
  • S55746 has the empirical formula C43H42N4O6 and a molecular weight of 710.82 g/mol.
  • the CAS Registry Number for S55746 is 1448584-12-0.
  • S55746 is described chemically as (S)-N-(4-hydroxyphenyl)-3-(6-(3-(morpholinornethyl)- l,2,3,4-tetraliydroisoquinoline-2-carbonyl)benzo[d][ l,3]dioxol-5-yl)-N-phenyl-5,6,7,8- tetrabydroindoliziiie-1 -carboxamide and has the following chemical structure:
  • a method of treating solid tumor in an individual that comprises administering to die individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) a platinum-based chemotherapy agent.
  • the solid tumor is colon cancer (e.g , colon carcinoma), lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, brain tumor, mesothelioma, or neuroblastoma.
  • die platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedap!atin, trip!atin tetranitrate, phenant!iriplat , picoplatin, and/or satrapiatin.
  • the platinum-based chemotherapy agent is cisplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SiRPa DI domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein)
  • die polypeptide e.g., fusion polypeptide
  • SiRPa DI domain variant that comprises the amino acid sequence of 5EQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (hi) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F2.34V, L235A, delG2.36, and N2.97A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide) and the platinum-based chemotherapy agent (e.g., cisplatin) are administered simultaneously, concurrently, or sequentially.
  • the platinum-based chemotherapy agent e.g., cisplatin
  • Platinum agents are widely used antitumor drugs that cause crosslinking of DN A as monoadduct, interstrand crosslinks, intrastrand crosslinks or DNA protein crosslinks. Platinum agents typically act on the adjacent N-7 position of guanine, forming a 1, 2 intrastrand crosslink (Poklar et al. (1996). Proc. Natl. Acad. Sci. U.S.A. 93 (15): 7606-11; Rudd ei al. (1995). Cancer Chemother. Pharmacol. 35 (4): 323-6). The resultant crosslinking inhibits DNA repair and/or DNA synthesis in cancer cells.
  • Cisplatin is an exemplary platinum coordination compound used in the methods described herein.
  • the chemical name for cisplatin is dichloroplatinum diammoniate, and cisplatin has the following structural formula:
  • Cisplatin is an inorganic and water-soluble platinum complex with the molecular formula of PiiN! LS . -C ' l ⁇ and a molecular weight of 300.046. After undergoing hydrolysis, it reacts with DNA to produce both intra and interstrand crosslinks. These crosslinks appear to impair replication and transcription of DNA. The cytotoxicity of cisplatin correlates with cellular arrest in the G2. phase of the cell cycle. Cisplatin, which has been assigned the CAS Registry No.
  • PLATINOL® is commercially available as PLATINOL®, PLATIN OL®-AQ, CDDP, CTSPLAN, CISPLAT, PLATIKEM, PLATIONCO, PRACTICES, PLATTCIS, BLASTOLEM, C1SMAX, CISPLAN, CISPLAT1NUM, CISTEEN, DUPLAT, KEMOPLAT, ONCOPLATIN-AQ, PLATINEX, PLATIN, TEVAPLATTN, and others.
  • cisplatin preparation, dispensing, dosage, and administration schedule can be found in local package insert (for the United States, see, e.g., www(dot)aecessdata(dot)fda(dot)gov/drugsatfda_docs/label/2011/018057s0801bl(dot)pdf and www(dot)accessdata(dot)fda(dot)gov/drugsatfda_ docs/label/2015/018057s0831bl(dot)pdi).
  • the cisplatin is administered in accordance with the dosing and frequency recommended in the local package insert.
  • Carboplatin is another exemplar ⁇ ' platinum coordination compound used in the methods described herein.
  • the chemical name for carboplatin is platinum, diammine [l,lcyclobutane-dicarboxyiato(2-)-0,0] ⁇ ,(SP-4-2), and carboplatin has the following structural formula:
  • Carboplatin is a water-soluble platinum complex with the molecular formula of C fi H ⁇ ⁇ CtiPt and a molecular weight of 373.26. Carboplatin has been assigned the CAS Registration Number 41575-94-4, and its mechanism of action is similar to that of cisplatin. Carboplatin is typically prescribed more commonly than cisplatin. Carboplatin is commercially available as PARAPLATIN®, BLASTOCARB®, BLAST OPL ATTN ® , CARBOKEM®, CARBOMAX®, PARAPLATIN®, CARBGPA®, KARPLAT®, and others.
  • carboplatin preparation dispensing, dosage, and administration schedule can be found in local package insert (for the United States, see, e.g., www(dot)accessdata(dot)fda(dot)gov/drugsatfda_docs/label/2010/020452s0051bl(dot)pdf and www(dot)accessdata.fda(dot)gov/drugsatfda_docs/Iabel/2012/0771390rigls016ibl(dot)pdf).
  • the carbopiatin is administered in accordance with the dosing and frequency recommended in the local package insert.
  • the anti-HER2 antibody is trastuzmnab (CAS Registry ' No. 180288-69-1).
  • the anti-PDLl antibody is atezoiizumab (CAS Registr ' No. 1380723-44-3), avelumab (CAS Registry No. 1537032-82-8), or durvalumab (CAS Registry ' No. 1428935-60-7).
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SIRPa D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) in some embodiments, the polypeptide (e.g., fusion polypeptide) comprises a SIRPa Di domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgG I Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat: (ii) a human IgG2 Fc region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human lgG4 Fc region comprising S22.8P, E2.33P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), the anti-HER2 antibody, the anti-PD-Ll antibody (e.g., an anti PD-LI antagonist antibody ) are administered simultaneously, concurrently, or sequentially.
  • the solid tumor is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the solid tumor is HER2 + solid tumor.
  • the solid tumor is colon cancer (e.g., HER2 + colon cancer).
  • the anti-HER2 antibody is trastuzumab (CAS Registry' No. 180288-69-1).
  • the anti-VEGFR2 antibody is ramucirumab (CAS Registry ' No.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SIRPa DI domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide e.g., fusion polypeptide
  • the Fc domain variant is (s) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the Ell index of Rabat; (ii) a human IgG2 Fc region comprising A330S, P33 IS, and N297A mutations, wherein numbering is according to the Ell index of Rabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the ELI index of Rabat: or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Rabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises
  • the polypeptide forms a homodimer.
  • the polypeptide (e.g., fusion polypeptide), the anti-HER2 antibody, the anti- VEGFR2 antibody, and the paelitaxel are administered simultaneously, concurrently, or sequentially in some embodiments, the polypeptide (e.g. fusion polypeptide) is administered to the individual at a dose of 10 mg/kg once a week or 15 mg/kg once a week in some embodiments, the individual receiving treatment has gastric or GEJ adenocarcinoma.
  • the individual receiving treatment has HER2 ⁇ gastric cancer or HER2 + GEJ cancer (e.g., a HER2-overexpessmg gastric or GEJ cancer).
  • the HER2 ⁇ gastric cancer or HER2 ⁇ GEJ cancer is advanced and/or metastatic.
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatments) comprising anti-HER2 antibody (e.g., trastuzumab).
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatments) comprising anti-HER2 antibody (e.g., trastuzumab) and a fluoropyrimidme.
  • the individual receiving treatment has gastric or GEJ cancer that has progressed during or after prior treatraents(s) comprising anti-HER2 antibody (e.g., trastuzumab) and a platinum-based chemotherapeutic agent.
  • the individual receiving treatment has gastric or GEJ cancer (e.g., HER2 + gastric cancer or GEJ cancer) that has progressed during or after prior treatment(s) comprising anti-HER2 antibody (e.g., trastuzumab) and/or a f!uoropyrimidine, and/or a platinum-based chemotherapeutic agent.
  • the fluoropyrimidine was fluorouracil (also known as 5-fluorouracil).
  • treatment with the polypeptide, the anti-HER2 antibody, the anti-VECFR2 antibody, and the paclitaxel does not result in adverse effects.
  • treatment with the polypeptide, the anti-HER2 antibody, the anti-VEGFR2 antibody, and the paclitaxel results in only low* grade adverse effects.
  • a method of treating gastric cancer or gastroesophageal junction (GEJ) cancer in an individual that comprises administering to tire individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa), (b) an anti-PD-1 antibody (e.g., an anti-PD-1 antagonist antibody), (e) an anti-HER2 antibody, (d) 5 -fluorouracil and (e) a platinum-based chemotherapeutic agent.
  • an agent that blocks the interaction between CD47 e.g., hCD47
  • SIRPa e.g., hSIRPa
  • an anti-PD-1 antibody e.g., an anti-PD-1 antagonist antibody
  • an anti-HER2 antibody e.g., an anti-HER2 antibody
  • 5 -fluorouracil e.
  • a method of treating gastric cancer or gastroesophageal junction (GEJ) cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa), (b) an anti- PD-1 antibody (e.g., an anti-PD-1 antagonist antibody), (c) an anti-HER2 antibody, (d) capecitabine, and (e) a platinum-based chemotherapeutic agent.
  • the anti- PD-1 antibody is pembrolizumab (CAS Registry No. 1374853-91-4).
  • the anti-HER2 antibody is trastuzumab (CAS Registry' No. 180288-69-1).
  • the platinum-based chemotherapeutic agent is cisplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa Dl domain variant (e.g., a SIRPa Dl domain variant described herein) and an Fe domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide (e.g., fusion polypeptide) comprises a SIRPa Dl domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G2.37A, and N2.97A mutations, wherein numbering is according to the EU index of Rabat; (li) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Rabat; (iir) a human IgG4 Fc region comprising S228P, E2.33P, F234V, L235 A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, de1G236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135.
  • the polypeptide [e.g , fusion polypeptide) forms a homodimer.
  • the polypeptide (e.g., fusion polypeptide), the anti-PD-1 antibody, the anti-HER2 antibody, the 5-fluorouracil, and the platinum-based chemotherapeutic agent are administered simultaneously, concurrently, or sequentially.
  • the polypeptide e.g., fusion polypeptide
  • the anti-PD-1 antibody e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., the capecitahine
  • the platinum-based chemotherapeutic agent are administered simultaneously, concurrently, or sequentially.
  • the individual receiving treatment has HER2- overexpressing gastric cancer or HER2-overexpressing GEJ cancer in some embodiments, the gastric cancer or the GEJ cancer is advanced and/or metastatic. In some embodiments, the individual has not received prior treatment for gastric cancer or the GEJ cancer.
  • a method of treating head and neck cancer e.g., head and neck cancer squamous cell carcinoma or HNSCC
  • an individual e.g., a human individual
  • administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., bCD47) and SIRPa (e.g , hSIRPa), (b) a PD-1 inhibitor, (c) an antimetabolite, and (d) a platinum-based agent in some embodiments, the PD-1 inhibitor is a small molecule inhibitor, an antisense nucleotide, or a peptide.
  • the PD-1 inhibitor is an anti-PD-I antibody in some embodiments, the anti-PD-1 antibody is pembrolizumab, nivolumab, pidilizumab, cemiplimah, or BMS-936559. in some embodiments, the anti-PD-1 antibody is pembrolizumab (CAS Registry No. 1374853-91-4).
  • the antimetabolite is 5-fluorouracil, 6-mercaptopurine, capecitahine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate.
  • die antimetabolite is 5-fluorouracil.
  • the platinum-based chemotherapy agent is carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin. In some embodiments, the platinum-based chemotherapy agent is cisplatin or carboplatin.
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SIRPa D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) in some embodiments, the polypeptide (e.g., fusion polypeptide) comprises a SIRPa DI domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • a polypeptide e.g., fusion polypeptide
  • a SIRPa DI domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, deIG236, and N2.97 mutations, w herein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135.
  • the polypeptide (e.g, fusion polypeptide) forms a homodimer.
  • the polypeptide (e.g., fusion polypeptide), the PD-1 inhibitor (e.g., an anti-PD-1 antibody, e.g., pembrolizumab), the antimetabolite (e.g., 5-fluorouraeil), and the platinum-based chemotherapeutic agent (e.g., cispiatin or carboplatin) are administered simultaneously, concurrently, or sequentially.
  • the polypeptide (e.g. fusion polypeptide) is administered to the individual at a dose of 10 mg/kg once a week or 15 mg/kg once a week.
  • the individual receiving treatment has HNSCC.
  • the HNSCC is advanced and/or metastatic HNSCC, In some embodiments, the HNSCC is unresectable and/or recurrent. In some embodiments, the individual has not received prior treatment for head and neck cancer (e.g., HNSCC).
  • treatment with the polypeptide, the PD-1 inhibitor (e.g., pembrolizumab), the antimetabolite (e.g., 5-fluorouracil), and tire platinum-based chemotherapeutic agent (e.g., cispiatin or carboplatin) does not result in adverse effects in some embodiments treatment with the polypeptide, the PD-1 inhibitor (e.g , pembrolizumab), the antimetabolite (e.g., 5-fluorouracil), and the platinum-based chemotherapeutic agent (e.g., cispiatin or carboplatin) results in only low grade adverse effects.
  • the PD-1 inhibitor e.g., pembrolizumab
  • the antimetabolite e.g., 5-fluorouracil
  • tire platinum-based chemotherapeutic agent e.g., cispiatin or carboplatin
  • a method of treating cancer in an individual that comprises administering to the individual an effective amount of (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) an anti-TROP2 antibody.
  • the anti-TROP2 antibody is RS7, which is described in U.S. Patent No. 10,179,171, the contents of which are incorporated herein in their entirely .
  • the anti-TROP2 antibody is conjugated to a drug (i.e., an antibody-drug conjugate or “ADC” ).
  • the anti-TROP2 ADC is Sacituzumab govitecan (also known as hRS7-SN38 or IMMU-132), which is described in US 2017/0281791, the contents of which are incorporated herein by reference in their entirety in some embodiments, the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa Dl domain variant (e.g., a SIRPa Dl domain variant described herein) and an Fe domain variant (e.g., an Fc domain variant described herein) in some embodiments, the polypeptide (e.g., fusion polypeptide) comprises a SIRPa Dl domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • a polypeptide e.g., fusion polypeptide
  • the polypeptide comprises a SIRPa Dl domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the Eli index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N2.97A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human igG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human igG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Kabat.
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the polypeptide (e.g., fusion polypeptide), and die anti-TROP2 antibody are administered simultaneously, concurrently, or sequentially.
  • the cancer is solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer.
  • the cancer is characterized by the overexpression of TROP2. In some embodiments, the cancer is not characterized by the overexpression of TROP2.
  • a method of increasing phagocytosis of a target cell that comprises contacting the target cell with (a) an agent that blocks the interaction between CD47 (e.g., hCD47) and SIRPa (e.g., hSIRPa) and (b) an anti-TROP2 antibody.
  • the anti-TROP2 antibody is RS7, which is described in U.S Patent No. 10,179,171, the contents of which are incorporated herein in their entirety.
  • the anti-TROP2 antibody is conjugated to a drug (i.e. , an antibody -drug conjugate or “ADC”).
  • the anti-TROP2 ADC is Sacituzumab govitecan (also known as hRS7-SN38 or IMMU-132), which is described in US 2017/0281791, the contents of which are incorporated herein by reference m their entirety' .
  • the agent is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g. , a SIRPa D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRPa DI domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, de
  • the polypeptide forms a homodimer.
  • the target cell is a cancer cell.
  • the cancer cell is a solid tumor cell, a gastric cancer cell, a nasopharyngeal cancer cell, a gallbladder cancer cell, a cervical cancer cell, an extranodal NK/T cell lymphoma cell, a lung cancer cell, a laryngeal squamous cell cancer ceil, a colon cancer cell, a Hilar Cholangiocarcinoma ceil, a pancreatic cancer cell, a squamous cell carcinoma cell of the oral cavity , an endometrioid endome trial carcinoma cell, or an ovarian carcinoma cell.
  • a method of increasing phagocytosis of a target cell comprising contacting the target cell with (a) an agent that blocks the interaction between CD47 (e.g., h €D47) and SIRPa (e.g., hSIRPa) and (b) a second agent that is capable of enhancing phagocytosis.
  • the agent that blocks the interaction between CD47 and SIRPa is a polypeptide (e.g., fusion polypeptide) comprising a SIRPa Dl domain variant (e.g., a SIRPa DI domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein).
  • the polypeptide comprises a SIRPa Dl domain variant that comprises the amino acid sequence of SEQ ID NO: 81 or SEQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of Kabat; (ii) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations, wherein numbering is according to the EU index of Kabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L2.35A, and delG236 mutations, wherein numbering is according to the EU index of Kabat; or (iv) a human IgG4 Fe region comprising S228P, E233P, F234V, L235A,
  • the polypeptide (e.g., fusion polypeptide) administered to the individual comprises the amino acid sequence of SEQ ID NO: 136 or SEQ ID NO: 135. In some embodiments, the polypeptide (e.g., fusion polypeptide) forms a homodimer. In some embodiments, the second agent enhances phagocytosis, e.g., by blocking “don’t eat me” signals.
  • Exemplary agents include, but are not limited to, e.g., an anti- LILRB2 antibody, an anti-LILRBl antibody, an anti-SIGLEC-10 antibody, an anti-CD24 antibody, an anti-SIRPa antibody, an anti-PDl antibody (e.g., an anti PD1 antagonist antibody), and an anti-PD-Ll antibody (e.g., an anti PD-LI antagonist antibody).
  • the second agent enhances phagocytosis, e.g., by enhancing “eat me” signals.
  • Exemplary ⁇ agents include, but are not limited to, e.g., BTK activators, TLR agonists, agents that promote the interaction between Mae-1 and SLAMF7, and agents that agents that promote the interaction between calreticulin and LRP1.
  • Additional exemplary agents that enhance phagocytosis include, but are not limited to, e.g., agents that modulate podosome adhesions, agents that modulate the expression level of !amin A, activators of the 8HP-! phosphatase activity, and activators of myosin Ha assembly.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRPa D1 domain variant (e.g., a SIRPa Dl domain variant described herein) and an Fe domain variant (e.g., an Fc domain variant described herein) and (b) and an anti ⁇ LILBR2 antibody, an anti ⁇ CD24 antibody, or an anti-STGLEC-10 antibody.
  • the method comprise contacting the target cell with (a) the fusion polypeptide and (b) a BTK activator.
  • the method comprises contacting the target cell with (a) the fusion polypeptide and (b) a TLR agonist.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRPa Dl domain variant (e.g., a SIRPa Dl domain variant described herein) and an Fc domain variant (e.g, an Fc domain variant described herein) and (b) two or more agents that are capable of enhancing phagocytosis (e.g., including, but not limited to, two or more agents described herein).
  • the polypeptide e.g., fusion polypeptide
  • a SIRPa Dl domain variant e.g., a SIRPa Dl domain variant described herein
  • Fc domain variant e.g, an Fc domain variant described herein
  • two or more agents that are capable of enhancing phagocytosis e.g., including, but not limited to, two or more agents described herein.
  • the method comprises contacting the target cell with (a) the polypeptide (e.g., fusion polypeptide) comprising a SIRPa Dl domain variant (e.g., a SIRPa Dl domain variant described herein) and an Fe domain variant (e.g., an Fe domain variant described herein), (b) and an anti-LILBR2 antibody, an anti-CD24 antibody, or an anti-SIGLEC-10 antibody, and (c) an anti-PDl antibody (e.g., an anti-PD-1 antagonist antibody) or an anti-PD-LI antibody (e.g., an anti-PD-Ll antagonist antibody).
  • a the polypeptide.g., fusion polypeptide
  • a SIRPa Dl domain variant e.g., a SIRPa Dl domain variant described herein
  • an Fe domain variant e.g., an Fe domain variant described herein
  • an anti-PDl antibody e.g., an anti-PD-1 antagonist antibody
  • an anti-PD-LI antibody e.
  • the method comprises contacting the target cell with (a) the fusion polypeptide, (b) an anti-LILBR2 antibody, and (c) an anti-PDl antibody (e.g., anti-PD-1 antagonist antibody) in some embodiments, the method comprises contacting the target cell with (a) the fusion polypeptide, (b) an anti-LlLBR2 antibody, and (c) an anti-PD-Ll antibody (e.g. an aiiti-PD-Ll antagonist antibody)
  • the contacting is performed in vitro. In some embodiments, the contacting is performed in vivo. In some embodiments, the target cell is a cancer cell. In some embodiments, contacting the target cell with (a) the polypeptide comprising a SiRPa D 1 domain variant (e.g., a SiRPa D1 domain variant described herein) and an Fc domain variant (e.g., an Fc domain variant described herein) and (b) one or more agents that are capable of enhancing phagocytosis increases phagocytosis of target cells by at least any one of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more than 99% as compared contacting the target cell with one or more agents that are capable of enhancing phagocytosis (i.e., in the absence of the polypeptide comprising a SiRPa D1
  • an article of manufacture or a kit comprising a polypeptide (e.g., a fusion polypeptide described herein) comprising a SiRPa D1 domain variant and an Fc domain variant.
  • the SiRPa D1 domain variant comprises the amino acid sequence selected from the group consisting of: SEQ ID NO: 81 and SFQ ID NO: 85.
  • the Fc domain variant is (i) a human IgGl Fc region comprising L234A, L235A, G237A, and N297A mutations, wherein numbering is according to the EU index of R abat; (ii) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations, wherein numbering is according to the EU index of Rabat; (iii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations, wherein numbering is according to the EU index of Rabat; or (i v) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations, wherein numbering is according to the EU index of Rabat.
  • the Fc domain variant comprises the amino acid sequence of SEQ ID NO: 91.
  • the polypeptide comprises the amino acid sequence of SFQ ID NO: 135 or SEQ ID NO: 136
  • the kit or article of manufacture is for use according to a method of treatment provided herein.
  • the kit or article of manufacture further comprises a BCL2 inhibitor in some embodiments, the BCL2 inhibitor is venetoclax.
  • the kit comprises a package insert or label with instructions tor using the polypeptide (e.g., fusion polypeptide) in combination with the BCL2 inhibitor (e.g., venetoclax) to treat or delay progression of cancer (e.g., leukemia, including, but not limited to acute or chronic lymphoblastic leukemia, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL).
  • cancer e.g., leukemia, including, but not limited to acute or chronic lymphoblastic leukemia, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL).
  • SLL small lymphocytic lymphoma
  • AML acute myeloid leukemia
  • MDS myelodysplastic syndrome
  • CML chronic myeloid letikernia
  • BPDCN biastic plasmacytoid dendritic cell neoplasm
  • B-PLL B-cell prolymphocytic leukemia
  • T-PLL T-cell prolymphocytic leukemia
  • MM Multiple Myeloma
  • Non-Hodgkin Lymphomas such as diffuse large B-cell lymphoma (DLBCL), Burkitt lymphoma, mantle cell lymphoma (MCL), Peripheral T-cell lymphoma (PTCL), Lympliop!asmacytic lymphom
  • the kit or article of manufacture further comprises a platinum- based chemotherapy agent.
  • the platinum-based chemotherapy agent is earboplatm, ctsplatin, oxaliplaiin, nedaplatin, tripiatin tetranitrate, phenanthriplatin, pieopiatin, or satraplatin.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fission polypeptide) in combination with the platinum-based chemotherapy agent (e.g., cisplatin) to treat or delay progression of solid tumor (e.g., colon cancer, colon carcinoma, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, brain tumor, mesothelioma, or neuroblastoma) in an individual (such as a human individual).
  • the platinum-based chemotherapy agent e.g., cisplatin
  • the kit or article of manufacture further comprises an anti- HER2 antibody (e.g., trastuzumab), and a PD-L1 inhibitor (e.g., an anti-PD-Ll antibody such as atezolizumab, avelumab, or durvalumab.
  • an anti- HER2 antibody e.g., trastuzumab
  • a PD-L1 inhibitor e.g., an anti-PD-Ll antibody such as atezolizumab, avelumab, or durvalumab.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-L1 inhibitor (e.g., atezolizumab, avelumab, or durvalumab) to treat or delay progression of cancer (e.g., solid tumor) in an individual (such as a human individual).
  • the polypeptide e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., trastuzumab
  • the PD-L1 inhibitor e.g., atezolizumab, avelumab, or durvalumab
  • the cancer e.g., solid tumor
  • the cancer is colon cancer, lung cancer, head and neck cancer, esophageal cancer, breast cancer, bladder cancer, ovarian cancer, cervical cancer, testicular cancer, endometrial cancer, liver cancer, gastric cancer, gastroesophageal junction cancer, brain tumor, mesothelioma, or neuroblastoma.
  • the cancer e.g., solid tumor
  • the cancer is HER2 + cancer in some embodiments
  • the cancer is colon cancer (e.g., 11 HR ' colon cancer).
  • the kit or article of manufacture further comprises an anti- HER2 antibody (e.g., trastuzumab), an anti-VEGFR2 antibody (e.g., ramueirumab), and paditaxel
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anii-HER2.
  • trastuzumab e.g., trastuzumab
  • anti-VEGFR2 antibody e.g., ramucirumab
  • die paclitaxel to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer m an individual (such as a human individual), e.g., according to a method described herein.
  • GEJ gastroesophageal junction
  • the kit or article of manufacture further comprises an anti- HER2 antibody (e.g., trastuzumab), a PD- 1 inhibitor (e.g., an anti -PD- 1 antibody such as pernbrolizumab), 5-fluorouracil, and a platinum-based agent (e.g., cisplatin or carbopiatin).
  • an anti- HER2 antibody e.g., trastuzumab
  • a PD- 1 inhibitor e.g., an anti -PD- 1 antibody such as pernbrolizumab
  • 5-fluorouracil e.g., 5-fluorouracil
  • platinum-based agent e.g., cisplatin or carbopiatin
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-1 inhibitor (e.g., pernbrolizumab), the 5-fluorouracii, and the platinum- based agent (e.g., cisplatin or carbopiatin) to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer in an individual (such as a human individual).
  • the kit or article of manufacture further comprises an anti-HER2.
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody such as pernbrolizumab
  • capecitabine e.g., a platinum-based agent
  • a platinum-based agent e.g., cisplatin or carbopiatin
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the anti-HER2 antibody (e.g., trastuzumab), the PD-1 inhibitor (e.g., pernbrolizumab), the capecitabine, and the platinum-based agent (e.g., cisplatin or carbopiatin) to treat or delay progression of gastric cancer or gastroesophageal junction (GEJ) cancer in an individual (such as a human individual).
  • the polypeptide e.g., fusion polypeptide
  • the anti-HER2 antibody e.g., trastuzumab
  • the PD-1 inhibitor e.g., pernbrolizumab
  • the capecitabine e.g., cisplatin or carbopiatin
  • the kit or article of manufacture further comprises a PD-1 inhibitor (e.g , an anti-PD-i antibody such as pernbrolizumab, nivolumab, pidilizumab, cemiplimab, or BM8936559), an antimetabolite (e.g., 5-fluorouracii, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate) and a platinum-based agent (e.g., cisplatin, carbopiatin, oxalipiatin, nedaplatin, tripiatin tetranitrate, phenanthripiatin, picoplatm, or satraplatin).
  • a PD-1 inhibitor e.g , an anti-PD-i antibody such as pernbrolizumab, nivolumab
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with the PD-1 inhibitor (e.g., pernbrolizumab, nivolumab, pidilizumab, cemiplimab, or BMS936559), the antimetabolite (e.g , 5-fiuorouracil, 6-mercaptopurine, capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, pemetrexed, phototrexate), and the platinum- based agent (e.g., cisplatin, carbopiatin, oxalipiatin, nedaplatin, tripiatin tetranitrate, phenanthripiatin, picoplatin, or satraplatin) to treat or delay progression of head and neck cancer (e.g., head and neck cancer (e.g
  • the kit or article of manufacture further comprises a therapeutic anti-TKOP2 antibody.
  • the anti-TROP2 antibody is RS7 (see, e.g , U.S. Patent No. 10,179,171) or sacituzumab goviteean.
  • the kit comprises a package insert or label with instructions for using the polypeptide (e.g., fusion polypeptide) in combination with anti-TROP2 antibody (e.g., cisplatin) to treat or delay progression of a TROP2 + cancer (e.g., solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squamous cell cancer, colon cancer, Hilar Cholangiocarcinoma, pancreatic cancer, squamous cell carcinoma of the oral cavity, endometrioid endometrial carcinoma, or ovarian carcinoma) in an individual (such as a human individual).
  • a TROP2 + cancer e.g., solid tumor, gastric cancer, nasopharyngeal cancer, gallbladder cancer, cervical cancer, extranodal NK/T cell lymphoma, lung cancer, laryngeal squa
  • the polypeptide (e.g., fusion polypeptide) and the one or more additional anti-cancer agents are provided together in the kit.
  • the polypeptide (e.g., fusion polypeptide) and die one or more additional anti-cancer agents are provided in the same container or separate containers.
  • Suitable containers include, for example, botles, vials, bags and syringes.
  • the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or polyolefin), or metal alloy (such as stainless steel or hastelloy).
  • the container holds die formulation and the label on, or associated with, the container may indicate directions for use.
  • the article of manufacture or kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • the article of manufacture further includes one or more of another agent (e.g., a chemotherapeutic agent, an anti-neoplastic agent, a therapeutic antibody, etc.).
  • Suitable containers tor the one or more agents include, for example, bottles, vials, bags and syringes.
  • Example 1A Anti-tumor activity of Drug .4 in combination with Venetoclax in an acute leukemia model.
  • the anti -tumor acti v ity of Drug A i.e., an exemplary' poly peptide comprising a SIRPa dl domain variant and an Fc variant, in combination with venetoclax was assessed in a RS4;11 xenograft model.
  • RS4;11 cells (described in Stong et al. (1985) Blood. 65(1): 21-31) was injected into the right flank of NOD-SCID female mice at a concentration of 5 x 1() 6 cells per mouse using a 1:1 matrigel (Coming) and RPMI 1640 ratio. Tumors were monitored until the average size of all tumors reached 190 mm’. Mice were randomized into PBS control, Venetoclax (Selleckchem), Drag A, and Venetociax/Drug A combination cohorts, with 10 mice per cohort.
  • V enetoclax was a ratio of DMSO :ethanol: Cremophor EL : dextrose 5% in water (D5W) was 2.5 : 5 : 10 : 20 : 67.5, by volume.
  • Venetoclax-treated mice were dosed with 250 pg of Venetoclax by oral gavage 2 times total, 3 days apart.
  • Drug A-treated mice were dosed IP at 10 mg/kg, 4 times total, 3-4 days apart
  • Venetoclax/Drug A-treated mice were dosed with 250 pg of Venetoclax by oral gavage 2 times total, 3 days apart, and with Drug A 1 day post Venetoclax dosage at 10 mg/kg, 4 times total, 3-4 days apart.
  • Tumors were measured in two dimensions with calipers, and tumor volume was calculated as: length x width x width x 0.5, where length w'as the larger of the two measurements.
  • Venetoclax administered on Day 45
  • Drug A administered on Day 46
  • FIG. IB in mice who had received prior Venetoclax, treatment with Venetoclax in combination w ith Drug A inhibited tumor growth to a greater extent that re-treatment with Venetoclax alone.
  • the average tumor volume at Day 65 of mice re-treated with Venetoclax was about 1685 mnr, whereas the average tumor volume at Day 65 of mice treated with the combination was about 970 mnr.
  • the mouse that demonstrated tumor regression when treated with single-agent Venetoclax received single agent Venetoclax on Day 45. Notably, tumor regrowth was observed in this mouse.
  • Example IB Effect of Drug A in combination with venetoclax on phagocytosis by macrophages in an in vitro model
  • CD14 monocytes were purified by negative selection using the Classical Monocytes
  • CD14 + monocytes were seeded into 150 mm tissue culture dishes (Coming) at 6 million cells per dish in 25 mL medium comprised of RPM1 complete media, supplemented with 50ng/mL M-CSF (Miltenyi Biotec), 10% human FBS serum (Thermo Fisher Scientific), 1% pegoriilin/streptomycin, and 1% GlutaMAX. Cells were cultured for seven to eleven days.
  • HL60 and OCI-AML3 cells were washed once in PBS and labeled with the Cell trace CFSE Cell Proliferation kit (Thermo Fisher Scientific) in suspension wdtli 300 nM CF8E (carboxyfluoreseein succinimidyl ester) according to the manufacturer’s instructions and resuspended in RPMI complete media.
  • Target cells were incubated overnight with two-fold serial dilutions of venetoclax between 39 nM to 2.5 iiM in RPMI complete media. Prior to incubation with macrophages, ceils w3 ⁇ 4re resuspended in RPMI.
  • Macrophages were detached from culture plates by washing once with PBS and incubation in TrypLE Select tor 20 minutes at 37°C. Cells were removed with a cell scraper (Coming), washed in PBS, and resuspended in RPMI.
  • CFSE-labeled target cells treated with venetoclax for 48 hours were spun and added to ultra-low* attachment U -bottom 96 w*eil plates (Coming) at 100,000 cells per well. Drag A was then added. Plates were incubated 30 minutes at 37 ° C in a humidified incubator with 5% carbon dioxide, then 50,000 macrophages were added. Plates were incubated two hours at 37 ° C in a humidified incubator with 5 % carbon dioxide. Cells were pelleted by centrifugation for five minutes at 400 x g and stained at 4 C for 30 minutes in Fixable Viability Dye eFluor 780 (ebioscience) diluted 1:4000 m PBS.
  • target ceils ’ were labeled with CFSE (carboxytluoreseem suceinimidyl ester) and treated with venetodax for 48 hours.
  • CFSE carboxytluoreseem suceinimidyl ester
  • the target cells were then spun and added to wells of 96 well plates at 100,000 cells per well. Drag A was then added. Untreated control target cells, as well as control target cells that treated only with venetodax or only with Drag A, were prepared in parallel. Macrophages were added to the wells, and tire plates were incubated two hours at 37 C. Macrophage ceils were pelleted, stained, and analyzed via flow cytometry.
  • Dead cells were excluded by gating on the c780- negative population. Macrophages were identified as cell positi ve for the lineage markers CD33, CD! Ib and CD14. Of this population, macrophages that had phagocytosed tumor cells were identified as cells positive for CFSE,
  • IP intraperrtoneally
  • Cisplatin was administered IP according to one of two regimens: once at a dose of 10 mpk or twice at a dose of 5 mpk. The two 5 mpk cisplatin doses were given 10 days apart. Mice receiving both cisplatin and Drug were administered with cisplatin (IP) according to one of the regimens described above, and with Drag A as described above. In mice receiving combination treatment, Drug A was administered one day after cisplatin. Tumors were measured in two dimensions with calipers, and tumor volume was calculated as: length x width x width x 0.5, where length was the larger of the two measurements.
  • mice treated with single agent cisplatin two 5 mpk doses, each given 10 days apart
  • Drag A did not have an appreciable effect of tumor growth.
  • Treatment with cisplatin in combination with Drug A delayed CT26 tumor growth m mice to a greater degree than either drag alone.
  • mice treated with cisplatin in combination with Drag A gained more weight during the course of treatment than mice given cisplatin alone.
  • mice in each of the PBS control, cisplatin, and Drag A treatment groups found to have a tumor volume ⁇ 500 mm 3 , whereas 33% of the mice in the cisplatin + Drag A treatment groups had tumors ⁇ 500 rnirr in volume.
  • DLD-1 cells were washed twice with 20 ml PBS and incubated in 10 ml TRYPLETM Select (Gibco) cell-dissociation enzymes for 10 minutes at 37°C in order to detach the cells from the culture plates. The detached cells were then centrifuged, washed in PBS, and resuspended in medium. Cells were labeled with the fluorescent label provided with the CELLTRACETM CFSE Cell Proliferation kit (Thermo Fisher) according to the manufacturer's instructions and resuspended in IMDM (Iscove’s Modified Dulbeceo Medium).
  • Macrophages were detached from culture plates by w ashing twice with 20 ml PBS and incubation in 10 ml TRYPLETM Select (Gibco) cell-dissociation enzymes for 2.0 minutes at 37°C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in IMDM.
  • Phagocytosis assays were assembled in ultra-low attachment U-bo tom 96 well plates (Coming) containing 100,000 DLD-1, 50,000 macrophages, five-fold serial dilutions of Drug A or negative control antibody from 100 nM to 6.4 pM, and anti-TKOP2 antibody at 0.01 pg/ml. The plates were incubated two hours at 37°C in a humidified incubator with 5 percent carbon dioxide. Cells were then pelleted by centrifugation for five minutes at 400 x g and washed in 250 m ⁇ FACS buffer.
  • Macrophages were stained on ice for 15 minutes in 50 m ⁇ FACS buffer containing 10 m ⁇ human FcR Blocking Reagent (Miltenyi Biotec), 0.5 m! anti ⁇ CD33 Ab conjugated to BV421 label (Biolegend), and 0.5 m ⁇ anti-CD2Q6 conjugated to Allophycocyanin- Cy7 label (Biolegend).
  • the cells were washed in 200 m ⁇ FACS buffer, washed in 2.50 m ⁇ PBS, and stained on ice for 30 minutes in 50 m ⁇ Fixable Viability Dye EFLUORTM 506 (ebioscience) viability dye diluted 1:1000 in PBS.
  • FIG. 3 the percent of macrophages that pliagocytosed CFSE-labeled tumor cells is indicated on the y-axis. Macrophages were incubated with the indicated concentration of Drug A and 10 ng/niL anti- TROP2 antibody. Cells were also incubated with 10 ng/mL anti- TROP2 antibody alone, with negative control human IgG antibody in combination witli anti-TROP2 antibody, and m media only. Phagocytosis of CFSE-labeled DLD-1 tumor cells by human monocyte-derived macrophages was enhanced in the presence of Drug A in combination of anti-TROP2 antibody. See FIG. 3.
  • Example 4 Anti-tumor activity of Drug A in combination with trastuzumab and an anti-PDl antibody in a colon cancer model.
  • MC38 m/h HER2 cells were generated by infecting MC38 murine colon adenocarcinoma cells with a lentivirus vector encoding a chimera of mouse and human HER2 transmembrane and extracellular domains.
  • MC38 m/h HER2 cells were maintained in DMEM (Thermo Fisher Scientific 11965092.) supplemented with 10% FBS, 1% Penicillin-Streptomycin, 1% GlutaMAX and I M Sodium Pyruvate (Thermo Fisher Scientific 11360070) at 37°C, 5% C02 incubator. All tissue culture was performed under aseptic conditions.
  • Tumor volume (mm 3 ) using Mitutoyo Digital Caliper (Mitutoyo America, Aurora, Illinois) and body weights were recorded two or three times per week. Mice exceeding tumor volume of 2000 mm 3 or loss of 20% body weight were euthanized according to IACUC guidelines. Tumor volume is calculated ([length x (width x width ⁇ ] x 0.5 volume in mm 3 ). Statistical analysis and p values were calculated using GraphPad Prism Software.
  • a clinical trial is performed to assess tire safety, tolerability ' , and efficacy of the combination of Drug A, trastuzumab, ramucirumab, and paclitaxel in patients with HER2 ⁇ overexpressing advanced or metastatic gastric or GFJ adenocarcinoma that has progressed during or after prior therapy with trastuzumab and fluoropyrimidine -containing chemotherapy (e.g., fiuorouraeil); during or after prior therapy with trastuzumab and platinum-containing chemotherapy; or during or after prior therapy with trastuzumab, fluoropyrimidine-containing chemotherapy (e.g., fiuorouraeil), and platinum-containing chemotherapy.
  • the patients enrolled in the trial are suitable for treatment with trastuzumab.
  • the patients have not received prior therapy with an anti-CD47 agent or an anti-SIRPa agent.
  • a clinical trial is perfonned to assess the safety, tolerability, and efficacy of the combination of Drug A, pembroliznmab, cisplatin, and either 5 -fiuorouraeil or eapecitabine in patients with gastric or GEJ adenocarcinoma (e.g., HER2 + overexpressing gastric or GEJ adenocarcinoma).
  • gastric or GEJ adenocarcinoma e.g., HER2 + overexpressing gastric or GEJ adenocarcinoma
  • the patients enrolled in the trial have not received prior therapy with an anti- CD47 agent or an anti-SIRPa agent.
  • Patients have adequate organ function and hemoglobin is greater or equal to 9 g/dL
  • TINSCC Head and Neck Squamous Cell Carcinoma
  • Example SB Preliminary Safety Results from the Exemplary Clinical Trials Described in Example 54
  • trastuzumab Three additional patients with HER2-positive gastric/gastroesophageal cancer who progressed on prior treatment(s) with trastuzumab, fluorouracii, and a platinum agent received treatment with Drug A (15 mg/kg IV QW), trastuzumab (8 mg/kg IV for the initial dose, followed by 6 mg/kg Q3W), ramucirumab (8 mg/kg on Days 1 and 15 Q4W), and paelitaxel (80 mg/m2 on Days 1, 8, and 15 Q4W).
  • Drug A 15 mg/kg IV QW
  • trastuzumab 8 mg/kg IV for the initial dose, followed by 6 mg/kg Q3W
  • ramucirumab 8 mg/kg on Days 1 and 15 Q4W
  • paelitaxel 80 mg/m2 on Days 1, 8, and 15 Q4W.
  • Example 5C Preliminary Efficacy Results from the Exemplary Clinical Trials Described in Example 5A
  • Drug A in combination with pembrolizumab, 5-fhiorouracii, and a platinum agent showed clinical activity in the treatment of advanced 1L HNSCC (i.e., as a first treatment in patients with advanced HNSCC who have not received prior therapy for HNSCC.)
  • Drug A in combination with trastuzumab, ramucimmab, and paclitaxel showed clinical activity in the treatment of advanced >2L gastric/gastroesophageal cancer (i.e., as a treatment in patients who have received at least one prior therapy tor gastric or GEJ cancer).
  • Example 57 Additional Results from the Exemplary Clinical Trials Described in Example 5A
  • CD47 is a myeloid checkpoint up-regulated by tumors to evade the anticancer immune response.
  • Drug A is an exemplary high affinity CD47-blocking fusion protein with an inactive Fe region designed to safely enhance anticancer therapeutics (Kauder et al. (2016) PLoS ONE. 13(8): e0201832; Chow et al. (2020) Journal of Clinical Oncology. 38:15_suppl, 3056- 3056).
  • Drug A in combination with standard chemotherapy and antibody regimens was evaluated in patients with advanced HER2 -positive gastric cancer (GC) or with head and neck squamous cell carcinoma (HNSCC).
  • GC advanced HER2 -positive gastric cancer
  • HNSCC head and neck squamous cell carcinoma
  • GC patients had progressed during or following a prior fluoropyrimidine therapy (or a fluoropyrimidine-containing therapy). GC patients who had progressed during or following a prior therapy with trastuzumab and/or a platinum -based chemotherapeutic agent were included.
  • Drug A 10 mg/kg QW or 15 mg/kg QW r in combination with pembrolizumab (P) + 5FU + platinum (cispiatin or carboplatin) as 1st hue therapy.
  • P pembrolizumab
  • 5FU platinum
  • platinum cispiatin or carboplatin
  • the primary' endpoint was dose limiting toxicity (DLT).
  • DLT dose limiting toxicity
  • Tumor response, PK), and pharmacodynamic (PD) markers were assessed in all patients.
  • HNSCC Three patients with previously untreated HNSCC were administered A + P + 5FU + platinum, as described above. No DLTs were reported. Three pts experienced any adverse events (AE), none were treatment-related.
  • Drug A demonstrates initial OR R of 64% in patients with >2L HER2 positive GC in combination with trastuzumab and ramucirumab + paditaxel that compares favorably with the clinical experience of ramucirumab ⁇ paditaxel in patients whose disease has progressed upon prior trastuzumab-containing regimens.
  • Drug A demonstrates initial anti-cancer activity including complete and partial objective responses in combination with pembrolizumab + 5FU + platinum in patients who have not received prior treatment for their advanced FIN8CC.
  • the C-temiinus of the SIRPa variant of Drug A is fused to the N- terminus of an Fc variant with ablated effector function.
  • Drug B is a fusion polypeptide comprising the SIRPa variant of Drug A whose C- terminus is fused to the N-terminus of a WT Fc (i.e., the WT Fc from which the Fc variant of Drug was derived).
  • Drag C is a fusion polypeptide comprising a SIRPa variant that binds hCD47 with a KD of 3n' ⁇ l whose C-terminus is fused to the N-terminus of the Fc variant of Drug A.
  • C57BL6 mice were randomized into 4 groups (n ::: 3 per group) and administered with 3 mg/kg (or “mpk”) of Drug A, Drug B, or Drug C, or with vehicle (PBS).
  • mpk 3 mg/kg
  • spleens w ere harvested an analyzed for up-regulation of CD86, a cell-surface marker that indicates dendritic cell activation.
  • CDS and CD8 dendritic cells were activated in spleens of mice that were administered with Drug A.
  • the level of CD8 + dendritic cell activation (FIG, 6A) and CDS dendritic ceil acti v ation (FIG. 6B) in the spleens of mice administered with Drag C was the same as m mice administered with PBS control.
  • CDS 1 and CDS dendritic cells were activated in the spleens of mice administered with Drag B, but to a lesser extent than CDS 1 and CD8 dendritic cells in the spleens of mice administered with Drug A.
  • a therapeutic agent comprising a CD47 binding moiety (e.g., a SIRPa variant) that has an affinity for hCD47 that is better than about 10 nM and/or an Fc variant with ablated effector function leads to higher CD8 + and CDS DC activation than administration of a therapeutic agent that comprises a CD47 binding moiety (e.g., a SIRPa variant) that has an affinity for CD47 (e.g., hCD47) that is higher than 10 nM and/or a WT Fc domain.
  • a CD47 binding moiety e.g., a SIRPa variant
  • a therapeutic agent that binds CD47 and comprises an Fc domain with ablated effector function demonstrates improved safety following administration as compared to a therapeutic agent that binds CD47 and comprises a WT Fc domain. See, e.g., Kauder et al. (2016) PLoS ONE 13(8): e0201832.
  • Drag A is a fusion polypeptide comprising a SIRPa variant that binds hCD47 wifli a K D of ⁇ 140 pM whose C- terminus is fused to the N-terminus of an Fc variant with ablated effector function.
  • F59/magrolimab is a therapeutic anti-CD47 antibody comprising a human IgG4 Fc domain with WT effector function.
  • TTi-621 is a therapeutic fusion polypeptide comprising the CD47 binding domain of human SIRPa linked to a human IgGT Fc domain with WT effector function.
  • TTI- 622 is a therapeutic fusion polypeptide comprising the CD47 binding domain of human SIRPa linked to a to a hitman igG4 Fc domain w itli WT effector function.
  • the affinities of Drug A, F59/magrolimab, TTI-621, and TTI-622 for hCD47 are shown in Table D below. Table D
  • Drug A exhibited about 100% receptor occupancy at a concentration of ⁇ JnM.
  • F59/magro3imab exhibited about 90% receptor occupancy at a concentration of ⁇ lnM.
  • Agents 2 and 3 exhibited about 40% receptor occupancy at a concentration of ⁇ 1mM.
  • a validated SIRPa signaling assay (PathHunter SIRPa Signaling Bioassay from DiscoverX) was used to assess the degree to which Drag A, F59/magrolimab, TTI-621, and TTI- 622 inhibit the interaction between hSIRPa and hCD47.
  • the EC50 values of Drug A, F59/magroliinab, TTI-621, and TTI-622 for h €D47 are shown in Table E below.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Inorganic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • Hematology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2020/062402 2019-11-27 2020-11-25 Combination therapies for treating cancer Ceased WO2021108693A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
KR1020227021105A KR20220107223A (ko) 2019-11-27 2020-11-25 암 치료를 위한 병용 요법
CN202080090447.6A CN114845710A (zh) 2019-11-27 2020-11-25 用于治疗癌症的组合疗法
JP2022530167A JP7713447B2 (ja) 2019-11-27 2020-11-25 がんを治療するための組み合わせ療法
MX2022006078A MX2022006078A (es) 2019-11-27 2020-11-25 Terapias de combinacion para el tratamiento del cancer.
CN202511210212.7A CN121243368A (zh) 2019-11-27 2020-11-25 用于治疗癌症的组合疗法
AU2020394204A AU2020394204A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer
IL293199A IL293199A (en) 2019-11-27 2020-11-25 Combined therapies for cancer treatment
CA3162633A CA3162633A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer
EP20825371.6A EP4065101A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer
BR112022008817A BR112022008817A2 (pt) 2019-11-27 2020-11-25 Terapias combinadas para tratamento de câncer
JP2025066099A JP2025118648A (ja) 2019-11-27 2025-04-14 がんを治療するための組み合わせ療法

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201962941390P 2019-11-27 2019-11-27
US62/941,390 2019-11-27
US202063022998P 2020-05-11 2020-05-11
US63/022,998 2020-05-11
US202063030686P 2020-05-27 2020-05-27
US63/030,686 2020-05-27
US202063106225P 2020-10-27 2020-10-27
US63/106,225 2020-10-27
US202063109044P 2020-11-03 2020-11-03
US63/109,044 2020-11-03

Publications (1)

Publication Number Publication Date
WO2021108693A1 true WO2021108693A1 (en) 2021-06-03

Family

ID=73854963

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/062402 Ceased WO2021108693A1 (en) 2019-11-27 2020-11-25 Combination therapies for treating cancer

Country Status (11)

Country Link
US (3) US20210154269A1 (https=)
EP (1) EP4065101A1 (https=)
JP (2) JP7713447B2 (https=)
KR (1) KR20220107223A (https=)
CN (2) CN121243368A (https=)
AU (1) AU2020394204A1 (https=)
BR (1) BR112022008817A2 (https=)
CA (1) CA3162633A1 (https=)
IL (1) IL293199A (https=)
MX (1) MX2022006078A (https=)
WO (1) WO2021108693A1 (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
WO2023043269A1 (ko) * 2021-09-17 2023-03-23 주식회사 엘베이스 면역반응을 조절하기 위한 약학적 조성물
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
WO2023073580A1 (en) * 2021-10-29 2023-05-04 Pfizer Inc. Enhancement of cd47 blockade with taxanes for cd47+ cancer therapy
WO2023183817A1 (en) * 2022-03-24 2023-09-28 Gilead Sciences, Inc. Combination therapy for treating trop-2 expressing cancers
WO2023235754A1 (en) * 2022-06-01 2023-12-07 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20250367255A1 (en) * 2021-11-08 2025-12-04 Pfizer Inc. Enhancement Of CD47 Blockade Therapy With Anti-VEGF Agents
US20250026806A1 (en) * 2021-11-19 2025-01-23 Hangzhou Sumgen Biotech Co., Ltd. SIRPa VARIANT AND USE THEREOF
US20230416402A1 (en) * 2022-03-03 2023-12-28 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16, and her2
US20250345395A1 (en) * 2022-05-25 2025-11-13 Pfizer Inc. Dosing Regimens of SIRP Alpha Fusion Proteins for Treatment of Cancer
CN120530124A (zh) * 2023-01-04 2025-08-22 阿斯顿科学有限公司 Trop2免疫原性肽
WO2025038668A1 (en) * 2023-08-14 2025-02-20 Voro Therapeutics, Inc. Therapeutic binding agents that conditionally promote myeloid cell activity against target cells and uses thereof
CN117890603A (zh) * 2024-01-17 2024-04-16 南通大学附属医院 Pd-l1作为药物靶点在筛选抑制肌腱粘连药物中的应用

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013109752A1 (en) 2012-01-17 2013-07-25 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents
WO2014094122A1 (en) 2012-12-17 2014-06-26 Trillium Therapeutics Inc. Treatment of cd47+ disease cells with sirp alpha-fc fusions
WO2016023040A1 (en) 2014-08-08 2016-02-11 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
WO2016063233A1 (en) 2014-10-24 2016-04-28 Effimune Method and compositions for inducing differentiation of myeloid derived suppressor cell to treat cancer and infectious diseases
WO2016187226A1 (en) 2015-05-18 2016-11-24 Ab Initio Biotherapeutics, Inc. Sirp polypeptide compositions and methods of use
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
WO2017068164A1 (en) 2015-10-21 2017-04-27 Ose Immunotherapeutics Methods and compositions for modifying macrophage polarization into pro-inflammatory cells to treat cancer
US20170281791A1 (en) 2002-03-01 2017-10-05 Immunomedics, Inc. Anti-trop-2 antibody-drug conjugates and uses thereof
WO2017178653A2 (en) 2016-04-14 2017-10-19 Ose Immunotherapeutics NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS
WO2017177333A1 (en) 2016-04-15 2017-10-19 Trillium Therapeutics Inc. Macrophage stimulation in cd47 blockade therapy
US20180037652A1 (en) 2016-08-03 2018-02-08 The Board Of Trustees Of The Leland Stanford Junior University Disrupting FC Receptor Engagement on Macrophages Enhances Efficacy of Anti-SIRPalpha Antibody Therapy
EP3287470A1 (en) 2015-04-24 2018-02-28 Immuneonco Biopharmaceuticals (Shanghai) Co., Ltd Novel recombinant bi-functional fusion protein and preparation and application therefor
WO2018057669A1 (en) 2016-09-21 2018-03-29 Alexo Therapeutics Inc. Antibodies against signal-regulatory protein alpha and methods of use
WO2018081897A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Enhancement of cd47 blockade therapy by proteasome inhibitors
WO2018081898A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Improvements in cd47 blockade therapy by hdac inhibitors
WO2018107058A1 (en) 2016-12-09 2018-06-14 Alector Llc Anti-sirp-alpha antibodies and methods of use thereof
WO2018149938A1 (en) 2017-02-17 2018-08-23 Ose Immunotherapeutics New uses of anti-sirpg antibodies
WO2018176132A1 (en) 2017-03-28 2018-10-04 Trillium Therapeutics Inc. Cd47 blockade therapy
US20180312587A1 (en) 2017-04-13 2018-11-01 Aduro Biotech Holdings, Europe B.V. Anti-sirp alpha antibodies
WO2018210795A1 (en) 2017-05-16 2018-11-22 Synthon Biopharmaceuticals B.V. ANTI-SIRPα ANTIBODIES
CA3063099A1 (en) * 2017-06-21 2018-12-27 The Board Of Trustees Of The Leland Stanford Junior University Dosing parameters for cd47 targeting therapies to hematologic malignancies
US10179171B2 (en) 2002-03-01 2019-01-15 Immunomedics, Inc. RS7 antibodies
WO2019023347A1 (en) 2017-07-26 2019-01-31 Forty Seven, Inc. ANTI-SIRP-ALPHA ANTIBODIES AND ASSOCIATED METHODS
WO2020047326A2 (en) * 2018-08-31 2020-03-05 ALX Oncology Inc. Decoy polypeptides

Family Cites Families (103)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US5697901A (en) 1989-12-14 1997-12-16 Elof Eriksson Gene delivery by microneedle injection
JPH04334377A (ja) 1990-12-31 1992-11-20 Akzo Nv 酸−不安定性リンカー分子
US6613332B1 (en) 1991-06-21 2003-09-02 The University Of Cincinnati Oral administration of therapeutic proteins
DK0590060T3 (da) 1991-06-21 1998-05-11 Univ Cincinnati Oralt indgivelige terapeutiske proteiner samt fremgangsmåde til fremstilling
IL99120A0 (en) 1991-08-07 1992-07-15 Yeda Res & Dev Multimers of the soluble forms of tnf receptors,their preparation and pharmaceutical compositions containing them
US7018809B1 (en) 1991-09-19 2006-03-28 Genentech, Inc. Expression of functional antibody fragments
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
CA2224907A1 (en) 1995-07-25 1997-02-13 Introgene B.V. Methods and means for targeted gene delivery
DE69733815T2 (de) 1996-02-15 2006-06-08 Biosense Webster, Inc., Diamond Bar Sonde zur exkavation
JP2000514440A (ja) 1996-07-09 2000-10-31 ザ ジョーンズ ホプキンス ユニバーシティー 遺伝子輸送システム
US6541615B1 (en) 1996-11-15 2003-04-01 Max-Planck-Gellschaft Zur Foderung Der Wissenschaften E.V. SIRP proteins and uses thereof
CA2226962A1 (en) 1998-02-16 1999-08-16 Marie Sarfati Use of binding agents to cd47 and its ligands in the treatment or the prophylaxis of various inflammatory, autoimmune and allergic diseases and in the treatment of graft rejection
EP1192176A4 (en) 1999-06-11 2003-03-05 Human Genome Sciences Inc 49 HUMAN SECRETED PROTEINS
US6613026B1 (en) 1999-12-08 2003-09-02 Scimed Life Systems, Inc. Lateral needle-less injection apparatus and method
GB9930706D0 (en) 1999-12-24 2000-02-16 Medical Res Council Composition for inhibiting macrophage activity
US7662367B2 (en) 2000-03-02 2010-02-16 Xencor, Inc. Pharmaceutical compositions for the treatment of TNF-α related disorders
TWI334439B (en) 2001-08-01 2010-12-11 Centocor Inc Anti-tnf antibodies, compositions, methods and uses
GB0124145D0 (en) 2001-10-08 2001-11-28 Bayer Ag Genes and proteins for prevention,prediction,prognosis and therapy of cardiovascular disease
US20040018522A1 (en) 2002-05-09 2004-01-29 Brigham And Women's Hospital, Inc. Identification of dysregulated genes in patients with multiple sclerosis
WO2004011618A2 (en) 2002-07-29 2004-02-05 Hmgene, Inc. Methods of identifying adipocyte specific genes, the genes identified, and their uses
US20070010434A1 (en) 2002-09-16 2007-01-11 Genetech, Inc. Novel compositions and methods for the treatment of immune related diseases
EP1900753B1 (en) 2002-11-08 2017-08-09 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
US20100215640A1 (en) 2003-04-24 2010-08-26 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US8613922B2 (en) 2003-04-24 2013-12-24 The University Of North Carolina At Chapel Hill Methods for inhibiting diabetic retinopathy with an antibody against integrin associated protein (IAP)
US20040213792A1 (en) 2003-04-24 2004-10-28 Clemmons David R. Method for inhibiting cellular activation by insulin-like growth factor-1
AU2003264100A1 (en) 2003-08-25 2005-03-10 Pieris Proteolab Ag Muteins of a bilin-binding protein with affinity for a given target
AU2005220156B2 (en) 2004-02-27 2011-06-02 Vaxconsulting Peptides of IL1 beta and TNF alpha and method of treatment using same
WO2005092362A2 (de) 2004-03-29 2005-10-06 Hallstroem Seth Pharmazeutisches kombinationspräparat enthaltend ein therapeutisches protein
US20080299042A1 (en) 2004-04-30 2008-12-04 Biogen Idec Ma Inc. Membrane Associated Molecules
US7514229B2 (en) 2005-09-29 2009-04-07 The Board Of Trustees Of The Leland Stanford Junior University Methods for diagnosing and evaluating treatment of blood disorders
AR060017A1 (es) 2006-01-13 2008-05-21 Novartis Ag Composiciones y metodos de uso para anticuerpos de dickkopf -1
US8377448B2 (en) 2006-05-15 2013-02-19 The Board Of Trustees Of The Leland Standford Junior University CD47 related compositions and methods for treating immunological diseases and disorders
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
AR066240A1 (es) 2007-04-23 2009-08-05 Wyeth Corp Metodos y composiciones para tratar y monitorear el tratamiento de trastornos asociados con il-13
US20090304719A1 (en) 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
EP2573112A1 (en) 2007-10-11 2013-03-27 The Hospital For Sick Children Modulation of sirpa - cd47 interaction for increasing human hematopoietic stem cell engraftment and compounds therefor
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
ES2582340T3 (es) 2008-01-15 2016-09-12 The Board Of Trustees Of The Leland Stanford Junior University Métodos para manipular fagocitosis mediada por CD47
EP2111869A1 (en) 2008-04-23 2009-10-28 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
WO2010070047A1 (en) 2008-12-19 2010-06-24 Novartis Ag Soluble polypeptides for use in treating autoimmune and inflammatory disorders
RU2636046C2 (ru) 2009-01-12 2017-11-17 Сайтомкс Терапьютикс, Инк Композиции модифицированных антител, способы их получения и применения
AU2010215761B2 (en) 2009-02-23 2017-04-06 Cytomx Therapeutics, Inc Proproteins and methods of use thereof
HRP20150553T1 (hr) 2009-05-15 2015-08-28 University Health Network Sastavi i metode za lijeäśenje hematoloških maligniteta ciljajuä†i sirp - cd47 interakciju
KR20120097481A (ko) 2009-07-20 2012-09-04 내셔날 쳉쿵 유니버시티 사람 혈청 알부민(HSA)의 변이체와 컨쥬게이션된 αvβ3 인테그린에 대해 선택적인 폴리펩타이드 및 이의 약제학적 용도
KR101632312B1 (ko) 2009-11-03 2016-06-21 삼성전자주식회사 항체 불변 영역에 특이적으로 결합하는 융합 단백질, 그의 제조 방법 및 이를 이용한 항체 분리 방법
US8961967B2 (en) 2009-11-30 2015-02-24 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
BR112012017164A2 (pt) 2009-12-22 2019-09-24 Novartis Ag proteína de fusão de região constante de anticorpo-cd47 tetravalente
PT2569013T (pt) 2010-05-14 2017-02-08 Univ Leland Stanford Junior Anticorpos monoclonais humanizados e quiméricos para cd47
JP6157352B2 (ja) 2010-10-08 2017-07-05 シティ・オブ・ホープCity of Hope メディトープ(Meditope)のためのモノクローナル抗体フレームワーク結合インターフェース、メディトープ送達系、およびその使用法
US8609621B2 (en) 2010-11-15 2013-12-17 E I Du Pont De Nemours And Company Acid-cleavable linkers exhibiting altered rates of acid hydrolysis
WO2012109267A2 (en) 2011-02-07 2012-08-16 The Trustees Of The University Of Pennsylvania Novel peptides and methods using same
ES2692268T5 (en) 2011-03-29 2025-02-26 Roche Glycart Ag Antibody fc variants
EP3415528B1 (en) 2011-04-13 2021-05-26 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP2699596A4 (en) 2011-04-22 2015-01-14 Emergent Product Dev Seattle PROSTATE-SPECIFIC MEMBRANE-BINDING PROTEINS AND COMPOSITIONS AND METHOD THEREFOR
BR112013031762A2 (pt) 2011-06-16 2016-09-13 Novartis Ag proteínas solúveis para utilização como terapêuticos
WO2013056352A1 (en) 2011-10-19 2013-04-25 University Health Network Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers
WO2013063076A1 (en) 2011-10-25 2013-05-02 Indiana University Research & Technology Corporation Compositions for and methods of modulating complications, risks and issues with xenotransplantation
US9428553B2 (en) 2012-02-10 2016-08-30 City Of Hope Meditopes and meditope-binding antibodies and uses thereof
US9856314B2 (en) 2012-06-22 2018-01-02 Cytomx Therapeutics, Inc. Activatable antibodies having non-binding steric moieties and methods of using the same
EP2863948B1 (en) 2012-06-22 2018-10-24 Cytomx Therapeutics Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
GB201216649D0 (en) 2012-09-18 2012-10-31 Univ Birmingham Agents and methods
WO2014121093A1 (en) 2013-01-31 2014-08-07 Thomas Jefferson University Fusion proteins that facilitate cancer cell destruction
EP2953633B1 (en) 2013-02-05 2017-10-04 The Board of Trustees of the Leland Stanford Junior University Cd47 targeted therapies for the treatment of infectious disease
AU2014244083B2 (en) 2013-03-13 2018-09-27 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods for modulating chemotherapeutic cytotoxicity
CN112245586A (zh) 2013-03-15 2021-01-22 小利兰·斯坦福大学托管委员会 用于实现治疗有效剂量的抗cd47剂的方法
JP6843611B2 (ja) 2013-04-29 2021-03-17 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー 免疫を強化する抗cd47因子の使用
US9945870B2 (en) 2013-05-17 2018-04-17 The Board Of Trustees Of The Leland Stanford Junior University Methods for determining responsiveness to an anti-CD47 agent
CA2919076C (en) 2013-07-31 2024-01-30 Amgen Inc. Stabilization of fc-containing polypeptides
EP3046627B1 (en) 2013-09-18 2019-10-23 The Board of Trustees of the Leland Stanford Junior University Modulation of efferocytosis pathways for treatment of atherosclerotic disease
TR201901782T4 (tr) 2013-09-23 2019-03-21 Regeneron Pharma İnsanlaştirilmiş bi̇r si̇nyal düzenleyi̇ci̇ protei̇n geni̇ne sahi̇p olan i̇nsan dişi hayvanlar.
NZ718283A (en) 2013-09-25 2022-05-27 Cytomx Therapeutics Inc Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
CN105829349B (zh) 2013-10-15 2023-02-03 斯克利普斯研究所 肽嵌合抗原受体t细胞开关和其用途
US9562073B2 (en) 2014-01-31 2017-02-07 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
CA2942245C (en) 2014-03-12 2021-11-02 Yeda Research And Development Co. Ltd. Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US10519237B2 (en) 2014-03-12 2019-12-31 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of disease and injury of the CNS
US9394365B1 (en) 2014-03-12 2016-07-19 Yeda Research And Development Co., Ltd Reducing systemic regulatory T cell levels or activity for treatment of alzheimer's disease
WO2016023001A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Multispecific high affinity pd-1 agents and methods of use
WO2016022971A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Sirp alpha-antibody fusion proteins
PT3177640T (pt) 2014-08-08 2020-08-31 Univ Leland Stanford Junior Agentes pd-1 de alta afinidade e métodos de utilização
PL3180363T3 (pl) 2014-08-15 2020-02-28 Merck Patent Gmbh Białka fuzyjne immunoglobulin sirp-alfa
EP4257145B1 (en) 2014-08-26 2025-06-25 The Board of Trustees of the Leland Stanford Junior University Engraftment of stem cells with a combination of an agent that targets stem cells and modulation of immunoregulatory signaling
US10822411B2 (en) 2014-09-15 2020-11-03 The Board Of Trustees Of The Leland Stanford Junior University Targeting aneurysm disease by modulating phagocytosis pathways
EP3204420B1 (en) 2014-10-10 2020-09-02 The United States of America, as represented by The Secretary, Department of Health and Human Services Methods to eliminate cancer stem cells by targeting cd47
CA2959821C (en) 2014-10-24 2024-10-29 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for inducing phagocytosis of MHC class I positive cells and for overcoming resistance to anti-CD47 agents/SIRPA
EP3212670B1 (en) 2014-10-29 2020-12-23 Five Prime Therapeutics, Inc. Combination therapy for cancer
EP3221358B1 (en) 2014-11-18 2021-07-21 Janssen Pharmaceutica, N.V. Cd47 antibodies, methods, and uses
WO2016138306A1 (en) 2015-02-27 2016-09-01 The Board Of Trustees Of The Leland Stanford Junior University Combination therapy for treatment of coronary artery disease
EA034582B1 (ru) 2015-08-07 2020-02-21 АЭлЭкс ОНКОЛОДЖИ ИНК. Конструкции варианта sirp-альфа и их применение
AU2016310348B2 (en) 2015-08-26 2023-01-05 The Board Of Trustees Of The Leland Stanford Junior University Enhanced depletion of targeted cells with CD47 blockade and an immune costimulatory agonist
US10613092B2 (en) 2016-04-01 2020-04-07 Agilent Technologies, Inc. Scoring methods for anti-PD therapy eligibility and compositions for performing same
CA3038712A1 (en) 2016-10-06 2018-04-12 Genentech, Inc. Therapeutic and diagnostic methods for cancer
CN111699005A (zh) 2018-02-12 2020-09-22 四十七公司 使用抗cd47抗体和抗cd20抗体的抗癌方案
CN114126648A (zh) 2019-05-31 2022-03-01 Alx肿瘤生物技术公司 用SIRPα Fc融合体组合免疫检查点抑制剂治疗癌症的方法
US20200400662A1 (en) 2019-06-07 2020-12-24 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
CN121243368A (zh) 2019-11-27 2026-01-02 Alx肿瘤生物技术公司 用于治疗癌症的组合疗法
KR20230018475A (ko) 2020-06-01 2023-02-07 알렉소 온콜로지 인크. 암 치료용 저메틸화제를 포함하는 병용 요법
WO2022010806A1 (en) 2020-07-06 2022-01-13 ALX Oncology Inc. Methods for reducing the interference of drugs that bind therapeutic targets expressed on blood cells in serological assays
US20220196651A1 (en) 2020-12-06 2022-06-23 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
JP2024520902A (ja) 2021-05-13 2024-05-27 エーエルエックス オンコロジー インコーポレイテッド がんを治療するための併用療法
US20240010701A1 (en) 2022-06-01 2024-01-11 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma

Patent Citations (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170281791A1 (en) 2002-03-01 2017-10-05 Immunomedics, Inc. Anti-trop-2 antibody-drug conjugates and uses thereof
US10179171B2 (en) 2002-03-01 2019-01-15 Immunomedics, Inc. RS7 antibodies
US20150071905A1 (en) 2012-01-17 2015-03-12 The Board Of Trustees Of The Leland Stanford Junior University High Affinity Sirp-Alpha Reagents
US9944911B2 (en) 2012-01-17 2018-04-17 The Board Of Trustees Of The Leland Stanford Junior University High affinity Sirp-alpha reagents and methods of using
WO2013109752A1 (en) 2012-01-17 2013-07-25 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents
WO2014094122A1 (en) 2012-12-17 2014-06-26 Trillium Therapeutics Inc. Treatment of cd47+ disease cells with sirp alpha-fc fusions
US20150329616A1 (en) 2012-12-17 2015-11-19 Trillium Therapeutics Inc. Treatment of CD47+ Disease Cells with SIRP Alpha-FC Fusions
US20180312563A1 (en) 2012-12-17 2018-11-01 Trillium Therapeutics Inc. Treatment of CD47+ Disease Cells with SIRP Alpha-FC Fusions
WO2016023040A1 (en) 2014-08-08 2016-02-11 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
WO2016063233A1 (en) 2014-10-24 2016-04-28 Effimune Method and compositions for inducing differentiation of myeloid derived suppressor cell to treat cancer and infectious diseases
EP3287470A1 (en) 2015-04-24 2018-02-28 Immuneonco Biopharmaceuticals (Shanghai) Co., Ltd Novel recombinant bi-functional fusion protein and preparation and application therefor
US20180141986A1 (en) 2015-04-24 2018-05-24 Immuneonco Biopharmaceuticals (Shanghai) Co.,Ltd Novel recombinant bi-functional fusion protein and preparation and application therefor
US9845345B2 (en) 2015-05-18 2017-12-19 Ab Initio Biotherapeutics, Inc. SIRP polypeptide compositions and methods of use
WO2016187226A1 (en) 2015-05-18 2016-11-24 Ab Initio Biotherapeutics, Inc. Sirp polypeptide compositions and methods of use
US20180155405A1 (en) 2015-05-18 2018-06-07 Ab Initio Biotherapeutics, Inc. Sirp polypeptide compositions and methods of use
US20170107270A1 (en) 2015-08-07 2017-04-20 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
US10259859B2 (en) 2015-08-07 2019-04-16 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
WO2017068164A1 (en) 2015-10-21 2017-04-27 Ose Immunotherapeutics Methods and compositions for modifying macrophage polarization into pro-inflammatory cells to treat cancer
WO2017178653A2 (en) 2016-04-14 2017-10-19 Ose Immunotherapeutics NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS
WO2017177333A1 (en) 2016-04-15 2017-10-19 Trillium Therapeutics Inc. Macrophage stimulation in cd47 blockade therapy
US20180037652A1 (en) 2016-08-03 2018-02-08 The Board Of Trustees Of The Leland Stanford Junior University Disrupting FC Receptor Engagement on Macrophages Enhances Efficacy of Anti-SIRPalpha Antibody Therapy
WO2018057669A1 (en) 2016-09-21 2018-03-29 Alexo Therapeutics Inc. Antibodies against signal-regulatory protein alpha and methods of use
US20180105600A1 (en) 2016-09-21 2018-04-19 Alexo Therapeutics Inc. Antibodies against signal-regulatory protein alpha and methods of use
WO2018081898A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Improvements in cd47 blockade therapy by hdac inhibitors
WO2018081897A1 (en) 2016-11-03 2018-05-11 Trillium Therapeutics Inc. Enhancement of cd47 blockade therapy by proteasome inhibitors
WO2018107058A1 (en) 2016-12-09 2018-06-14 Alector Llc Anti-sirp-alpha antibodies and methods of use thereof
WO2018149938A1 (en) 2017-02-17 2018-08-23 Ose Immunotherapeutics New uses of anti-sirpg antibodies
WO2018176132A1 (en) 2017-03-28 2018-10-04 Trillium Therapeutics Inc. Cd47 blockade therapy
US20180312587A1 (en) 2017-04-13 2018-11-01 Aduro Biotech Holdings, Europe B.V. Anti-sirp alpha antibodies
WO2018210795A1 (en) 2017-05-16 2018-11-22 Synthon Biopharmaceuticals B.V. ANTI-SIRPα ANTIBODIES
CA3063099A1 (en) * 2017-06-21 2018-12-27 The Board Of Trustees Of The Leland Stanford Junior University Dosing parameters for cd47 targeting therapies to hematologic malignancies
WO2019023347A1 (en) 2017-07-26 2019-01-31 Forty Seven, Inc. ANTI-SIRP-ALPHA ANTIBODIES AND ASSOCIATED METHODS
WO2020047326A2 (en) * 2018-08-31 2020-03-05 ALX Oncology Inc. Decoy polypeptides

Non-Patent Citations (32)

* Cited by examiner, † Cited by third party
Title
CAS , no. 1374853-91-4
CASARA ET AL., ONCOTARGET, vol. 9, no. 28, 2008, pages 29975 - 20088
CHAO ET AL., BLOOD, vol. 118, 2011, pages 4890 - 4891
CHAO ET AL., CELL, vol. 142, 2010, pages 699 - 713
CHOW ET AL., JOURNAL OF CLINICAL ONCOLOGY, vol. 38, 2020, pages 3056 - 3056
EDRIS ET AL., PNAS USA, vol. 109, 2012, pages 6656 - 61
GABRILOVICH ET AL., NAT REV IMMUNOL, vol. 12, no. 4, 2012, pages 253 - 68
GOTO ET AL., EUR J. CANCER, vol. 50, 2014, pages 1836 - 1846
HUSAIN ET AL., BIODMGS, vol. 32, no. 5, 2018, pages 441 - 464
KABAT: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE
KAUDER ET AL., PLOS ONE, vol. 13, no. 8, 2018, pages e0201832
KIM ET AL., LEUKEMIA, vol. 26, 2012, pages 2538 - 2545
LIU ET AL., NATURE MEDICINE, vol. 21, no. 1, 2015, pages 1
MILLER ET AL.: "Quantitative high-throughput screening assays for the discovery and development of SIRP(L-CD47 interaction inhibitors", PLOS ONE, vol. 14, no. 7, 2019, pages e0218897, XP055654017, DOI: 10.1371/journal.pone.0218897
MOSELY ET AL.: "Rational Selection of Syngeneic Preclinical Tumor Models for Immunotherapeutic Drug Discovery", CANCER IMMUNOL RES, vol. 5, no. 1, 2016, pages 29 - 41
MURATA ET AL., CANCER SCI, vol. 109, no. 5, 2018, pages 1300 - 1308
OLDENBORG, ISRN HEMATOL, vol. 614619, 2013
PETROVA ET AL., CLIN CANCER RES, vol. 23, 2017, pages 1086 - 1079
POKLAR ET AL., PROC. NAIL. ACAD. SCI. U.S.A., vol. 93, no. 15, 1996, pages 7606 - 11
RING ET AL., PNAS USA, vol. 114, no. 49, 2017, pages E10578 - E10585
RUDDET, CANCER CHEMOTHER. PHARMACOL., vol. 35, no. 4, 1995, pages 323 - 6
RUSS ET AL., BLOOD REV, no. 17, 2018, pages 30093 - 0
SASIKUMAR ET AL., ACR-NCI-EORTC INTERNATIONAL CONFERENCE: MOLECULAR TARGETS AND CANCER THERAPEUTICS, 26 October 2017 (2017-10-26)
SOTO-PANTQJA, CANCER RESEARCH, vol. 74, no. 23, 2014, pages 6771 - 83
SPIESS ET AL., MOLECULAR IMMUNOLOGY, vol. 67, no. 2, 2015, pages 95 - 106
STONG ET AL., BLOOD, vol. 65, no. 1, 1985, pages 21 - 31
TSE, CANCER RES, vol. 68, no. 9, 2008, pages 3421 - 3429
TSENG D ET AL., PROC NATL ACAD SCI USA., vol. 110, no. 27, 2013, pages 11103 - 11108
WANG ET AL., J. IMMUNOL., vol. 154, 1995, pages 4685 - 4692
YANIGATA ET AL., JCI INSIGHT, vol. 2, 2017, pages e89140
ZHANG, XCHEN, WFAN, J ET AL.: "Disrupting CD47-SIRPa axis alone or combined with autophagy depletion for the therapy of glioblastoma", CARCINOGENESIS, vol. 39, 2018, pages 689 - 99, XP055672618, DOI: 10.1093/carcin/bgy041
ZHAO ET AL., PNAS USA, vol. 108, 2011, pages 18342 - 18347

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US11639376B2 (en) 2015-08-07 2023-05-02 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
WO2023043269A1 (ko) * 2021-09-17 2023-03-23 주식회사 엘베이스 면역반응을 조절하기 위한 약학적 조성물
WO2023073580A1 (en) * 2021-10-29 2023-05-04 Pfizer Inc. Enhancement of cd47 blockade with taxanes for cd47+ cancer therapy
WO2023183817A1 (en) * 2022-03-24 2023-09-28 Gilead Sciences, Inc. Combination therapy for treating trop-2 expressing cancers
TWI895708B (zh) * 2022-03-24 2025-09-01 美商基利科學股份有限公司 用於治療trop-2表現性癌症之組合療法
WO2023235754A1 (en) * 2022-06-01 2023-12-07 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma

Also Published As

Publication number Publication date
JP2025118648A (ja) 2025-08-13
CN114845710A (zh) 2022-08-02
EP4065101A1 (en) 2022-10-05
US20230218719A1 (en) 2023-07-13
US20240075101A1 (en) 2024-03-07
MX2022006078A (es) 2022-08-02
JP2023503943A (ja) 2023-02-01
KR20220107223A (ko) 2022-08-02
IL293199A (en) 2022-07-01
JP7713447B2 (ja) 2025-07-25
CA3162633A1 (en) 2021-06-03
US12527838B2 (en) 2026-01-20
BR112022008817A2 (pt) 2022-07-26
AU2020394204A1 (en) 2022-06-02
US20210154269A1 (en) 2021-05-27
CN121243368A (zh) 2026-01-02

Similar Documents

Publication Publication Date Title
US12527838B2 (en) Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US11407801B2 (en) SIRP-gamma polypeptide compositions and treatment of cancer
US12098214B2 (en) Combination therapies for treating cancer
US20250296986A1 (en) Engineered polypeptides
AU2021397271A9 (en) Targeted cytokine construct for engineered cell therapy
CN111867612A (zh) 抗PDL1、IL-15和TGF-β受体组合分子
CN110799528A (zh) 基于多聚体il-15的分子
EP3843772A2 (en) Decoy polypeptides
CN117279633A (zh) 用于治疗癌症的组合疗法
WO2024196798A1 (en) Fusion protein and uses thereof
HK1252870B (zh) Sirp多肽组合物和使用方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20825371

Country of ref document: EP

Kind code of ref document: A1

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022008817

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022530167

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3162633

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020394204

Country of ref document: AU

Date of ref document: 20201125

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227021105

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020825371

Country of ref document: EP

Effective date: 20220627

ENP Entry into the national phase

Ref document number: 112022008817

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220506