WO2021034179A1 - Fam86a를 이용한 멜라닌 형성 검출 방법 - Google Patents

Fam86a를 이용한 멜라닌 형성 검출 방법 Download PDF

Info

Publication number
WO2021034179A1
WO2021034179A1 PCT/KR2020/095119 KR2020095119W WO2021034179A1 WO 2021034179 A1 WO2021034179 A1 WO 2021034179A1 KR 2020095119 W KR2020095119 W KR 2020095119W WO 2021034179 A1 WO2021034179 A1 WO 2021034179A1
Authority
WO
WIPO (PCT)
Prior art keywords
fam86a
protein
melanin
composition
mrna
Prior art date
Application number
PCT/KR2020/095119
Other languages
English (en)
French (fr)
Inventor
조재열
홍요한
박상희
Original Assignee
성균관대학교산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020200101716A external-priority patent/KR102372647B1/ko
Priority claimed from KR1020200101715A external-priority patent/KR102531515B1/ko
Application filed by 성균관대학교산학협력단 filed Critical 성균관대학교산학협력단
Priority to US17/635,294 priority Critical patent/US20220334130A1/en
Publication of WO2021034179A1 publication Critical patent/WO2021034179A1/ko

Links

Images

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6881—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids from skin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/13—Nucleic acids or derivatives thereof
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/40—Complete food formulations for specific consumer groups or specific purposes, e.g. infant formula
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00—Preparations for care of the skin
    • A61Q19/02—Preparations for care of the skin for chemically bleaching or whitening the skin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q5/00—Preparations for care of the hair
    • A61Q5/10—Preparations for permanently dyeing the hair
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y201/00—Transferases transferring one-carbon groups (2.1)
    • C12Y201/01—Methyltransferases (2.1.1)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/14—Type of nucleic acid interfering N.A.
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/14—Type of nucleic acid interfering N.A.
    • C12N2310/141—MicroRNAs, miRNAs
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/50—Physical structure
    • C12N2310/53—Physical structure partially self-complementary or closed
    • C12N2310/531—Stem-loop; Hairpin
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00—Oligonucleotides characterized by their use
    • C12Q2600/158—Expression markers
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/91—Transferases (2.)
    • G01N2333/91005—Transferases (2.) transferring one-carbon groups (2.1)
    • G01N2333/91011—Methyltransferases (general) (2.1.1.)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/20—Dermatological disorders
    • G01N2800/207—Pigmentation disorders

Definitions

  • the present invention relates to a method for detecting melanin formation using FAM86A.
  • the melanin pigment determines the skin color and absorbs ultraviolet rays to protect the skin.
  • the melanin pigment consists of an amino acid called tyrosine, which is activated by an enzyme called tyrosinae.
  • Tyrosine is synthesized into two types of melanin, pheomelanin or eumelanin, depending on the conversion process. Piomelanin is yellow to red, and eumelanin is a brown to black pigment, mainly in Asians. can see.
  • Melanocytes that produce melanin pigments are derived from melanoblasts.
  • melanoblast When melanoblast is stimulated to differentiate into melanocytes, tyrosinase is activated to change the tyrosine contained in the cell to DOPA (3,4-dihydroxy-L-phenyl-alanine), and then DOPA is dopaoxidase ( By the action of an enzyme called dopaoxidase), it is transformed into a substance called dopaquinone and then synthesized into melanin. After making melanin, melanocytes move to the epidermal tissue in the upper layer of the skin, and deliver the melanin to keratinocytes present in the epidermal tissue.
  • DOPA dopaoxidase
  • melanin pigment is stored and transported in melanosomes, but it has no color at the beginning of its production, and then gradually moves to the upper layer, filling with black pigment over 4-5 steps, and finally becoming fully pigmented mature melanin granules.
  • ⁇ -melanocyte-stimulating hormone is very important for melanin production.
  • ⁇ -MSH is composed of the amino acid sequence of Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH 2 , melanocortin 1 receptor (melanocortin 1 receptor, MC1-R).
  • MC1-R melanocortin 1 receptor
  • MC1-R activates adenyl cyclase, increases cAMP, and activates PKA, and PKA is a cAMP-responsive element binding protein transcription factor. factor) to finally activate microphthalmia-associated transcription factor (MITF).
  • MITF microphthalmia-associated transcription factor
  • MITF is also activated by the Wnt, GSK3 ⁇ , and MAPK signaling systems, and in response to various stimuli, tyrosinase (TYR), tyrosinase-related protein 1 (TYRP1), dopacrom tauto It regulates the expression level of enzymes related to melanin biosynthesis, such as merase (dopachrome tautomerase, DCT; also called tyrosinase-related protein 2, TRP2).
  • DCT dopacrom tautomerase
  • melanin produced by the action of various enzymes such as tyrosinase from melanocytes in the human body. If more melanin is produced than necessary, hyperpigmentation such as spots, freckles and spots It will cause a cosmetic result that is not good. And melanin generated by stressful stimuli inside and outside the skin does not disappear until it is discharged to the outside through skin keratinization even if the stress disappears.
  • vitiligo is an acquired depigmentation disease in which white spots of various sizes and shapes appear on the skin due to the death or necrosis of melanocytes. It is a relatively common disease that occurs in about 1% of the world's population, and does not differ by race or region. The age of onset is most common between 10 and 30 years of age, 95% of cases develop before 40 years of age, and 30% of patients have a family history. As a clinical manifestation of vitiligo, round or irregular white spots of various sizes appear, the degree of discoloration is not clear at first, but often becomes more pronounced over time, and the boundary with normal skin may not be clear, but normal skin color. It can appear darker and more distinct. In rare cases, you may feel itchy.
  • Vitiligo can occur anywhere on the skin, but especially in areas where bones protrude such as fingers, toes, knees, and elbows, around the mouth, around the nose, around the eyes, underarms, and inside the wrists. It can also come to the mucous membranes such as the lips or genitals, and it occurs particularly well in areas that are frequently hurt.
  • the distribution of vitiligo is symmetrical, or it may be distributed according to the nerves.
  • Vitiligo can be accompanied by pigmentation abnormalities in the iris and retina of the eye, in addition to simply appearing white spots on the skin, diabetes, pernicious anemia, hypothyroidism or hyperactivity, Down syndrome, biliary cirrhosis, gastric cancer, Adison's disease, alopecia areata. , It can be associated with autoimmune diseases such as lupus erythematosus. Although the cause of vitiligo has not been accurately identified yet, various theories have been suggested, such as autoimmune theory, stress, viral hypothesis, neuronal humoral hypothesis, and melanocyte self-destruction theory. In addition, various factors such as inherited cellular defects, genetic factors, apoptosis, and abnormal calcium metabolism have been suggested.
  • Vitiligo requires continuous treatment with steroids or ultraviolet rays because the lesions worsen in most patients without treatment.
  • steroids or ultraviolet rays because the lesions worsen in most patients without treatment.
  • a more effective treatment method is urgently required.
  • the technical problem to be achieved by the present invention is to provide a composition for detecting melanin formation and a method for screening skin whitening substances.
  • the present inventors confirmed that the FAM86A protein is inversely proportional to the amount of melanin produced, thereby detecting melanin formation using FAM86A, and , It was confirmed that whitening-related substances can be screened, and by inhibiting FAM86A, it can exhibit the treatment and improvement effect of melanin-deficient diseases such as vitiligo, and it is confirmed that melanin formation can be reduced by overexpressing FAM86A.
  • composition for detecting melanin formation comprising an agent for measuring the protein of FAM86A or its mRNA expression level.
  • Another object of the present invention is to provide a kit for detecting melanin formation comprising an agent for measuring the expression level of the protein of FAM86A or its mRNA.
  • Another object of the present invention is to provide a method for screening skin whitening substances comprising the following steps.
  • Another object of the present invention is to provide a composition for skin whitening comprising the FAM86A protein, its agonist or its activator as an active ingredient.
  • Another object of the present invention is to provide a composition for the prevention or treatment of pigmented disorders comprising the FAM86A protein, its agonist or its activator as an active ingredient.
  • Another object of the present invention is to provide a composition for preventing, treating, or improving melanin deficiency disease comprising a FAM86A inhibitor as an active ingredient.
  • Another object of the present invention is to provide a method for screening a melanin deficiency disease prevention or treatment comprising the following steps.
  • the present invention provides a composition for detecting melanin formation, including an agent for measuring the protein of FAM86A or its mRNA expression level; The use of an agent for measuring the protein or mRNA expression level of FAM86A to detect melanin formation; And it provides a kit for detecting melanin formation comprising an agent for measuring the expression level of the protein of FAM86A or its mRNA.
  • the present invention provides a method for screening skin whitening substances comprising the following steps.
  • the present invention provides a composition for diagnosing pigment-related skin conditions, including an agent for measuring the protein of FAM86A or mRNA expression level thereof.
  • the present invention provides a kit for diagnosing pigment-related skin conditions, including an agent for measuring the expression level of protein of FAM86A or mRNA thereof.
  • the present invention is a composition for skin whitening comprising the FAM86A protein, its agonist or its activator as an active ingredient;
  • a method of whitening skin comprising administering to the subject a composition comprising the FAM86A protein, an agonist thereof or an activator thereof; Skin whitening use of a composition comprising the FAM86A protein, an agonist thereof or an activator thereof; And the use of the FAM86A protein, an agonist thereof, or an activator thereof for preparing a skin whitening formulation.
  • the present invention is a pharmaceutical composition for the prevention or treatment of pigmentation disorders comprising the FAM86A protein, its agonist or its activator as an active ingredient;
  • a method of preventing or treating pigmented disorders comprising administering to the subject a composition comprising the FAM86A protein, an agonist thereof or an activator thereof;
  • the use of the FAM86A protein, an agonist thereof, or an activator thereof for the manufacture of a pigmented disease agent.
  • the agent for measuring the expression level of the mRNA may be a probe or primer that specifically binds to the mRNA of FAM86A.
  • the agent for measuring the expression level of the protein may be an antibody or aptamer specific for the protein of FAM86A.
  • the mRNA of FAM86A may include or consist of the nucleotide sequence represented by SEQ ID NO: 6, but is not limited thereto.
  • the protein of FAM86A may include or consist of an amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto.
  • the agonist or activator may be one or more selected from the group consisting of an expression vector containing the FAM86A gene, a cell containing the vector, a compound, and a peptide, but is not limited thereto.
  • the pigmentation disorder is pigmentation, melasma, freckles, blemishes, spots, spots, ovarian spots, cyanic melasma, gestational brown spots (gravidic chloasma), taking oral contraceptives It may be one or more selected from the group consisting of melanoma, age spots, senile blackness, wounds, hyperpigmentation after inflammation due to dermatitis, and melanin dermatosis, but is not limited thereto.
  • the present invention is a composition for preventing, treating, or improving melanin deficiency disease comprising a FAM86A inhibitor as an active ingredient; A method of preventing or treating melanin deficiency disease by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual; Use of a composition comprising a FAM86A inhibitor as an active ingredient to prevent or treat melanin deficiency disease; And a FAM86A inhibitor for the manufacture of a medicament for the prevention or treatment of melanin deficiency disease.
  • the composition is not limited thereto, but may be provided in the form of a pharmaceutical composition, a food composition, or a cosmetic composition.
  • the food composition may be a health functional food composition, but is not limited thereto.
  • the melanin deficiency disease is leukoderma, vitiligo, quadrichrome vitiligo, vitiligo ponctue, and syndromic albinism (such as , Alezzandrini syndrome, Hermansky-Pudlak syndrome, Chediak-Higashi syndrome, Griscelli syndrome (Elejalde syndrome) , Griscelli syndrome type 2 and Griscelli syndrome type 3, Wardenburg syndrome, Tietz syndrome, CrossMuKusick syndrome -Breen syndrome), ABCD syndrome, Albinism-deafness syndrome and Vogt-Koyanagi-Harada syndrome], oculocutaneous albinism, Canities, hypomelanosis (idiopathic guttate hypomelanosis), phyloid hypomelanosis, progressive macular hypomelanosis], piebaldism , Nevus depigmentosus, postinflammatory hypopigmentation, pityriasis albinism (such as ,
  • the composition may be to promote the synthesis or secretion of melanin.
  • the inhibitor may be an inhibitor of FAM86A activity or an inhibitor of expression.
  • the activity inhibitor may be one or more selected from the group consisting of compounds, peptides, peptidomimetics, matrix analogs, aptamers, and antibodies that specifically bind to the FAM86A protein.
  • the expression inhibitor may be one or more selected from the group consisting of antisense nucleotides, RNAi, siRNA, miRNA, shRNA, and ribozymes that complement the mRNA of the FAM86A gene.
  • the shRNA may be represented by one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 11 to SEQ ID NO: 20.
  • the shRNA may target one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 21 to SEQ ID NO: 30.
  • the miRNA may be represented by one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 40 to SEQ ID NO: 45.
  • the present invention provides a screening method for a melanin deficiency disease prevention or treatment comprising the following steps.
  • the present invention is a composition for promoting melanogenesis comprising a FAM86A inhibitor as an active ingredient; A method of promoting melanin production by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual; Use of a composition comprising a FAM86A inhibitor as an active ingredient to promote melanogenesis; And the use of a FAM86A inhibitor to prepare a melanogenesis promoter.
  • the melanin production promotion may be for one or more selected from the group consisting of white hair prevention, black hair induction promotion, and individual color adjustment, but is not limited thereto.
  • the present invention is a composition for promoting black hair induction comprising a FAM86A inhibitor as an active ingredient; A method of preventing white hair or promoting black hair induction by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual; Use of a composition comprising a FAM86A inhibitor as an active ingredient to prevent white hair or promote black hair induction; And a FAM86A inhibitor for producing an anti-white hair agent or a black hair induction promoter.
  • the present invention is a composition for controlling the color of an individual comprising a FAM86A inhibitor as an active ingredient; A method of controlling the color of the subject by administering a composition containing the FAM86A inhibitor as an active ingredient to the subject; Use of a composition comprising a FAM86A inhibitor as an active ingredient to control the color of a subject; And the use of a FAM86A inhibitor to prepare a color modifier in a subject.
  • the level of FAM86A of the present invention decreases with an increase in the amount of melanin secretion or formation, skin whitening is possible using the FAM86A protein or its agonist, and melanin formation and secretion are promoted when FAM86A is inhibited, and melanin-deficient diseases such as vitiligo It is possible to prevent, treat, or improve. Therefore, it is expected that it can be used in various ways, such as a composition for skin whitening using a FAM86A protein or an agonist, and a composition for the prevention and treatment of melanin deficiency diseases including vitiligo and alopecia using a FAM86A inhibitor.
  • Figure 2 shows the results of confirming the expression level of FAM86A in the back tissue of ICR (white-albino) mice and C57BL/6 (black) mice through western blotting analysis.
  • FIG. 3 shows the results of confirming the expression level of FAM86A in the tissues of black hair (between ears and ears) and white hair skin (behind ears) of C57BL/6 mice through Western blotting analysis.
  • Figure 4 shows the result of confirming the expression level of FAM86A protein by western blotting analysis after treatment with ⁇ -MSH inducing melanin formation using mouse melanoma cells (top), the result of confirming the amount of melanin production through melanin contents assay Is shown (bottom).
  • Figure 5 shows the expression levels of genes (Tyrosinase, TYRP-1, TYRP-2, MITF) and FAM86A genes involved in melanogenesis after treatment with a-MSH that induces melanin formation using mouse melanoma cells. This is the result confirmed using time PCR.
  • cAMP a protein important for melanin formation
  • 9 is a result of confirming the amount of melanin production through a melanin secretion assay after overexpressing FAM86A in mouse melanoma cells.
  • 11 is a result of measuring the expression levels of MAPK and MC1R signaling pathway proteins MC1R, p-CREB, and MITF through Western blot after overexpressing FAM86A in mouse melanoma cells.
  • 13 is a result of confirming the amount of melanin secretion through a melanin secretion assay by knocking down FAM86A in mouse melanoma cells using shRNA and then treating ⁇ -MSH to promote melanin formation.
  • 15 is a result of confirming the amount of melanin secretion through a melanin secretion assay after knocking down FAM86A using shRNA in mouse melanoma cells.
  • FIG. 16 shows FAM86A knockdown using shRNA in mouse melanoma cells, and then FAM86A K/D levels and MAPK & MC1R signaling pathway proteins related to melanin formation through western blotting analysis, ERK, JNK, p38, PKA, CREB, This is the result of confirming the expression levels of MITF and Tyrosinase.
  • FIG. 17 is a result of confirming the presence of melanin through a microscope by knocking down FAM86A in mouse melanoma cells using shRNA and then staining melanin through Fontana Mason staining.
  • Figure 18 is a result of measuring the expression level of genes (Tyrosinase, TYRP-1, TYRP-2, MITF) pivotal to melanin formation using a real-time PCR method after knockdown of FAM86A using shRNA in mouse melanoma cells to be.
  • 19 is a result of measuring the expression of cAMP, a protein important for melanin formation, by ELISA after knocking down FAM86A in mouse melanoma cells using shRNA.
  • FIG. 20 is a result of confirming the proteins that bind to the MC1R protein, which is pivotal to melanin formation, in mouse melanoma cells by knocking down FAM86A using shRNA and then proceeding to immunoprecipitation-MC1R.
  • the inventors of the present invention confirmed that FAM86A expression was rather decreased when inducing melanin formation by inducing ⁇ -MSH while studying the relationship between FAM86A and melanin through Examples,
  • the present invention was completed by confirming that the FAM86A inhibitor has therapeutic and ameliorating effects on melanin deficiency diseases including leukoplakia and vitiligo (of the present invention). See Examples).
  • protein is used interchangeably with “polypeptide” or “peptide”, and refers to a polymer of amino acid residues, for example, as commonly found in proteins in their natural state.
  • polynucleotide or “nucleic acid” refers to deoxyribonucleic acid (DNA) or ribonucleic acid (RNA) in the form of single or double strands. Unless otherwise limited, known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides are also included.
  • DNA is composed of four bases: adenine (A), guanine (G), cytosine (C), and thymine (T), and RNA is composed of uracil (U) instead of thymine.
  • A adenine
  • G guanine
  • C cytosine
  • T thymine
  • U uracil
  • mRNA messenger RNA or messenger RNA
  • RNA messenger RNA or messenger RNA
  • FAM86 is a protein belonging to the protein MTase family, and a single FAM86 gene is present in most mammalian genomes, and FAM86 of primates is contained within the replication region of the tumor-prone region, and is located in several genomic locations. It is known to have spread (Identification and Characterization of a Novel Evolutionarily conserveed Lysine-specific Methyltransferase Targeting Eukaryotic Translation Elongation Factor 2 (eEF2), JOURNAL OF BIOLOGICAL CHEMISTRY, VOLUME 289, NUMBER 44, OCTOBER 31, 2014).
  • eEF2 Novel Evolutionarily conserveed Lysine-specific Methyltransferase Targeting Eukaryotic Translation Elongation Factor 2 (eEF2), JOURNAL OF BIOLOGICAL CHEMISTRY, VOLUME 289, NUMBER 44, OCTOBER 31, 2014.
  • the FAM86 may be FAM86A, but is not limited thereto.
  • the FAM86A protein may be derived from a mammal, preferably derived from a human. Most preferably, the FAM86A protein in the present invention is characterized by comprising an amino acid sequence represented by human FAM86A (NP_958802.1) represented by SEQ ID NO: 1 (NCBI Genbank accession number in parentheses).
  • the FAM86 mRNA preferably contains a nucleotide sequence represented by human FAM86A mRNA (NM_201400.4) represented by SEQ ID NO: 6 (NCBI Genbank accession number in parentheses).
  • SEQ ID NO: 6 NCBI Genbank accession number in parentheses.
  • complementary refers to a targeting moiety in a nucleic acid molecule selectively to a target (eg, FAM86A gene) under predetermined hybridization or annealing conditions, specifically physiological conditions (intracellular). It means that it is sufficiently complementary enough to hybridize, and can have one or more mismatched nucleotide sequences, and has a meaning to encompass both substantially complementary and perfectly complementary. , More specifically, it means completely complementary.
  • the present invention provides a composition for detecting melanin formation or a composition for diagnosing pigment-related skin conditions, including an agent for measuring the protein of FAM86A or its mRNA expression level.
  • the present invention provides a composition for detecting melanin overproduction comprising an agent for measuring the protein of FAM86A or mRNA expression level thereof.
  • the term'detection' is to measure and confirm the presence (expression) of a target substance (marker protein in the present invention, FAM86A), or to measure a change in the abundance (expression level) of a target substance. And it means to include all things to confirm.
  • measuring the expression level of the protein in the present invention means measuring the expression or not (ie, measuring the presence or absence of expression), or measuring the level of qualitative or quantitative change of the protein. The measurement may be performed without limitation, including both a qualitative method (analysis) and a quantitative method.
  • the types of qualitative and quantitative methods are well known in the art, and the experimental methods described herein are included therein. Specific protein level comparison methods for each method are well known in the art. Therefore, the detection of the FAM86A protein is meant to include detecting the presence or absence of the FAM86A protein, or confirming an increase (up-regulation) or decrease (down-regulation) of the protein expression level.
  • the meaning of'increased expression (or high expression)' of a protein means that what was not expressed was expressed (i.e., that that was not detected) or that which was relatively overexpressed (that is, the amount of detection To increase).
  • the meaning of the opposite term thereof can be understood by those skilled in the art as having the opposite meaning according to the above definition.
  • the agent for measuring the expression level of the mRNA may be a probe or primer that specifically binds to the mRNA of FAM86A, but is not limited thereto.
  • the agent for measuring the expression level of the protein may be an antibody or aptamer specific for the protein of FAM86A, but is not limited thereto.
  • the mRNA of FAM86A may include the nucleotide sequence represented by SEQ ID NO: 6, but is not limited thereto.
  • the protein of FAM86A may include the amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto.
  • The'primer' is a short single-stranded oligonucleotide that acts as a starting point for DNA synthesis.
  • the primer specifically binds to a polynucleotide that is a template in a suitable buffer and temperature conditions, and DNA polymerase is linked to the primer by adding a nucleoside triphosphate having a base complementary to the template DNA. Is synthesized.
  • Primers generally consist of 15 to 30 base sequences, and the melting temperature (Tm) of bonding to the template strand varies depending on the base composition and length.
  • the sequence of the primer does not need to have a sequence that is completely complementary to some of the base sequences of the template, and it is sufficient to have sufficient complementarity within a range capable of hybridizing with the template to function unique to the primer. Therefore, in the present invention, the primer for measuring the expression level of the FAM86A mRNA does not need to have a sequence that is completely complementary to each gene sequence, and a specific section of mRNA or cDNA is amplified through DNA synthesis to measure the amount of mRNA. It is sufficient if it has the length and complementarity suitable for the purpose.
  • the primers for the amplification reaction consist of a set (pair) that complementarily bind to the template (or sense) at both ends of the specific section of the mRNA to be amplified and the opposite side (antisense, antisense).
  • the primer can be easily designed by those skilled in the art by referring to the mRNA or cDNA sequence of KRS or AIMP1.
  • the primers may preferably be a set, a pair, or a combination thereof that specifically binds to the mRNA of FAM86A represented by SEQ ID NO: 6.
  • The'probe' is a fragment of a polynucleotide such as RNA or DNA having a length of several to several hundred base pairs that can specifically bind to mRNA or complementary DNA (cDNA) of a specific gene. It is labeled so that the presence or absence of the target mRNA or cDNA to be bound, the expression level, etc.
  • a probe complementary to FAM86A mRNA is hybridized with a sample of a subject to measure the expression level of FAM86A mRNA, and thus it can be used for diagnosis of pigment-related skin conditions or detection of melanin overproduction. Probe selection and hybridization conditions can be appropriately selected according to techniques known in the art.
  • the primer or probe may be chemically synthesized using a method for synthesizing a solid support of phosphoramidite or other well-known methods.
  • primers or probes can be variously modified according to methods known in the art within a range that does not interfere with hybridization with FAM86A mRNA. Examples of such modifications include methylation, encapsulation, substitution of one or more homologs of natural nucleotides, and modifications between nucleotides, such as uncharged linkers (e.g. methyl phosphonate, phosphotriester, phosphoroamidate, carbamate, etc. ) Or charged linkers (eg, phosphorothioate, phosphorodithioate, etc.), and binding of a labeling material using fluorescence or enzymes.
  • uncharged linkers e.g. methyl phosphonate, phosphotriester, phosphoroamidate, carbamate, etc.
  • charged linkers eg, phosphorothioate, phosphorod
  • the antibody refers to a specific protein molecule directed against an antigenic site.
  • Antibodies used in the present invention include monoclonal or polyclonal antibodies, immunologically active fragments (e.g., Fab or (Fab)2 fragments), antibody heavy chains, humanized antibodies, antibody light chains, genetically engineered single chain Fv molecules, Chimeric antibodies and the like.
  • the aptamer refers to a single-stranded nucleic acid (DNA, RNA, or modified nucleic acid) having a stable tertiary structure by itself as a substance capable of specifically binding to an analyte to be detected in a sample. The presence of the target protein in the can be confirmed.
  • the aptamer is synthesized by determining the sequence of an oligonucleotide having a high binding ability and selective to the target protein to be identified according to a general aptamer manufacturing method, and then applying the 5'or 3'end of the oligonucleotide. In order to bind to the functional group of the timer chip, it may be made by modifying it with -SH, -COOH, -OH or NH 2 , but is not limited thereto.
  • the antibody used in the present invention can be prepared by a conventional method widely known in the field of immunology using the protein as an antigen.
  • the FAM86A protein used as an antigen of the antibody according to the present invention can be extracted or synthesized in nature and can be produced by a recombinant method based on a DNA sequence. When using genetic recombination technology, insert the nucleic acid encoding the FAM86A protein into an appropriate expression vector, culture host cells so that the FAM86A protein is expressed in the transformant transformed with the recombinant expression vector, and then recover the FAM86A protein from the transformant. It can be obtained by doing.
  • polyclonal antibodies can be produced by injecting the FAM86A protein antigen into an animal and collecting blood from the animal to obtain serum containing the antibody.
  • Such antibodies can be prepared using several warm-blooded animals such as horses, cows, goats, sheep, dogs, chickens, turkeys, rabbits, mice or rats.
  • Monoclonal antibodies are also known fusion methods (Kohler and Milstein, European J. Immnunol. 6:511-519, 1976), recombinant DNA methods (US Patent No. 4816567), and phage antibody libraries (Clackson et al., Nature, 352, 624-628, 1991; Marks et al., J. Mol. Biol. 222, 58:1-597, 1991).
  • the present invention provides a kit for detecting melanin formation or a kit for diagnosing skin conditions related to pigment, including an agent for measuring the expression level of the protein of FAM86A or its mRNA.
  • kit of the present invention may further include tools and/or reagents known in the art for use in immunological analysis.
  • immunological analysis may include any method capable of measuring the binding of an antigen and an antibody.
  • methods are known in the art and, for example, immunocytochemistry and immunohistochemistry, radioimmunoassays, enzyme-linked immunosorbent assays (ELISA), immunoblotting, and Paar assays ( Farr assay), immunoprecipitation, latex aggregation, red blood cell aggregation, turbidity, immunodiffusion, counter-current electrophoresis, single radical immunodiffusion, protein chip and immunofluorescence.
  • Tools and/or reagents used in immunological assays include suitable carriers or supports, labels capable of generating detectable signals, solubilizers, and detergents.
  • the labeling material is an enzyme
  • a substrate capable of measuring enzyme activity and a reaction terminator may be included.
  • the FAM86A included in the detection or diagnostic kit of the present invention may be preferably immobilized on a suitable carrier or support using various methods as disclosed in the literature (Antibodies: A Labotory Manual, Harlow &Lane; Cold SpringHarbor, 1988 ), examples of suitable carriers or supports include agarose, cellulose, nitrocellulose, dextran, sephadex, sepharose, liposomes, carboxymethyl cellulose, polyacrylamide, polyesterin, porphyry, filter paper, ion exchange resin, plastic film, Plastic tubes, glass, polyamine-methyl vinyl-ether-maleic acid copolymer, amino acid copolymer, ethylene-maleic acid copolymer, nylon, cups, flat packs, and the like. Other solid substrates include cell culture plates, ELISA plates, tubes and polymeric membranes.
  • the support may have any possible shape, for example spherical (bead), cylindrical (test tube or well inner surface), planar (sheet, test strip).
  • Labels capable of generating detectable signals enable qualitative or quantitative measurement of the formation of antigen-antibody complexes, examples of which include enzymes, fluorescent substances, ligands, luminescent substances, microparticles, redox molecules and radioactive substances. Isotopes, etc. can be used. Enzymes include ⁇ -glucuronidase, ⁇ -D-glucosidase, urease, peroxidase, alkaline phosphatase, acetylcholinesterase, glycose oxidase, hexokinase, maleate dehydrogenase, glucose-6 -Phosphate dehydrogenase, invertase, etc. can be used.
  • fluorescein, isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, fluorescein isothiocyanate, and the like may be used.
  • Ligands include biotin derivatives, and luminescent materials include acridinium ester, luciferin, and luciferase.
  • Microparticles include colloidal gold and colored latex, and redox molecules include ferrocene, ruthenium complex, biologen, quinone, Ti ion, Cs ion, diimide, 1,4-benzoquinone, and hydroquinone.
  • any one that can be used in an immunological assay may be used.
  • the present invention provides a method for screening skin whitening substances comprising the following steps.
  • the present invention provides a screening method for a melanin deficiency disease prevention or treatment comprising the following steps.
  • the cells expressing the protein of FAM86A or mRNA thereof include cells in which the protein of FAM86A or mRNA thereof is endogenous or transiently highly expressed, or a nucleic acid encoding FAM86A is contained in the cell. It can be used by introducing and transforming it to be overexpressed, but is not particularly limited thereto.
  • the cell expressing the protein of FAM86A or its mRNA may be one that excessively produces melanin, but is not particularly limited thereto.
  • expression means that a protein or nucleic acid is produced in a cell.
  • the cell expressing FAM86A may be a cell that expresses FAM86A endogenously, or may be a cell that overexpresses FAM86A by being transformed with a recombinant expression vector containing a polynucleotide encoding FAM86A.
  • the cells expressing the FAM86A gene may be cells derived from melanocytes.
  • the present inventors have used the B6F10 cell line as a cell that internally expresses FAM86A.
  • test substance used while referring to the screening method of the present invention means an unknown substance used in screening to test whether it affects the expression of FAM86A of the present invention.
  • the test substances are siRNA (small interference RNA), shRNA (short hairpin RNA), miRNA (microRNA), ribozyme, DNAzyme, PNA (peptide nucleic acids), antisense oligonucleotides, antibodies, aptamers, natural extracts, or Including, but not limited to, chemicals.
  • the cells used in step (a) or step (A) may be provided in the form of an experimental animal, and in this case, the screening method of the present invention further comprises the step of inducing melanin formation in the experimental animal, .
  • Contact with the test substance includes, but is not limited to, parenteral or oral administration, or stereotactic injection, and those skilled in the art will be able to select an appropriate method for testing the test substance on an animal.
  • Treating the test substance means adding the test substance to the cell or tissue culture medium and then culturing the cells for a certain time.
  • contact with the test substance is not limited thereto, including parenteral or oral administration, or stereotactic injection, and those skilled in the art can select an appropriate method for testing the test substance on the animal. will be.
  • Measurement of the expression level of mRNA in step (b) or (B) of the present invention is RT-PCR, quantitative or semi-quantitative RT-PCR (Quentitative or semi-Quentitative RT-PCR), quantitative or semi-quantitative real-time RT- It may be measured using one or more methods selected from the group consisting of PCR (Quentitative or semi-Quentitative real-time RT-PCR), northern blot, and DNA or RNA chip, but is not limited thereto. .
  • the protein expression level is measured by Western blot, ELISA, radioimmunoassay, radioimmunodilution, Ouchterlony immunodiffusion, rocket immunoelectrophoresis, and immunohistochemistry. It may be measured using one or more methods selected from the group consisting of staining, immunoprecipitation analysis, complement fixation analysis, FACS, and protein chip, but is not limited thereto.
  • step (c) or step (C) is a step of selecting a material having an increased expression level of the protein of FAM86A or its mRNA compared to a control cell as a skin whitening material.
  • step (c) or step (C) is a step of selecting a substance having a reduced expression level of the protein of FAM86A or its mRNA compared to a control cell as a preventive or therapeutic agent for melanin deficiency disease.
  • control cells may be cells that have not been treated with a test substance, but are not limited thereto.
  • the candidate material when the expression level of the FAM86 gene or protein in the melanin hyperproducing sample contacted with the test material is increased than the expression level of the gene or protein in the melanin hyperproducing sample not contacted with the candidate material, the candidate material is It may include the step of determining a melanogenesis inhibitor and/or a pigmented skin disease therapeutic agent and/or a skin whitening agent.
  • the candidate substance when the expression level of the FAM86 gene or protein in the melanin hyperproducing sample contacted with the test substance is reduced than the expression level of the gene or protein in the melanin hyperproducing sample not contacted with the candidate substance, the candidate substance is It may include the step of determining as a melanin production promoter and/or a treatment for color shedding disorders.
  • the present invention provides a method for providing information necessary for diagnosis of a pigment-related skin condition comprising the following steps.
  • the pigment-related skin condition refers to skin-related information indicating the skin type or skin condition related to the melanin pigment.
  • the present invention targets information related to pigmentation among various skin characteristics, in particular.
  • the biological sample may be used without limitation as long as it is collected from a subject to be diagnosed with a pigment-related skin condition.
  • cells or tissues obtained by biopsy blood, whole blood, serum, plasma, saliva, cerebrospinal fluid, It can be various secretions, urine, feces, etc.
  • it may be selected from the group consisting of blood, plasma, serum, saliva, nasal fluid, sputum, ascites, vaginal secretions, and urine, and preferably tissue or cells.
  • step (i) When the expression level of the FAM86A protein or its mRNA in the subject measured by the method of step (i) is compared with the normal control measured by the same method, when the expression level of the FAM86A protein or its mRNA is decreased, the subject is melanin It can be determined that this is excessively formed.
  • the subject, and various samples, as used herein, may be any animal, preferably a mammal, more preferably a human, or a sample or biopsy sample obtained therefrom may be any tissue, body fluid, or cell, such as skin tissue or It may be a skin cell or a fibroblast.
  • a normal individual refers to an individual who has no symptoms and signs of melanin overproduction and pigmented skin disease resulting from it, and has no history of melanin overproduction and pigmented skin disease resulting from it personally and familyly.
  • the melanin overproduction sample may be obtained naturally from an animal, such as a mammal, preferably a human, or obtained by an artificial method, and the artificial method includes overexpressing tyrosinase in non-pigmented cells.
  • the present invention provides a composition for skin whitening comprising a FAM86A protein, an agonist or an activator as an active ingredient.
  • the present invention provides a skin whitening method comprising administering a FAM86A protein, an agonist or an activator to an individual.
  • the present invention provides the use of a FAM86A protein, an agonist or an activator for preparing a skin whitening formulation.
  • the composition may be provided in the form of a pharmaceutical composition, a food composition, or a cosmetic composition, but is not limited thereto.
  • the agonist or activator may be one or more selected from the group consisting of an expression vector containing the FAM86A gene, a cell containing the vector, a compound, and a peptide, but is not limited thereto.
  • the expression vector includes the FAM86A gene, and the FAM86A recombinant expression vector is not limited thereto. It can be, for example, linear DNA, plasmid DNA or recombinant viral vectors.
  • the FAM86A gene included in the expression vector may include or consist of a nucleotide sequence represented by SEQ ID NO: 47.
  • the recombinant virus may be at least one selected from the group consisting of retrovirus, adenovirus, adeno-associated virus, herpes simplex virus, and lentivirus, but is not limited thereto.
  • whitening refers to not only brightening skin tone by inhibiting the synthesis of melanin pigments, but also improving skin hyperpigmentation such as spots and freckles caused by ultraviolet rays, hormones, or genetics.
  • whitening of the present invention includes whitening black or yellow skin, and may include converting black or yellow skin to white skin.
  • the pharmaceutical composition according to the present invention is a pathological condition of excessive melanin pigmentation, for example, aging/photoaging, and sudden hormonal changes such as pregnancy, pigmentation caused by skin damage and regeneration due to wounds, inflammation, burns, etc., Spots, freckles, blemishes, spots, spots, ovarian nevus, cyanic melasma, gravitic chloasma, melanoma in women who took oral contraceptives, age spots, senile blacks, wounds, and dermatitis. It can be used to improve and alleviate hyperpigmentation and melanodermatosis after inflammation.
  • the present invention provides a composition for preventing, treating, or improving melanin deficiency disease comprising a FAM86A inhibitor as an active ingredient.
  • the present invention provides a composition for skin blackening comprising a FAM86A inhibitor as an active ingredient.
  • a FAM86A inhibitor of the present invention was applied to melanoma cells of a mouse, it was confirmed that it could be used as a skin blackening agent or a suntanning agent because it showed a very strong melanin production promoting effect.
  • the FAM86A inhibitor of the present invention can be used as a composition for promoting melanin production, and can adjust the skin color or color of animals including humans by promoting melanin production, and specifically, can exhibit an effect of darkening the color of the hair.
  • the inhibitor may be an inhibitor of FAM86A activity or an expression inhibitor, but is not limited thereto.
  • the activity inhibitor may be one or more selected from the group consisting of compounds, peptides, peptidomimetics, matrix analogs, aptamers, and antibodies that specifically bind to the FAM86A protein, but is not limited thereto.
  • the expression inhibitor may be one or more selected from the group consisting of antisense nucleotides, RNAi, siRNA, miRNA, shRNA, and ribozymes complementarily binding to the mRNA of the FAM86A gene, but is not limited thereto.
  • siRNA refers to a sense strand (eg, a sequence corresponding to a FAM86A gene mRNA sequence) and an antisense strand (eg, a sequence complementary to a FAM86A gene mRNA sequence) located opposite each other. Thus, it can have a structure forming a double chain.
  • the siRNA molecule that can be used in the present invention may have a single-chain structure having a self-complementary sense and antisense strand.
  • siRNA is not limited to a complete pair of double-stranded RNA portions that pair with each other, and is not paired by mismatch (the corresponding base is not complementary), bulge (there is no base corresponding to one chain), etc.
  • the siRNA may specifically target one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 31 to SEQ ID NO: 39.
  • shRNA small hairpin RNA or short hairpin RNA
  • shRNA refers to a sequence of RNA that makes a robust hairpin turn, which can be used to silence gene expression through RNA interference.
  • the shRNA may be introduced into cells using any promoter capable of functioning in eukaryotic cells, but the pLKO.1 vector was used in the present invention. These vectors are always delivered to daughter cells, allowing gene silencing to be inherited.
  • the shRNA hairpin structure is degraded into siRNA, an intracellular machinery, and bound to the RNA-induced silencing complex. The above-described complex binds to and degrades mRNA matched to the siRNA bound thereto.
  • shRNA is transcribed by RNA polymerase III, and shRNA production in mammalian cells may trigger interferon reactions, just as cells recognize shRNA as viral attacks and seek defenses.
  • the shRNA may specifically include one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 11 to SEQ ID NO: 20, preferably one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 11 to SEQ ID NO: 20 It may be made of.
  • the shRNA may specifically target one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 21 to SEQ ID NO: 30.
  • miRNA refers to a substance that controls gene expression in eukaryotes by binding to 3'-UTR of mRNA (messengerRNA) as a single-stranded RNA molecule of 21-25 nucleotides ( Bartel DP, et al., Cell, 23;116(2): 281-297(2004)).
  • mRNA messengerRNA
  • the generation of miRNA is made into a precursor miRNA (pre-miRNA) of a stem-loop structure by Drosha (RNaseIII type enzyme), moves to the cytoplasm, and is cleaved by Dicer to make mature miRNA.
  • the miRNA may specifically include one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 40 to SEQ ID NO: 45, preferably one or more nucleotide sequences selected from the group consisting of SEQ ID NO: 40 to SEQ ID NO: 45 It may be made of.
  • the term "antisense oligonucleotide” refers to a DNA or RNA containing a nucleic acid sequence complementary to a specific mRNA sequence, or a derivative thereof, and binds to a complementary sequence in the mRNA to translate the mRNA into a protein. It acts to inhibit.
  • the antisense sequence of the present invention refers to a DNA or RNA sequence that is complementary to FAM86A and capable of binding to FAM86A mRNA, and translation of FAM86A mRNA, translocation into the cytoplasm, maturation, or any other overall It can inhibit essential activity for biological function.
  • the length of the antisense nucleic acid is 6 to 100 bases, specifically 8 to 60 bases, and more specifically 10 to 40 bases.
  • ribozyme is a type of RNA, which recognizes the nucleotide sequence of a specific RNA and has the same function as an enzyme that cuts it by itself. Ribozyme is composed of a region that binds with specificity as a complementary nucleotide sequence of the target messenger RNA strand and a region that cleaves the target RNA.
  • aptamer refers to an oligonucleotide (generally, an RNA molecule) that binds to a specific target.
  • aptamer in the present specification refers to an oligonucleotide aptamer. For example, RNA aptamer).
  • the siRNA or shRNA may be obtained by applying various modifications to improve the stability of the oligonucleotide in vivo, confer resistance to nuclease and reduce non-specific immune responses.
  • the modification of the oligonucleotide is the OH group at the 2′ carbon position of the sugar structure in one or more nucleotides -CH 3 (methyl), -OCH 3 (methoxy), -NH 2 , -F, -O-2-methoxyethyl, -O-propyl, -O-2-methylthioethyl, -O-3-aminopropyl, -O-3-dimethylaminopropyl, -ON-methylacetamido or -O-dimethylami Modification by substitution with dooxyethyl; Modification in which oxygen in the sugar structure in the nucleotide is substituted with sulfur; Alternatively, one or more modifications selected from modifications of nucleotide bonds to phosphorothioate
  • complementary refers to a targeting moiety in a nucleic acid molecule selectively to a target (eg, FAM86A gene) under predetermined hybridization or annealing conditions, specifically physiological conditions (intracellular). It means that it is sufficiently complementary enough to hybridize, and can have one or more mismatched nucleotide sequences, and has a meaning to encompass both substantially complementary and perfectly complementary. , More specifically, it means completely complementary.
  • melanin deficiency diseases to which the composition of the present invention can be applied are leukoderma, vitiligo, quadrichrome vitiligo, vitiligo ponctue, and syndromic albinism.
  • Alezzandrini syndrome Hermansky-Pudlak syndrome, ChediakHigashi syndrome, Griscelli syndrome (Elejalde syndrome) , Griscelli syndrome type 2 and Griscelli syndrome type 3, Wardenburg syndrome, Tietz syndrome, CrossMuKusick syndrome -Breen syndrome), ABCD syndrome, Albinism-deafness syndrome and Vogt-Koyanagi-Harada syndrome], oculocutaneous albinism, Canities, hypomelanosis (idiopathic guttate hypomelanosis), phyloid hypomelanosis, progressive macular hypomelanosis], piebaldism , Nevus depigmentosus, postinflammatory hypopigmentation, pityriasis alba, Vagabond's leukomel anoderma), Yemenite deaf-blind hypopigmentation syndrome, Wend-Bauckus syndrome, Woronoff's ring, melanism, and Leucism ) And skin
  • vitiligo is a pigment deficiency characterized by localized depigmented spots as a result of the loss of melanin and functional melanocytes from the epidermis of the skin.
  • canities Hair graying
  • hair graying or graying which means that the color tone of individual hair gradually weakens, and hairs of various shades from normal to white hair are mixed. do.
  • the leukoplakia is known to be caused by a decrease in tyrosinase activity in the hair bulbar melanocytes due to toxic oxidative damage of melanocytes, which are melanocytes.
  • composition of the present invention may be provided in the form of a pharmaceutical composition, a food composition, or a cosmetic composition, but is not limited thereto.
  • the present invention provides a method for preventing or treating melanin deficiency disease by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual.
  • the present invention provides the use of a FAM86A inhibitor for preparing a medicament for the prevention or treatment of melanin deficiency disease.
  • the present invention provides a composition for preventing alopecia, comprising a FAM86A inhibitor as an active ingredient.
  • the present invention provides a method for treating alopecia by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual.
  • the present invention provides the use of a FAM86A inhibitor for preparing a medicament for the prevention or treatment of alopecia.
  • composition may be to promote the synthesis or secretion of melanin, but is not limited thereto.
  • the present invention provides a composition for promoting black hair induction comprising a FAM86A inhibitor as an active ingredient.
  • the present invention provides a method for promoting black hair induction by administering a composition comprising a FAM86A inhibitor as an active ingredient to an individual, and a use of the FAM86A inhibitor for promoting black hair induction.
  • the present invention provides a composition for adjusting the color of an individual comprising a FAM86A inhibitor as an active ingredient, and specifically, may be a composition for adjusting the fur color or skin color of a companion animal.
  • the present invention provides a method for controlling the color of a subject by administering a composition comprising a FAM86A inhibitor as an active ingredient to a subject, and a use of the FAM86A inhibitor for controlling the color of a subject.
  • the FAM86A inhibitor of the present invention has an effect of promoting melanin production, when the FAM86A inhibitor is included, it can prevent the production of gray hair and promote the induction and production of black hair.
  • the present invention may also contain a pharmaceutically acceptable salt of the desired substance as an active ingredient.
  • pharmaceutically acceptable salt includes salts derived from pharmaceutically acceptable inorganic acids, organic acids, or bases.
  • food wise acceptable salt includes salts derived from food pharmaceutically acceptable organic acids, inorganic acids, or bases.
  • vehicleinarily acceptable salt includes salts derived from veterinarily acceptable inorganic acids, organic acids, or bases.
  • acids examples include hydrochloric acid, bromic acid, sulfuric acid, nitric acid, perchloric acid, fumaric acid, maleic acid, phosphoric acid, glycolic acid, lactic acid, salicylic acid, succinic acid, toluene-p-sulfonic acid, tartaric acid, acetic acid, citric acid, methanesulfonic acid, formic acid. , Benzoic acid, malonic acid, gluconic acid, naphthalene-2-sulfonic acid, and benzenesulfonic acid.
  • the acid addition salt can be prepared by a conventional method, for example, dissolving a compound in an excess acid aqueous solution, and precipitating the salt using a water-miscible organic solvent such as methanol, ethanol, acetone or acetonitrile. It can also be prepared by heating an equimolar amount of the compound and an acid or alcohol in water, followed by evaporating the mixture to dryness, or by suction filtration of the precipitated salt.
  • a water-miscible organic solvent such as methanol, ethanol, acetone or acetonitrile.
  • Salts derived from suitable bases may include alkali metals such as sodium and potassium, alkaline earth metals such as magnesium, and ammonium, but are not limited thereto.
  • the alkali metal or alkaline earth metal salt can be obtained, for example, by dissolving the compound in an excess alkali metal hydroxide or alkaline earth metal hydroxide solution, filtering the undissolved compound salt, and evaporating and drying the filtrate.
  • the metal salt it is particularly pharmaceutically suitable to prepare sodium, potassium or calcium salt, and the corresponding silver salt can be obtained by reacting an alkali metal or alkaline earth metal salt with a suitable silver salt (eg, silver nitrate).
  • the content of the FAM86A protein, its agonist, its activator or its inhibitor in the composition of the present invention can be appropriately adjusted according to the symptoms of the disease, the degree of progression of the symptoms, the condition of the patient, etc., for example, 0.0001 based on the total weight of the composition. It may be 99.9% by weight, or 0.001 to 50% by weight, but is not limited thereto.
  • the content ratio is a value based on the amount of dry solvent removed.
  • the pharmaceutical composition according to the present invention may further include suitable carriers, excipients, and diluents commonly used in the preparation of pharmaceutical compositions.
  • the excipient may be, for example, one or more selected from the group consisting of a diluent, a binder, a disintegrant, a lubricant, an adsorbent, a moisturizing agent, a film-coating material, and a controlled release additive.
  • the pharmaceutical composition according to the present invention is a powder, granule, sustained-release granule, enteric granule, liquid, eye drop, el-silic, emulsion, suspension, alcohol, troche, fragrance, limonadese according to a conventional method, respectively.
  • Carriers, excipients and diluents that may be included in the pharmaceutical composition according to the present invention include lactose, dextrose, sucrose, oligosaccharides, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium. Phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oils.
  • diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants that are usually used.
  • the additives of the liquid formulation according to the present invention include water, diluted hydrochloric acid, diluted sulfuric acid, sodium citrate, monostearic acid sucrose, polyoxyethylensorbitol fatty acid esters (twin esters), polyoxyethylene monoalkyl ethers, lanolin ethers, Lanolin esters, acetic acid, hydrochloric acid, aqueous ammonia, ammonium carbonate, potassium hydroxide, sodium hydroxide, prolamine, polyvinylpyrrolidone, ethylcellulose, sodium carboxymethylcellulose, and the like can be used.
  • the syrup according to the present invention may include a solution of white sugar, other sugars or sweeteners, and if necessary, a fragrance, a colorant, a preservative, a stabilizer, a suspending agent, an emulsifier, a viscous agent, and the like may be used.
  • Purified water may be used for the emulsion according to the present invention, and emulsifiers, preservatives, stabilizers, fragrances, etc. may be used as needed.
  • a topical agent may be used, and if necessary, a surfactant, a preservative, a stabilizer, a colorant, and a fragrance may be used.
  • Injectables according to the present invention include distilled water for injection, 0.9% sodium chloride injection, ring gel injection, dextrose injection, dextrose + sodium chloride injection, PEG, lactated ring gel injection, ethanol, propylene glycol, non-volatile oil-sesame oil Solvents such as cottonseed oil, peanut oil, soybean oil, corn oil, ethyl oleic acid, isopropyl myristic acid, and benzene benzoate; Solubilizing aids such as sodium benzoate, sodium salicylate, sodium acetate, urea, urethane, monoethylacetamide, butazolidine, propylene glycol, tweens, nijeongtinamide, hexamine, and dimethylacetamide; Buffering agents such as weak acids and their salts (acetic acid and sodium acetate), weak bases and their salts (ammonia and ammonium acetate), organic compounds, proteins, albumin, peptone,
  • Suppositories according to the present invention include cacao butter, lanolin, witepsol, polyethylene glycol, glycerogelatin, methylcellulose, carboxymethylcellulose, a mixture of stearic acid and oleic acid, Subanal, cottonseed oil, peanut oil, palm oil, cacao butter+ Cholesterol, lecithin, ranetwax, glycerol monostearate, tween or span, Imhausen, monolen (propylene glycol monostearate), glycerin, Adeps solidus, Butyrum Taego-G (Buytyrum Tego) -G), Cebes Pharma 16, Hexalide Base 95, Cotomar, Hydroxote SP, S-70-XXA, S-70-XX75 (S-70-XX95), Hydro Hydrokote 25, Hydrokote 711, Idropostal, Massa estrarium (A, AS, B, C, D, E, I, T), Massa-MF
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and these solid preparations include at least one excipient in the extract, such as starch, calcium carbonate, and sucrose. ) Or lactose (lactose), gelatin, etc. are mixed to prepare. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral administration include suspensions, liquid solutions, emulsions, syrups, etc.In addition to water and liquid paraffin, which are commonly used simple diluents, various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included. have.
  • Preparations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized preparations, and suppositories.
  • the non-aqueous solvent and suspending agent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable ester such as ethyl oleate may be used.
  • a pharmaceutically effective amount means an amount sufficient to treat a disease at a reasonable benefit/risk ratio applicable to medical treatment, and the effective dose level is the type of patient disease, severity, drug activity, Sensitivity to drugs, time of administration, route of administration and rate of excretion, duration of treatment, factors including drugs used concurrently, and other factors well known in the medical field can be determined.
  • the pharmaceutical composition according to the present invention may be administered as an individual therapeutic agent or administered in combination with other therapeutic agents, may be administered sequentially or simultaneously with a conventional therapeutic agent, and may be administered single or multiple. It is important to administer an amount capable of obtaining the maximum effect in a minimum amount without side effects in consideration of all the above factors, and this can be easily determined by a person skilled in the art to which the present invention pertains.
  • the pharmaceutical composition of the present invention can be administered to a subject by various routes. All modes of administration can be expected, e.g. oral administration, subcutaneous injection, intraperitoneal administration, intravenous injection, intramuscular injection, peri-spinal space (intrathecal) injection, sublingual administration, buccal mucosa administration, rectal injection, vaginal injection. It may be administered according to intramuscular insertion, ocular administration, ear administration, nasal administration, inhalation, spray through the mouth or nose, skin administration, transdermal administration, and the like.
  • the pharmaceutical composition of the present invention is determined according to the type of drug as an active ingredient, along with various related factors such as the disease to be treated, the route of administration, the age, sex, weight, and severity of the disease.
  • “individual” refers to a subject in need of treatment of a disease, and is not limited if it is a vertebrate animal, but specifically, human, mouse, rat, guinea pig, rabbit, monkey, pig, horse, cow, It can be applied to sheep, antelopes, dogs, cats, fish and reptiles, and may preferably be a furry mammal, more preferably a human.
  • “administration” means providing a given composition of the present invention to a subject by any suitable method.
  • prevention refers to any action that suppresses or delays the onset of the target disease
  • treatment refers to the target disease and the resulting metabolic abnormalities are improved by administration of the pharmaceutical composition according to the present invention. It means all actions that are advantageously altered, and “improvement” means any action that reduces the degree of a parameter related to a desired disease, for example, symptoms by administration of the composition according to the present invention.
  • composition comprising the FAM86A protein, agonist or activator may be added to food for whitening purposes.
  • composition comprising the FAM86A inhibitor may be added to food for the purpose of improving melanin deficiency disease.
  • foods include functional foods and health functional foods.
  • the health functional food has the advantage of having a more excellent effect by ingesting it in the form of inner beauty food.
  • the inner beauty is a food that is referred to as'eating cosmetics or beauty food', and refers to foods that change the skin constitution healthily by absorbing various ingredients that are good for the skin into the body, and select cosmetics suitable for the skin type. As if, considering the skin condition and lifestyle, you can choose and consume an inner beauty food that suits each individual. More preferably, when the cosmetics containing the cosmetic composition and the inner beauty food containing the FAM86A protein, agonist, and activator are mixed, the whitening effect is significantly higher than that of using only cosmetics or drugs, and thus a more effective skin whitening effect. It has the advantage of being able to see.
  • the treatment or improvement of melanin deficiency diseases including vitiligo and alopecia is superior compared to using only cosmetics or drugs. It has the advantage of being able to see more effective treatment or improvement of melanin-related skin diseases.
  • the FAM86A protein of the present invention When the FAM86A protein of the present invention, its agonist, its activator, or its inhibitor is used as a food additive, the FAM86A protein, its agonist, its activator or its inhibitor can be added as it is or used with other foods or food ingredients. And can be appropriately used according to a conventional method.
  • the mixing amount of the active ingredient may be appropriately determined according to the purpose of use (prevention, health or therapeutic treatment).
  • the FAM86A protein of the present invention, its agonist, its activator or its inhibitor is added in an amount of 15% by weight or less, preferably 10% by weight or less based on the raw material.
  • the amount may be below the above range, and there is no problem in terms of safety, so the active ingredient may be used in an amount above the above range.
  • the health beverage composition according to the present invention may contain various flavoring agents or natural carbohydrates as an additional component, like a conventional beverage.
  • the natural carbohydrates described above are monosaccharides such as glucose and fructose, disaccharides such as maltose and sucrose, polysaccharides such as dextrin and cyclodextrin, and sugar alcohols such as xylitol, sorbitol and erythritol.
  • natural sweeteners such as taumatin and stevia extract, and synthetic sweeteners such as saccharin and aspartame can be used.
  • the ratio of the natural carbohydrate is generally about 0.01-0.20 g, preferably about 0.04-0.10 g per 100 mL of the composition of the present invention.
  • the composition of the present invention includes various nutrients, vitamins, electrolytes, flavoring agents, colorants, pectic acids and salts thereof, alginic acid and salts thereof, organic acids, protective colloidal thickeners, pH adjusters, stabilizers, preservatives, glycerin, alcohols, Carbonating agents used in carbonated beverages may be contained.
  • the composition of the present invention may contain flesh for the production of natural fruit juice, fruit juice beverage and vegetable beverage. These components may be used independently or in combination. The proportion of these additives is not very important, but it is generally selected from 0.01 to 20 parts by weight per 100 parts by weight of the composition of the present invention.
  • the FAM86A protein, its agonist, its activator, or its inhibitor may be provided in the form of a cosmetic composition.
  • Formulations of the cosmetic composition according to the present invention include skin lotion, skin softener, skin toner, astringent, lotion, milk lotion, moisture lotion, nutrition lotion, massage cream, nutrition cream, moisture cream, hand cream, foundation, essence, nutrition essence, It may be in the form of a pack, soap, cleansing foam, cleansing lotion, cleansing cream, body lotion, or body cleanser.
  • the cosmetic composition of the present invention may further include a composition selected from the group consisting of water-soluble vitamins, oil-soluble vitamins, polymer peptides, polymer polysaccharides, and sphingo lipids.
  • the water-soluble vitamin may be any one that can be blended in cosmetics, but preferably vitamin B1, vitamin B2, vitamin B6, pyridoxine, pyridoxine hydrochloride, vitamin B12, pantothenic acid, nicotinic acid, nicotinic acid amide, folic acid, vitamin C, vitamin H, etc. And their salts (thiamine hydrochloride, sodium ascorbate, etc.) and derivatives (ascorbic acid-2-phosphate sodium salt, ascorbic acid-2-magnesium salt, etc.) are also included in the water-soluble vitamins that can be used in the present invention. Included. Water-soluble vitamins can be obtained by conventional methods such as a microbial transformation method, a purification method from a microorganism culture, an enzyme method, or a chemical synthesis method.
  • oil-soluble vitamin any one may be used as long as it can be blended in cosmetics, but preferably vitamin A, carotene, vitamin D2, vitamin D3, vitamin E (d1-alpha tocopherol, d-alpha tocopherol, d-alpha tocopherol), etc. are mentioned.
  • Their derivatives (ascorbine palmitate, ascorbine stearate, ascorbine dipalmitate, dl-alpha tocopherol acetate, nicotinic acid dl-alpha tocopherol vitamin E, DL-pantotenyl alcohol, D-pantotenyl alcohol, pantotenyl ethyl Ether, etc.) are also included in the oil-soluble vitamin used in the present invention.
  • Oil-soluble vitamins can be obtained by conventional methods such as a microbial transformation method, a purification method from a microorganism culture, an enzyme or a chemical synthesis method.
  • the polymer peptide may be any one as long as it can be blended into cosmetics.
  • collagen, hydrolyzed collagen, gelatin, elastin, hydrolyzed elastin, keratin, and the like are exemplified.
  • the polymeric peptide can be purified and obtained by a conventional method such as a purification method from a culture medium of a microorganism, an enzyme method, or a chemical synthesis method, or it can be used after being purified from natural products such as dermis of pigs and cattle, silk fibers of silkworms.
  • any one may be used as long as it can be blended in cosmetics, but preferably, hydroxyethyl cellulose, xanthan gum, sodium hyaluronate, chondroitin sulfuric acid or a salt thereof (sodium salt, etc.) may be mentioned.
  • chondroitin sulfate or a salt thereof can be used after being purified from mammals or fish.
  • the sphingolipids may be any as long as they can be blended into cosmetics, and ceramides, phytosphingosine, sphingoglycolipids, and the like are preferable. Sphingolipids are usually purified from mammals, fish, shellfish, yeast, plants, etc. by a conventional method or can be obtained by chemical synthesis.
  • composition of the present invention in addition to the above essential ingredients, other ingredients that are usually blended in cosmetics may be blended if necessary.
  • ingredients that may be added include fats and oils, moisturizers, emollients, surfactants, organic and inorganic pigments, organic powders, ultraviolet absorbers, preservatives, fungicides, antioxidants, plant extracts, pH adjusters, alcohols, pigments, fragrances, Blood circulation accelerators, cold sensation agents, restrictors, and purified water.
  • oil and fat components examples include ester oils and fats, hydrocarbon oils, silicone oils, fluorine oils, animal oils and vegetable oils.
  • ester oils include glyceryl tri2-ethylhexanoate, cetyl 2-ethylhexanoate, isopropyl myristate, butyl myristate, isopropyl palmitate, ethyl stearate, octyl palmitate, isocetyl isostearate, stearic acid.
  • hydrocarbon-based fats and oils examples include hydrocarbon-based fats such as squalene, liquid paraffin, alpha-olefin oligomer, isoparaffin, ceresin, paraffin, liquid isoparaffin, polybuden, microcrystalline wax, and petrolatum.
  • Silicone-based fats and oils include polymethylsilicone, methylphenylsilicone, methylcyclopolysiloxane, octamethylpolysiloxane, decamethylpolysiloxane, dodecamethylcyclosiloxane, dimethylsiloxane/methylcetyloxysiloxane copolymer, dimethylsiloxane/methylsteaoxysiloxane copolymer, alkyl And modified silicone oil and amino-modified silicone oil.
  • Animal or vegetable oils include avocado oil, almond oil, olive oil, sesame oil, rice bran oil, new flower oil, soybean oil, corn oil, rapeseed oil, almond oil, palm kernel oil, palm oil, castor oil, sunflower oil, grape seed oil.
  • Cottonseed Oil, Palm Oil Cucuine Nut Oil, Wheat Germ Oil, Rice Germ Oil, Shea Butter, Walnut Colostrum Oil, Marker Demi Anut Oil, Meadow Home Oil, Egg Yolk Oil, Tallow Oil, Horse Oil, Mink Oil, Orange Rape Oil, Jojoba Oil
  • Animal or plant fats such as canderry wax, carnauba wax, liquid lanolin, and hydrogenated castor oil.
  • the moisturizing agent examples include a water-soluble low-molecular moisturizer, a fat-soluble molecular moisturizer, a water-soluble polymer, and a fat-soluble polymer.
  • water-soluble polymer examples include carboxyvinyl polymer, polyaspartic acid salt, tragacanth, xanthan gum, methylcellulose, hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, carboxymethylcellulose, water-soluble chitin, chitosan, dextrin, and the like. I can.
  • oil-soluble polymer examples include polyvinylpyrrolidone/eicosene copolymer, polyvinylpyrrolidone/hexadecene copolymer, nitrocellulose, dextrin fatty acid ester, and polymer silicone.
  • emollient agent examples include long-chain acyl glutamate cholesteryl ester, hydroxystearate cholesteryl, 12-hydroxystearic acid, stearic acid, rosin acid, and lanolin fatty acid cholesteryl ester.
  • surfactant examples include nonionic surfactants, anionic surfactants, cationic surfactants, and amphoteric surfactants.
  • Nonionic surfactants include self-emulsifying glycerin monostearate, propylene glycol fatty acid ester, glycerin fatty acid ester, polyglycerin fatty acid ester, sorbitan fatty acid ester, POE (polyoxyethylene) sorbitan fatty acid ester, POE sorbit fatty acid ester, POE Glycerin fatty acid ester, POE alkyl ether, POE fatty acid ester, POE hydrogenated castor oil, POE castor oil, POE ⁇ POP (polyoxyethylene ⁇ polyoxypropylene) copolymer, POE ⁇ POP alkyl ether, polyether-modified silicone, lauric acid Alkanolamides, alkylamine oxides, hydrogenated soybean phospholipids, and the like.
  • anionic surfactants fatty acid soap, alpha-acyl sulfonate, alkyl sulfonate, alkyl allyl sulfonate, alkyl naphthalene sulfonate, alkyl sulfate, POE alkyl ether sulfate, alkylamide sulfate, alkyl phosphate, POE alkyl phosphate, alkylamide phosphate , Alkyloylalkyltaurine salt, N-acylamino acid salt, POE alkylether carboxylate, alkylsulfosuccinate, sodium alkylsulfoacetate, acylated hydrolyzed collagen peptide salt, perfluoroalkylphosphoric acid ester, and the like. .
  • Cationic surfactants include alkyl trimethyl ammonium chloride, stearyl trimethyl ammonium chloride, stearyl trimethyl ammonium bromide, cetostearyl trimethyl ammonium chloride, distearyl dimethyl ammonium chloride, stearyldimethylbenzyl ammonium chloride, behenyl trimethyl ammonium bromide, and chloride.
  • Benzalkonium diethylaminoethyl amide stearate, dimethylaminopropyl amide stearate, lanolin derivative quaternary ammonium salt, and the like.
  • amphoteric surfactants include carboxybetaine type, amidebetaine type, sulfobetaine type, hydroxysulfobetaine type, amide sulfobetaine type, phosphobetaine type, aminocarboxylate type, imidazoline derivative type, amideamine type, etc. Amphoteric surfactants, and the like.
  • organic and inorganic pigments include silicic acid, silicic anhydride, magnesium silicate, talc, sericite, mica, kaolin, bengala, clay, bentonite, titanium coated mica, bismuth oxychloride, zirconium oxide, magnesium oxide, zinc oxide, titanium oxide, aluminum oxide.
  • Inorganic pigments such as calcium sulfate, barium sulfate, magnesium sulfate, calcium carbonate, magnesium carbonate, iron oxide, ultramarine, chromium oxide, chromium hydroxide, calamine, and complexes thereof; Polyamide, polyester, polypropylene, polystyrene, polyurethane, vinyl resin, urea resin, phenolic resin, fluorine resin, silicon resin, acrylic resin, melamine resin, epoxy resin, polycarbonate resin, divinylbenzene-styrene copolymer, Organic pigments, such as silk powder, cellulose, CI pigment yellow, and CI pigment orange, and complex pigments of these inorganic pigments and organic pigments, etc. are mentioned.
  • organic powder examples include metal soaps such as calcium stearate; Alkyl phosphate metal salts, such as sodium zinc cetylate, a zinc laurylate, and calcium laurylate; Acylamino acid polyvalent metal salts such as N-lauroyl-beta-alanine calcium, N-lauroyl-beta-alanine zinc, and N-lauroyl glycine calcium; Amide sulfonic acid polyvalent metal salts such as N-lauroyl-taurine calcium and N-palmitoyl-taurine calcium; N, such as N-epsilon-lauroyl-L-lysine, N-epsilon-palmitoyl lizine, N-alpha-paritoylolnitine, N-alpha-lauroylarginine, N-alpha-hardened tallow fatty acid acylarginine, etc.
  • metal soaps such as calcium stearate
  • N-acyl polypeptides such as N-lauroylglycylglycine
  • Alpha-amino fatty acids such as alpha-aminocaprylic acid and alpha-aminolauric acid
  • Polyethylene polypropylene, nylon, polymethyl methacrylate, polystyrene, divinylbenzene/styrene copolymer, ethylene tetrafluoride, and the like.
  • UV absorbers include paraaminobenzoic acid, ethyl paraaminobenzoate, amyl paraaminobenzoate, octyl paraaminobenzoate, ethylene glycol salicylate, phenyl salicylate, octyl salicylate, benzyl salicate, butyl phenyl salicylate, homomentyl salicylate, benzyl cinnamate , Paramethoxycinnamic acid-2-ethoxyethyl, paramethoxycinnamic acid octyl, diparamethoxycinnamic acid mono-2-ethylhexane glyceryl, paramethoxycinnamic acid isopropyl, diisopropyl ⁇ diisopropyl cinnamic acid ester mixture, right Cannic acid, ethyl urocanate, hydroxymethoxybenzophenone, hydroxymethoxybenz
  • antioxidant examples include butylhydroxyanisole, propyl gallic acid, and elisorbic acid.
  • pH adjuster examples include citric acid, sodium citrate, malic acid, sodium malate, pmalic acid, sodium pmarate, succinic acid, sodium succinate, sodium hydroxide, sodium monohydrogen phosphate, and the like.
  • alcohol examples include higher alcohols such as cetyl alcohol.
  • the blending components that may be added are not limited thereto, and any of the above components can be blended within a range that does not impair the object and effect of the present invention, but preferably 0.01-5% by weight based on the total weight, More preferably, it is blended in an amount of 0.01-3% by weight.
  • the formulation of the present invention is a lotion, paste, cream or gel, animal fibers, plant fibers, wax, paraffin, starch, tracant, cellulose derivatives, polyethylene glycol, silicone, bentonite, silica, talc, or zinc oxide, etc. are used as carrier components. Can be used.
  • lactose When the formulation of the present invention is a powder or spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, or polyamide powder may be used as a carrier component.
  • lactose talc
  • silica aluminum hydroxide
  • calcium silicate or polyamide powder
  • propellants such as butane or dimethyl ether.
  • a solvent, a solvating agent or an emulsifying agent is used as a carrier component, such as water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 ,3-butylglycol oil, glycerol aliphatic ester, polyethylene glycol or fatty acid ester of sorbitan.
  • a liquid diluent such as water, ethanol or propylene glycol as a carrier component, an ethoxylated isostearyl alcohol, a suspending agent such as polyoxyethylene sorbitol ester and polyoxyethylene sorbitan ester, microcrystalline Cellulose, aluminum metahydroxide, bentonite, agar or tracant, and the like may be used.
  • the formulation of the present invention is a surfactant containing cleansing, as a carrier component, aliphatic alcohol sulfate, aliphatic alcohol ether sulfate, sulfosuccinic acid monoester, isethionate, imidazolinium derivative, methyltaurate, sarcosinate, fatty acid amide Ether sulfates, alkylamidobetaines, fatty alcohols, fatty acid glycerides, fatty acid diethanolamides, vegetable oils, linoline derivatives, or ethoxylated glycerol fatty acid esters may be used.
  • the composition may be a formulation selected from the group consisting of shampoo, conditioner, hair tonic, hair nutrient lotion, hair essence, hair serum scalp treatment, hair treatment, hair conditioner, hair shampoo, and hair lotion. , But is not limited thereto.
  • composition according to the present invention may further contain an appropriate component according to the above formulation, and this will be described in detail as follows.
  • any one or more selected from the group consisting of surfactants, preservatives and viscosity modifiers, pH modifiers, fragrances, dyes, hair conditioning agents, and water are further contained.
  • the surfactant is at least one selected from anionic surfactants, amphoteric surfactants and nonionic surfactants.
  • the anionic surfactant may be an alkyl sulfate or an alkyl ether sulfate, and specific examples thereof include sodium lauryl sulfate, ammonium lauryl sulfate, triethanolamine lauryl sulfate, sodium polyoxyethylene lauryl sulfate, and polyoxyethylene. Ammonium uryl sulfate, etc. are mentioned.
  • amphoteric surfactant may be an alkyl betaine or an alkyl amidopropyl betaine, and specific examples thereof include cocodimethyl carboxymethyl betaine, lauryldimethyl carboxymethyl betaine, lauryldimethyl alpha-carboxyethyl beta Phosphorus, cetyldimethyl carboxymethyl betaine, cocamido propyl betaine, and the like.
  • the nonionic surfactant may be an alkanol amide or an amine oxide, and specific examples thereof include lauryl diethyl amine oxide, palm oil alkyldimethyl amine oxide, lauric acid diethanolamide, palm oil fatty acid diethanolamide, Palm oil fatty acid monoethanolamide, etc. are mentioned.
  • the preservative is at least one selected from the group consisting of methyl paraoxybenzoate, propyl paraoxybenzoate, sodium benzoate, methylchloroisothiazolinone, methylisothiazolinone, and sodium benzoate.
  • the viscosity modifier is at least one consisting of Cocamide M.E. (CME), Cocamide D.E. (CDE), and sodium chloride.
  • the pH adjusting agent is at least one consisting of sodium phosphate, disodium phosphate, citric acid, and sodium citrate.
  • the hair conditioning agent is a dimethicone base, a cationic polymer, or a combination thereof.
  • the hair conditioning agent may further include any one or more of a tertiary amidoamine, a quaternary ammonium compound, a high melting point compound, and a silicone compound.
  • tertiary amidoamine examples include cocaamidopropyl dimethylamine, stearamidopropyl dimethylamine, beheniramidopropyl dimethylamine, oleamidopropyl dimethylamine, isostearamidopropyl dimethylamine, and the like. I can.
  • quaternary ammonium compound examples include alkyl (carbon number 14 to 22) trimethyl ammonium chloride, dialkyl (carbon number 14 to 22) dimethyl ammonium chloride, hydrogenated tallow alkyl trimethyl ammonium chloride and ditallow alkyl dimethyl ammonium chloride. have.
  • the high melting point compound examples include fatty alcohols, fatty acids, fatty alcohol derivatives, hydrocarbons, and the like, and more specifically, cetyl alcohol, stearyl alcohol, cetostearyl alcohol, and the like.
  • silicone compound examples include polyalkylsiloxane, polyarylsiloxane, polyalkylarylsiloxane, and polyethersiloxane copolymers.
  • the term "combination of these" included in the expression of the Makushi format refers to one or more mixtures or combinations selected from the group consisting of components described in the expression of the Makushi format, the It means to include one or more selected from the group consisting of components.
  • B16F10 cells and cells which are murine melanoma cells, were mixed with 10% FBS (fetal bovine serum) and penicillin-streptomycin-containing DMEM (Dulbecco's modified Eagle's medium) culture medium at 37°C, 5% carbon dioxide (CO). 2 ) It was cultured in a cell incubator under conditions.
  • FBS fetal bovine serum
  • DMEM Dulbecco's modified Eagle's medium
  • CO carbon dioxide
  • Example 2-1 Western blotting for melanin formation by UVB and confirmation of FAM86A protein
  • the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and sufficiently washed with TBS-T.
  • the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T.
  • the ECL detection system was used to determine the amount and location of specific proteins. Correction of the amount of protein was confirmed by recycling (stripping) the PVDF membrane and confirming the amount of actin protein.
  • Each antibody was purchased from Cell signaling and Santacruz.
  • FAM86A has an effect on melanin formation.
  • C57BL/6 mice were treated with UVB (1mJ), and then skin tissue was removed by time.
  • the obtained tissue was treated with 200 ⁇ l of cell lysis to dissolve the tissue, and then centrifuged for 5 minutes at 12,000 rpm at 4°C and the supernatant was removed.
  • 100 ⁇ l of a 10% sodium dodecyl sulfate-1M NaOH solution was dispensed into the obtained precipitate and heated at 60° C. for 30 minutes. Then, the heated solution was allowed to stand at room temperature, cooled to 25°C, and absorbance was measured at 405 nm. At this time, the amount of melanin was calculated based on the amount of melanin formation in cells not treated with UVB.
  • Example 2-3 Western blotting to confirm the expression level of FAM86A according to the mouse color type
  • the skin tissues of C57BL/6, ICR mice were excised and washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a tissue lysis and staining reagent, was treated. Then, after quantifying the protein by BCA assay, electrophoresis was performed using 10% SDS-PAGE. After transferring the protein from the electrophoresed SDS-PAGE gel to the PVDF membrane, the PVDF membrane on which the protein was transferred was transferred to TBS-T (in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA).
  • TBS-T in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA.
  • the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and sufficiently washed with TBS-T.
  • the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T.
  • the ECL detection system was used to determine the amount and location of a specific protein. Correction of the amount of protein was confirmed by recycling the PVDF membrane (stripping) and confirming the amount of actin protein.
  • Each antibody was purchased from Cell signaling and Santacruz.
  • FAM86A protein expression level was changed according to the color of the skin. Specifically, it was confirmed that FAM86A was hardly expressed in black mouse skin, while FAM86A was highly expressed in white mouse skin. This is a result indicating that FAM86A has an effect on melanin formation.
  • Example 2-4 Western blotting to confirm the expression level of FAM86A according to the color of the skin area of the mouse
  • the skin tissues of the white skin and the black skin between the ears and the ears of C57BL/6 mice were removed, and then washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a tissue lysis and staining reagent, was treated. Then, after quantifying the protein by BCA assay, electrophoresis was performed using 10% SDS-PAGE. After transferring the protein from the electrophoresed SDS-PAGE gel to the PVDF membrane, the PVDF membrane on which the protein transfer was completed was transferred to TBS-T (in 100mM NaCl, 10mM Tris, 0.1% (v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA).
  • TBS-T in 100mM NaCl, 10mM Tris, 0.1% (v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA.
  • the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and sufficiently washed with TBS-T.
  • the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T.
  • the ECL detection system was used to determine the amount and location of a specific protein. The results are shown in FIG. 3. Correction of the amount of protein was confirmed by recycling the PVDF membrane (stripping) and confirming the amount of actin protein.
  • Each antibody was purchased from Cell signaling and Santacruz.
  • FAM86A protein expression level was changed according to the color of the skin. Specifically, it was confirmed that FAM86A was rarely expressed in the skin tissue between the ear and the ear corresponding to black skin, and FAM86A was highly expressed in the white skin behind the ear. This is a result indicating that FAM86A has an effect on melanin formation.
  • Example 2-5 Western blotting for induction of melanin formation by ⁇ -MSH and confirmation of FAM86A protein expression level
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate so as to be 5 ⁇ 10 4 cells per well, cultured for 24 hours, and then treated with ⁇ -MSH to be 100 nM.
  • the cells were cultured for 48 hours in a cell incubator under conditions of 37° C., 5% carbon dioxide (CO 2 ), and then washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper. Then, after quantifying the protein by BCA assay, electrophoresis was performed using 10% SDS-PAGE.
  • the PVDF membrane on which the protein transfer was completed was transferred to TBS-T (in 100mM NaCl, 10mM Tris, 0.1% (v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA). Then, after washing three times for 10 minutes using TBS-T, the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and sufficiently washed with TBS-T. And the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T. Then, the ECL detection system was used to determine the amount and location of a specific protein. Correction of the amount of protein was confirmed by recycling the PVDF membrane (stripping) and confirming the amount of actin protein. Each antibody was purchased from Cell signaling and Santacruz.
  • Example 2-6 Confirmation of melanogenesis-related gene expression (realtime PCR)
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate so as to be 5 ⁇ 10 4 cells per well, cultured for 24 hours, and then treated with ⁇ -MSH to be 100 nM.
  • the cells were cultured for 48 hours in a cell incubator at 37° C., 5% carbon dioxide (CO 2 ). After 48 hours, all the cell culture was removed, the cells were digested with TRI-Zol, and neutralized with BCP. The mRNA was precipitated in the neutralized liquid using isopropanol. Subsequently, only the precipitated mRNA was collected using a centrifuge and used in the experiment.
  • Intracellular mRNA was synthesized into cDNA using a cDNA kit, and expression levels of Tyrosinase, TYRP-1, TYRP-2, MITF, and FAM86A genes, which are genes important for melanin formation, were confirmed through PCR.
  • vector pCMV Myc mFAM86A; SEQ ID NO: 46
  • Empty Vector pCMV Myc; SEQ ID NO: 48
  • FAM86A represented by SEQ ID NO: 47
  • lipopectamine a cell incubator at 37°C and 5% carbon dioxide (CO 2 ).
  • the cultured cells were washed twice with PBS.
  • 200 ⁇ l of RIPA buffer 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper.
  • the expression of cAMP protein was measured using cAMP ELISA KIT (ab65355).
  • Example 3-2 Confirming the effect of reducing melanin formation through Fontana-Masson stain according to FAM86A overexpression
  • mouse melanoma B16F10 cells were transfected with Myc-FAM86A to overexpress FAM86A, followed by staining melanin through Fontana Mason staining, and the degree of melanin formation was confirmed through a microscope.
  • cells were cultured for 48 hours in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ), washed twice with PBS, and then treated with 1 ml of 1% amonical silver nitrate solution to each well for 1 hour. Heated through a dryer at 60°C. Then, after washing three times with running water, gold chloride 0.2% solution was treated with 1 ml each for 30 seconds. Then, after washing twice with running water, 1 ml of sodium thiosulfate 5% solution was treated, and after washing twice with running water, 1 ml of neutral red 0.5% solution was treated for 2 minutes each, followed by washing with running water. After that, the results were confirmed through a microscope.
  • CO 2 carbon dioxide
  • mouse melanoma B16F10 cells were transfected with Myc-FAM86A to overexpress FAM86A, and then the amount of melanin secretion was confirmed through a melanin secretion assay.
  • Cells were cultured in a cell incubator under conditions of 37° C. and 5% carbon dioxide (CO 2 ) for 48 hours, and then 800 ⁇ l of the cell culture solution was transferred to a new tube and centrifuged at 12,000 rpm for 5 minutes at 4° C. to obtain a supernatant. 100 ⁇ l of the obtained supernatant was dispensed into a 96-well plate and absorbance was measured at 475 nm. At this time, the amount of melanin secretion was calculated based on the amount of melanin in cells that did not overexpress the FAM86A gene.
  • mouse melanoma B16F10 cells were transfected with Myc-FAM86A to overexpress FAM86A, and then the amount of melanin production was confirmed through a melanin secretion assay.
  • Cells were cultured in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ) for 48 hours, and then the cell culture solution was removed, and 200 ⁇ l of cell lysis buffer was applied to each well to lyse the cells, and then at 4°C at 12,000 rpm. After centrifugation for 5 minutes, the supernatant was removed.
  • CO 2 carbon dioxide
  • Example 3-5 Confirmation of gene expression level related to melanin formation following FAM86A overexpression (realtime PCR)
  • mice melanoma B16F10 cells were transfected with Myc-FAM86A to overexpress FAM86A, and then genes that were pivotal for melanin formation (Tyrosinase, TYRP) using the real-time PCR method of Example 2-6. -1, TYRP-2, MITF) expression level was measured.
  • the cells were cultured for 48 hours in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ). After 48 hours, all the cell culture was removed, the cells were digested with TRI-Zol, and neutralized with BCP. The mRNA was precipitated in the neutralized liquid using isopropanol. Subsequently, only the precipitated mRNA was collected using a centrifuge and used in the experiment. Intracellular mRNA was synthesized into cDNA using a cDNA kit, and the expression levels of Tyrosinase, TYRP-1, TYRP-2, and MITF genes, which are genes important for melanin formation, were confirmed through PCR.
  • Example 3-6 Confirmation of protein expression level related to melanin formation following FAM86A overexpression (Western blotting)
  • Example 3-1 mouse melanoma B16F10 cells were transfected with Myc-FAM86A to overexpress FAM86A, and then FAM86A K/D levels and melanin formation-related MAPK & MC1R through Western blotting of Example 2-5. The expression levels of the signaling pathway proteins were confirmed.
  • the cells were cultured for 48 hours in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ). Then, it was washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper. Then, after quantifying the protein by BCA assay, electrophoresis was performed using 10% SDS-PAGE.
  • the PVDF membrane on which the protein was transferred was transferred to TBS-T (in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA).
  • TBS-T in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA.
  • the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and TBS-T was sufficiently used. Washed. And the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T. Then, the ECL detection system was used to determine the amount and location of specific proteins. Correction of the amount of protein was confirmed by recycling (stripping) the PVDF membrane and confirming the amount of actin protein.
  • Each antibody was purchased from Cell signaling and Santacruz.
  • Example 4-1 Confirmation of increased melanin formation in ⁇ -MSH-induced melanocytes
  • ⁇ -MSH melanocyte stimulating hormone
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate so as to be 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then the FAM86A gene was extracted using the FAM86A shRNA represented by SEQ ID NO: 17 in Table 1. After knocking down. ⁇ -MSH was treated to be 100 nM. The treated cells were cultured in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ) for 48 hours, and then the cell culture solution was removed, and 200 ⁇ l of cell lysis buffer was treated in each well to lyse the cells. After centrifugation at 12,000 rpm for 5 minutes at °C, the supernatant was removed.
  • CO 2 carbon dioxide
  • FAM86A shRNA Homo sapiens, Mus musculus sequence and target sequence sequence (shRNA sequence used in the examples shown in bold ) Species shRNA No. Gene NCBI accession No. shRNA sequence Target sequence Vector Mean Knockdown level Homo sapiens One FAM86A NM_201400.4 CCGGGCAGAAACTGTTTCCCTACGACTCGAGTCGTAGGGAAACAGTTTCTGCTTTTTG (SEQ ID NO: 11) GCAGAAACTGTTTCCCTACGA (SEQ ID NO: 21) pLKO.1 0.93 2 FAM86A NM_201400.4 CCGGCGAGGGAATGTCCTTCTCAATCTCGAGATTGAGAAGGACATTCCCTCGTTTTTG (SEQ ID NO: 12) CGAGGGAATGTCCTTCTCAAT (SEQ ID NO: 22) pLKO.1 0.84 3 FAM86A NM_201400.4 CCGGGATGTTGTCATTGCAGCAGATCTCGAGATCTGCTGCAATGACAACATC
  • FAM86A miRNA Homo sapiens, Mus musculus sequence and target sequenc sequence Species miRNA miRNA target gene miRNA target region miRNA sequence miRNA target sequence Reference Homo sapiens miR-145 FAM86A 397-404 of 3'UTR caccttgtcctcacggtccagttttcccaggaatcccttagatgctaagatggggattcctggaaatactgttcttgaggtcatggtttggaaatactgttcttgagg tcatggttt (SEQ ID NO: 40) aggaatc Integrated MicroRNA-mRNA profiling identifies oncostatin M as a marker of mesenchymal-like ER-negative/HER2-negative breast cancer, Target scan human_prediction of microRNA targets miR-204 FAM86A 767-773 of 3'UTR ggctacagtctttcttcatgtg
  • FAM86 Family Sequence Homo sapiens, Mus musculus sequence Species Gene NCBI accession No. Sequence Homo sapiens FAM86A NM_201400.4 (SEQ ID NO: 6) atggcgcccgaggagaacgcggggaccgaactcttgctgcagagtttcgagcgccgcttcctggcggcacgcacactgcgctccttcccctggcagagcttagaagcaaagttaagagactcatcagattctgagctgctgcgggatattttgcacaagactgtgaagcatcctgtgtgtgtgaagcacccgccgtccgtcaaatatgcccggtgcttctctcagaactcatcaaaaagcaccccggtgctttctctcagaact
  • ⁇ -MSH melanocyte stimulating hormone
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to be 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A (family with sequence similarity 86, member A) represented by SEQ ID NO: 17 After knocking down the FAM86A gene using shRNA, ⁇ -MSH was treated to be 100 nM.
  • the treated cells were cultured in a cell incubator under conditions of 37° C. and 5% carbon dioxide (CO 2 ) for 48 hours, and then 800 ⁇ l of the cell culture solution was transferred to a new tube and centrifuged at 12,000 rpm for 5 minutes at 4° C. to obtain a supernatant.
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene.
  • FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene.
  • Cells were cultured in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ) for 48 hours, and then the cell culture solution was removed, and 200 ⁇ l of cell lysis buffer was applied to each well to lyse the cells, and then at 4°C at 12,000 rpm. After centrifugation for 5 minutes, the supernatant was removed.
  • CO 2 carbon dioxide
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene.
  • Cells were cultured in a cell incubator under conditions of 37° C. and 5% carbon dioxide (CO 2 ) for 48 hours, and then 800 ⁇ l of the cell culture solution was transferred to a new tube and centrifuged at 12,000 rpm for 5 minutes at 4° C. to obtain a supernatant. 100 ⁇ l of the obtained supernatant was dispensed into a 96-well plate and absorbance was measured at 475 nm. At this time, the amount of melanin secretion was calculated based on the amount of melanin in cells that did not knock down the FAM86A gene.
  • Example 4-5 Western blotting to confirm the expression of melanin formation signaling pathway protein
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene. I did.
  • the cells were cultured for 48 hours in a cell incubator at 37° C., 5% carbon dioxide (CO 2 ). Then, it was washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper. Then, after quantifying the protein by BCA assay, electrophoresis was performed using 10% SDS-PAGE.
  • the PVDF membrane on which the protein was transferred was transferred to TBS-T (in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA).
  • TBS-T in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 ( PBST) containing 3% BSA.
  • the primary antibody was treated with TBS-T in which 3% BSA was dissolved for 1 hour, and TBS-T was sufficiently used. Washed. And the secondary antibody was treated for 1 hour and washed 3 times for 10 minutes each with PBS-T. Then, the ECL detection system was used to determine the amount and location of specific proteins. Correction of the amount of protein was confirmed by recycling (stripping) the PVDF membrane and confirming the amount of actin protein.
  • Each antibody was purchased from Cell signaling and Santacruz.
  • Example 4-6 Fontana-Masson staining to confirm the presence of melanin in cells
  • Example 1 The B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene.
  • Cells were cultured in a cell incubator under conditions of 37°C and 5% carbon dioxide (CO 2 ) for 48 hours, washed twice with PBS, treated with 1 ml of 1% amonical silver nitrate solution in each well, and then dried at 60° C. for 1 hour. Heated through. Then, after washing three times with running water, gold chloride 0.2% solution was treated with 1 ml each for 30 seconds.
  • CO 2 carbon dioxide
  • Example 4-7 Confirmation of melanin formation-related gene expression (realtime PCR)
  • the B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene. I did.
  • the cells were cultured for 48 hours in a cell incubator at 37° C., 5% carbon dioxide (CO 2 ). After 48 hours, all the cell culture was removed, the cells were digested with TRI-Zol, and neutralized with BCP. After separating the supernatant separately from the neutralized liquid, mRNA was precipitated using isopropanol. Subsequently, only the precipitated mRNA was collected using a centrifuge and used in the experiment.
  • Intracellular mRNA was synthesized into cDNA using a cDNA kit, and the expression levels of Tyrosinase, TYRP-1, TYRP-2, and MITF genes, which are genes important for melanin formation, were confirmed through PCR.
  • Example 1 The B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene. I did. Then, it was washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper. Then, after quantifying the protein by BCA assay, the expression of cAMP protein was measured using cAMP ELISA KIT (ab65355).
  • Example 1 The B16F10 cells cultured in Example 1 were aliquoted into a 6-well plate to become 5 ⁇ 10 4 cells per well and cultured for 24 hours, and then FAM86A shRNA represented by SEQ ID NO: 17 was used to induce knockdown of the FAM86A gene. I did. Then, it was washed twice with PBS. Then, after completely removing the PBS, 200 ⁇ l of RIPA buffer, a cell lysis and staining reagent, was put into each dish and scraped using a scraper.
  • the cell lysate was treated with anti-MC1R antibody (3 ⁇ g) and reacted in PBS for 1 hour, and then protein A/G-agarose Beads (protein A/G-agarose beads) were added and reacted for 24 hours at 4°C.
  • the beads were washed 3 times with PBS containing 1 mM DTT, and 5 minutes with 2X protein loading dye (25% SDS, 62.5mM Tris-HCl (pH 6.8), 25% Gylcerol, and 0.01% Bromophenol Blue). Heated to a temperature of 95°C.
  • the samples were subjected to electrophoresis using SDS-PAGE to identify proteins that bind to the MC1R protein, which is pivotal to melanin formation in knock-down cells.
  • FAM86A can be used as a detection biomarker for melanin production.By measuring the FAM86A level, it is confirmed that melanin formation can be detected, and accordingly, pigment-related skin conditions can be diagnosed. I did.
  • the FAM86A protein of the present invention or an agonist thereof can be used as a cosmetic composition for skin whitening.
  • the present inventors have confirmed that there is an effect of preventing and treating melanin deficiency diseases as melanin formation and secretion is increased through inhibition of FAM86A, and inhibitors that control the expression or activity of FAM86A are used to prevent, treat, and treat melanin deficiency diseases. Or it can be seen that it can be used in pharmaceuticals and health functional foods for improvement, cosmetic compositions, and leading materials for their development.
  • the level of FAM86A of the present invention decreases with an increase in the amount of melanin secretion or formation, skin whitening is possible using the FAM86A protein or its agonist, and melanin formation and secretion are promoted when FAM86A is inhibited, and melanin-deficient diseases such as vitiligo Since it can be used in various ways, such as a composition for skin whitening using FAM86A protein or an agonist, and a composition for preventing and treating melanin deficiency disease using FAM86A inhibitor, industrial applicability is possible. have.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Public Health (AREA)
  • Food Science & Technology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Nutrition Science (AREA)
  • Polymers & Plastics (AREA)
  • Mycology (AREA)
  • Pathology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Physics & Mathematics (AREA)
  • Dermatology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Birds (AREA)

Abstract

본 발명은 FAM86A를 이용한 멜라닌 형성 검출 방법 등에 관한 것으로, 본 발명의 FAM86A는 멜라닌 분비 또는 형성량의 증가에 따라 그 수준이 감소하므로, FAM86A 단백질 또는 그 아고니스트를 이용하여 피부 미백이 가능하고, FAM86A 억제 시 멜라닌 형성 및 분비가 촉진되어 백반증 등 멜라닌 결핍 질환의 예방, 치료, 또는 개선이 가능하다. 따라서, FAM86A 단백질 또는 아고니스트를 이용한 피부 미백용 조성물 및 FAM86A 억제제를 이용한 백반증, 백모증을 포함한 멜라닌 결핍 질환의 예방과 치료를 위한 조성물 등 다양한 방면으로 이용될 수 있을 것으로 기대된다.

Description

FAM86A를 이용한 멜라닌 형성 검출 방법
본 발명은 FAM86A를 이용한 멜라닌 형성 검출 방법 등에 관한 것이다.
본 출원은 2019년 8월 16일에 출원된 한국특허출원 제10-2019-0100307호 및 제10-2019-0100308호와 2020년 8월 13일에 출원된 한국특허출원 제10-2020-0101716호 및 제10-2020-0101715호에 기초한 우선권을 주장하며, 해당 출원의 명세서 및 도면에 개시된 모든 내용은 본 출원에 원용된다.
멜라닌(melanin) 색소는 피부색을 결정하며 자외선을 흡수하여 피부를 보호하는 역할을 한다. 멜라닌 색소는 티로신(tyrosine)이라는 아미노산으로 이루어져 있는데, 티로신은 티로시나아제(tyrosinae)라는 효소에 의해 활성화된다. 티로신은 전환 과정에 따라 피오멜라닌(pheomelanin) 또는 유멜라닌(eumelanin)의 두 종류의 멜라닌으로 합성되는데, 피오멜라닌은 황색에서 적색을 띠며, 유멜라닌은 갈색에서 검은색을 띠는 색소로 주로 동양인에게서 볼 수 있다. 멜라닌 색소를 생성하는 멜라닌 세포(melanocyte)는 멜라노블라스트(melanoblast)에서 유래한다. 멜라노블라스트가 자극을 받아 멜라닌 세포로 분화되면, 티로시나아제가 활성화되어 세포 내 함유되어 있는 티로신을 DOPA(3,4-dihydroxy-L-phenyl-alanine)로 변화시키고, 이어서 DOPA는 도파옥시다제(dopaoxidase)라는 효소의 작용으로 도파퀴논(dopaquinone)이라는 물질로 변한 후 멜라닌으로 합성된다. 멜라닌 세포는 멜라닌을 만든 후 피부 상층부의 표피 조직까지 이동하여, 표피 조직에 존재하는 각질 형성 세포(keratinocyte)로 멜라닌을 전달한다. 세포 이동 과정에서 멜라닌 색소는 멜라노좀(melanosome)에 저장되어 운반되는데 생성 초기에는 색이 없다가 점차 상층부로 이동하면서 4-5 단계에 걸쳐 검은 색소로 채워져 마침내 완전한 색소를 띤 성숙한 멜라닌 과립이 된다.
α-멜라노사이트 자극 호르몬(α-melanocyte-stimulating hormone, α-MSH)은 멜라닌 생성에 매우 중요하다. α-MSH는 Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH 2의 아미노산 서열로 이루어져 있으며, 멜라노코틴 1 수용체(melanocortin 1 receptor, MC1-R)의 작용제이다. 작용제가 MC1-R에 결합하면, MC1-R은 아데닐 사이클라제(adenylate cyclase)를 활성화하고, cAMP가 증가하여 PKA가 활성화되며, PKA는 cAMP 반응성 단백질 전사인자(cAMP-responsive element binding protein transcription factor)를 인산화하여 최종적으로 소안구 관련 전사인자(microphthalmia-associated transcription factor, MITF)를 활성화시킨다. MITF는 또한 Wnt, GSK3β, 그리고 MAPK 신호전달계에 의하여 활성화되며, 다양한 자극에 반응하여 타이로시나제(TYR), 타이로시나제 관련 단백질 1(tyrosinase-related protein 1, TYRP1), 도파크롬 타우토머라제(dopachrome tautomerase, DCT; tyrosinase-related protein 2, TRP2라고도 불림) 등 멜라닌 생합성에 관련된 효소의 발현 수준을 조절한다.
사람의 피부색을 결정하는 가장 중요한 요인은 인체 내의 멜라노사이트에서 타이로시나제 등의 여러 가지 효소가 작용하여 생성되는 멜라닌으로서, 멜라닌이 필요 이상으로 많이 생기게 되면 기미, 주근깨 및 점 등과 같은 과색소 침착증을 유발하여 미용상으로 좋지 않은 결과를 가져오게 된다. 그리고 피부 내, 외부의 스트레스적 자극에 의해 생겨난 멜라닌은 스트레스가 사라져도 피부 각질화를 통해서 외부로 배출되기 전까지는 없어지지 않는다.
따라서 이러한 멜라닌의 생성을 억제하기 위한 연구가 진행되고 있으며, 아스코르빈산, 코지산, 알부틴, 하이드로퀴논, 글루타치온 또는 이들의 유도체, 또는 타이로시나제 저해활성을 가진 물질들을 화장료나 의약품에 배합하여 사용되어 오고 있다. 그러나, 이들의 불충분한 미백효과, 피부에 대한 안전성 문제로 인해 그 사용이 제한되고 있다.
한편, 백반증은 멜라닌 세포의 사멸이나 괴사로 인한 여러 가지 크기 및 형태의 백색반이 피부에 나타나는 후천성 탈색소 질환이다. 전세계적으로 인구의 약 1%에서 나타나는 비교적 흔한 질환으로, 인종이나 지역에 따른 차이는 없다. 발생 연령은 10~30세에 가장 많고, 95%의 경우 40세 이전에 발병하고, 환자의 30%에서 가족력이 있다. 백반증의 임상 양상으로는 다양한 크기의 둥글거나 불규칙한 모양의 흰색 반점이 나타나고, 초기에는 탈색 정도가 뚜렷하지 않으나 시간이 경과하면서 뚜렷해지는 경우가 많으며, 정상피부와의 경계가 뚜렷하지 않을 수도 있으나 정상피부색 보다도 진하면서 뚜렷하게 나타날 수 있다. 드문 경우 가려움을 느끼기도 한다. 털이 있는 부위, 특히 머리카락, 눈썹부위에 흰반점이 나타나는 경우는 흰 털이 자라나는 경우도 있다. 백반증은 피부의 어디에나 발병할 수 있으나, 특히 손가락, 발가락, 무릎, 팔꿈치 등의 뼈가 돌출한 부위, 입주위, 코주위, 눈주위, 겨드랑이, 손목 안쪽 등에 자주 발생한다. 그리고 입술이나 성기 등 점막에도 올 수 있으며, 상처를 자주 받는 부위에 특히 잘 발생한다. 백반증의 분포는 좌우 대칭적이거나, 신경에 따른 분포를 보이기도 한다. 백반증은 단순히 피부에 흰 반점이 나타나는 경우 외에 눈의 홍채와 망막의 색소이상을 동반할 수 있으며, 당뇨병, 악성 빈혈, 갑상선 기능 저하 또는 항진, 다운 증후군, 담즙성 간경변, 위암, 아디손병, 원형탈모증, 홍반성 낭창 등의 자가 면역질환과 병발할 수 있다. 백반증이 생기는 원인에 대해서 아직 정확히 밝혀진 바는 없으나, 자가면역설, 스트레스, 바이러스 가설, 신경체액설, 멜라닌 세포 자가 파괴설 등 여러 가지 설이 제시되고 있다. 그 외 고유세포 결손(inherent cellular defect), 유전요인, 세포사멸, 칼슘대사 이상 등의 다양한 인자들이 제시되고 있다.
백반증은 치료를 받지 않을 경우 대부분의 환자에서 병변이 악화되기 때문에 스테로이드나 자외선을 이용한 지속적인 치료를 필요로 한다. 하지만 기존의 치료 방법으로는 적절한 치료가 이루어지지 않는 경우가 많아서 보다 효과적인 치료 방법이 시급히 요구되고 있다.
이에 더하여, 희고 고운 피부를 갖고자 하는 일반 사람의 소망과는 반대로 햇빛에 보기좋게 그을은 피부를 선호하는 추세가 나날이 늘고 있다. 흑인들의 세계에서는 피부가 검을수록 미인으로 받아들여지며 구미나 동양권에서도 건강한 다갈색피부는 스포츠를 할 수 있는 여유의 상징으로 받아들여져서 최근에는 패션에도 이용되고 있다.
이에 종래에는 자외선 차단제를 함유한 선탠오일을 이용하여 일광욕을 하였으나 불펀하고 피부가 거칠어지거나 잔주름이 생기는 등의 단점이 있었다. 또한, 디하이드록시아세톤(dihydroxyacetone)을 이용하여 피부표면에 화학결합을 일으켜 인위적으로 피부를 검게 만들기도 하였다. 그러나, 디하이드록시아세톤은 피부를 거칠게 만들고 자극성을 유발하며, 또한 고른 도포가 어려워 사용시에도 얼룩이 생기며 특히 옷에 오염되면 그 옷을 손상시키는 등의 단점이 있었다.
본 발명이 이루고자 하는 기술적 과제는 멜라닌 형성 검출용 조성물 및 피부 미백 물질을 스크리닝 하는 방법을 제공하는 것으로서, 본 발명자들은 FAM86A 단백질이 멜라닌 생성량과 반비례함을 확인함으로써, FAM86A를 이용하여 멜라닌 형성을 검출하고, 미백 관련 물질을 스크리닝할 수 있음을 확인하였으며, FAM86A를 억제함으로써 백반증 등 멜라닌 결핍 질환의 치료 및 개선 효과를 나타낼 수 있고, FAM86A를 과발현시킴으로써 멜라닌 형성을 감소시킬 수 있음을 확인하였다.
이에, 본 발명의 목적은 FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 조성물을 제공하는 것이다.
본 발명의 다른 목적은 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 키트를 제공하는 것이다.
본 발명의 또 다른 목적은 하기 단계를 포함하는 피부 미백 물질의 스크리닝 방법을 제공하는 것이다.
(a) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(b) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(c) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 증가시킨 물질을 피부 미백 물질로 선별하는 단계.
본 발명의 또 다른 목적은 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 피부 미백용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 색소 침착 질환의 예방 또는 치료용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 FAM86A 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 하기 단계를 포함하는 멜라닌 결핍 질환 예방 또는 치료제의 스크리닝 방법을 제공하는 것이다.
(A) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(B) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(C) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 감소시킨 물질을 멜라닌 결핍 질환 예방 또는 치료제로 선별하는 단계.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당업자에게 명확하게 이해될 수 있을 것이다.
상기 과제를 해결하기 위하여, 본 발명은 FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 조성물; FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제의 멜라닌 형성 검출 용도; 및 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 키트를 제공한다.
또한, 본 발명은 하기 단계를 포함하는 피부 미백 물질의 스크리닝 방법을 제공한다.
(a) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(b) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(c) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 증가시킨 물질을 피부 미백 물질로 선별하는 단계.
이에 더하여, 본 발명은 FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 색소관련 피부 상태 진단용 조성물을 제공한다.
또한, 본 발명은 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 제제를 포함하는 색소관련 피부 상태 진단용 키트를 제공한다.
또한, 하기 단계를 포함하는 색소관련 피부 상태의 진단에 필요한 정보를 제공하기 위한 방법을 제공한다.
(i) 피검체로부터 수득한 시료에서 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 단계; 및
(ii) 상기 FAM86A 단백질 또는 이의 mRNA의 발현 수준을 정상 대조구와 비교하여 FAM86A 단백질 또는 이의 mRNA의 발현 수준이 감소한 피검체를 멜라닌이 과다 생성될 것으로 예측하는 단계.
또한, 본 발명은 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 피부 미백용 조성물; FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물을 개체에 투여하는 단계를 포함하는 피부 미백 방법; FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물의 피부 미백 용도; 및 피부 미백용 제제를 제조하기 위한 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제의 용도를 제공한다.
또한, 본 발명은 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 색소 침착 질환의 예방 또는 치료용 약학적 조성물; FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물을 개체에 투여하는 단계를 포함하는 색소 침착 질환의 예방 또는 치료 방법; FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물의 색소 침착 질환의 예방 또는 치료 용도; 및 색소 침착 질환 약제를 제조하기 위한 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제의 용도를 제공한다.
본 발명의 일 구현예로서, 상기 mRNA의 발현 수준을 측정하는 제제는 FAM86A의 mRNA에 특이적으로 결합하는 프로브 또는 프라이머일 수 있다.
본 발명의 다른 구현예로서, 상기 단백질의 발현 수준을 측정하는 제제는 FAM86A의 단백질에 특이적인 항체 또는 앱타머일 수 있다.
본 발명의 다른 구현 예로서, 상기 FAM86A의 mRNA는 서열번호 6으로 표시되는 염기 서열을 포함하거나 이루어지는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 FAM86A의 단백질은 서열번호 1로 표시되는 아미노산 서열을 포함하거나 이루어지는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 구현예로서, 상기 아고니스트 또는 활성화제는 FAM86A 유전자를 포함하는 발현벡터, 상기 벡터를 포함하는 세포, 화합물 및 펩타이드로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 구현예에서, 상기 색소 침착 질환은 색소 침착, 기미, 주근깨, 잡티, 점, 반점, 오타모반, 푸른 흑피증(cyanic melasma), 임신성 갈색반(gravidic chloasma), 경구 피임약을 복용한 여성에서의 흑피증, 검버섯, 노인성 흑자, 상처, 피부염으로 인한 염증 후 과다 색소 침착 및 멜라닌 피부증으로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물; FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 멜라닌 결핍 질환을 예방 또는 치료하는 방법; FAM86A 억제제를 유효성분으로 포함하는 조성물의 멜라닌 결핍 질환의 예방 또는 치료 용도; 및 멜라닌 결핍 질환의 예방 또는 치료를 위한 약제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
본 발명의 일 구현예로서, 상기 조성물은 이에 제한되는 것은 아니나, 약학적 조성물, 식품 조성물, 또는 화장료 조성물의 형태로 제공되는 것일 수 있다.
본 발명의 다른 구현예로서, 상기 식품 조성물은 건강기능성 식품 조성물일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 구현예로서, 상기 멜라닌 결핍 질환은 백색피부증(leukoderma), 백반증(vitiligo), 쿼디크롬 백반증(quadrichrome vitiligo), 반점성 백반증(vitiligo ponctue), 백색증 증후군(syndromic Albinism)[예컨대, 알레잔드리니 증후군(Alezzandrini syndrome), 헤르만스키-푸들라크 증후군(Hermansky-Pudlak syndrome), 세디아크-히가시 증후군(Chediak-Higashi syndrome), 그리셀리 증후군(Griscelli syndrome)(엘레잘데 증후군(Elejalde syndrome), 그리셀리 증후군 타입 2(Griscelli syndrome type 2) 및 그리셀리 증후군 타입 3(Griscelli syndrome type 3), 바르덴부르크 증후군(Waardenburg syndrome), 티쩨 증후군(Tietz syndrome), 크로스-먹큐직-브린 증후군(CrossMuKusick-Breen syndrome), ABCD 증후군(ABCD syndrome), 백색증-청각장애 증후군(Albinism-deafness syndrome) 및 보그트-고야나기-하라다 증후군(Vogt-Koyanagi-Harada syndrome)], 눈 피부 백색증(oculocutaneous albinism), 백모증(canities), 멜라닌증(hypomelanosis)[물방울모양 저멜라닌증(idiopathic guttate hypomelanosis), 잎모양 저멜라닌증(phylloid hypomelanosis), 진행성 반상 저멜라닌증(progressive macular hypomelanosis)], 얼룩백색증(piebaldism), 탈색 모반(nevus depigmentosus), 염증후 색소침착저하증 (postinflammatory hypopigmentation), 백색비강진(pityriasis alba), 바가본드 백반흑피증(Vagabond's leukomelanoderma), 예맨 시청각장애 색소침착저하 증후군(Yemenite deaf-blind hypopigmentation syndrome), 웬드-바우쿠스 증후군(Wende-Bauckus syndrome), 워로노프 반지증(Woronoff's ring), 멜라닌결핍증(amelanism), 루시즘(Leucism) 및 피부 탈색소 관련 질환으로 이루어진 군으로부터 하나 이상 선택된 것일 수 있으며, 바람직하게는 백반증 또는 백모증일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 구현예로서, 상기 조성물은 멜라닌의 합성 또는 분비를 촉진하는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 억제제는 FAM86A 활성 억제제 또는 발현 억제제일 수 있다.
본 발명의 또 다른 구현예로서, 상기 활성 억제제는 FAM86A 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드모방체, 기질유사체, 앱타머 및 항체로 이루어진 군에서 하나 이상 선택된 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 발현 억제제는 FAM86A 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, RNAi, siRNA, miRNA, shRNA 및 리보자임으로 이루어진 군에서 하나 이상 선택된 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 shRNA는 서열번호 11 내지 서열번호 20으로 이루어진 군으로부터 하나 이상 선택된 염기서열로 표시되는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 shRNA는 서열번호 21 내지 서열번호 30으로 이루어진 군으로부터 하나 이상 선택된 염기서열을 타겟으로 하는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 miRNA는 서열번호 40 내지 서열번호 45로 이루어진 군으로부터 하나 이상 선택된 염기서열로 표시되는 것일 수 있다.
또한, 본 발명은 하기 단계를 포함하는 멜라닌 결핍 질환 예방 또는 치료제의 스크리닝 방법을 제공한다.
(A) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(B) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(C) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 감소시킨 물질을 멜라닌 결핍 질환 예방 또는 치료제로 선별하는 단계.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 멜라닌 생성 촉진용 조성물; FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 멜라닌 생성을 촉진하는 방법; FAM86A 억제제를 유효성분으로 포함하는 조성물의 멜라닌 생성 촉진 용도; 및 멜라닌 생성 촉진제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
본 발명의 일 구현예에서, 상기 멜라닌 생성 촉진은 백모 방지용, 흑모 유발 촉진용 및 개체 색 조절용으로 이루어진 군으로부터 선택된 하나 이상을 위한 것일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 흑모 유발 촉진용 조성물; FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 백모를 방지하거나 흑모 유발을 촉진하는 방법; FAM86A 억제제를 유효성분으로 포함하는 조성물의 백모 방지 또는 흑모 유발 촉진 용도; 및 백모 방지제 또는 흑모 유발 촉진제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 개체의 색 조절용 조성물; FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 개체의 색을 조절하는 방법; FAM86A 억제제를 유효성분으로 포함하는 조성물의 개체의 색 조절 용도; 및 개체의 색 조절제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
본 발명의 FAM86A는 멜라닌 분비 또는 형성량의 증가에 따라 그 수준이 감소하므로, FAM86A 단백질 또는 그 아고니스트를 이용하여 피부 미백이 가능하고, FAM86A 억제 시 멜라닌 형성 및 분비가 촉진되어 백반증 등 멜라닌 결핍 질환의 예방, 치료, 또는 개선이 가능하다. 따라서, FAM86A 단백질 또는 아고니스트를 이용한 피부 미백용 조성물 및 FAM86A 억제제를 이용한 백반증, 백모증을 포함한 멜라닌 결핍 질환의 예방과 치료를 위한 조성물 등 다양한 방면으로 이용될 수 있을 것으로 기대된다.
도 1은 C57BL/6 마우스에 UVB (1mJ)을 처리한 뒤 시간별로 FAM86A 단백질 발현량을 western blotting analysis를 통해 확인한 결과를 나타낸 것이며(상단), 또한 동일 샘플을 이용하여 멜라닌 생성량을 melanin contents assay를 통해 확인한 결과를 나타낸 것이다(하단).
도 2는 ICR(백색-알비노) 쥐와, C57BL/6(검정) 마우스의 등 조직에서 FAM86A의 발현량을 western blotting analysis를 통해 확인한 결과를 나타낸 것이다.
도 3은 C57BL/6 마우스의 검정 털 피부(귀와 귀 사이), 흰 털 피부 (귀 뒤 부분)의 조직에서 FAM86A의 발현량을 Western blotting analysis를 통해 확인한 결과를 나타낸 것이다.
도 4는 마우스 흑색종 세포를 이용하여 멜라닌 형성을 유도하는 α-MSH를 처리한 뒤 FAM86A 단백질 발현량을 western blotting analysis로 확인한 결과를 나타낸 것이고(상단), 멜라닌 생성량을 melanin contents assay를 통해 확인한 결과를 나타낸 것이다(하단).
도 5는 마우스 흑색종 세포를 이용하여 멜라닌 형성을 유도하는 a-MSH를 처리한 뒤 멜라닌 형성에 관여하는 유전자(Tyrosinase, TYRP-1, TYRP-2, MITF) 및 FAM86A 유전자의 발현량을 real-time PCR을 이용하여 확인한 결과이다.
도 6은 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 멜라닌 형성에 중요한 단백질인 cAMP의 발현 수준을 측정한 결과이다.
도 7은 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 폰타나 마손 염색을 통해 멜라닌 발현을 확인한 결과이다.
도 8은 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 멜라닌 분비 어세이를 통해 멜라닌 분비량을 확인한 결과이다.
도 9는 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 멜라닌 분비 어세이를 통해 멜라닌 생성량을 확인한 결과이다.
도 10은 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 RT-PCR을 이용하여 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, 및 MITF의 발현량을 측정한 결과이다.
도 11은 마우스 흑색종 세포에 FAM86A를 과발현시킨 후 웨스턴 블롯을 통해 MAPK 및 MC1R 신호전달경로 단백질인 MC1R, p-CREB 및 MITF의 발현량을 측정한 결과이다.
도 12는 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 멜라닌형성을 촉진시키는 α-MSH를 처리하여 melanin contents assay를 통해 멜라닌 생성량을 확인한 결과이다.
도 13은 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 멜라닌형성을 촉진시키는 α-MSH를 처리하여 melanin secretion assay를 통해 멜라닌 분비량을 확인한 결과이다.
도 14는 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 melanin contents assay를 통해 멜라닌 생성량을 확인한 결과이다.
도 15는 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 melanin secretion assay를 통해 멜라닌 분비량을 확인한 결과이다.
도 16은 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 western blotting analysis를 통해 FAM86A K/D 수준 및 멜라닌 형성과 관련된 MAPK & MC1R 신호전달경로 단백질인 ERK, JNK, p38, PKA, CREB, MITF, Tyrosinase의 발현량을 확인한 결과이다.
도 17은 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 폰타나 마손 염색을 통하여 멜라닌을 염색하여 멜라닌 존재 정도를 현미경을 통해 확인한 결과이다.
도 18은 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 real-time PCR 법을 이용하여 멜라닌 형성에 중추적인 유전자(Tyrosinase, TYRP-1, TYRP-2, MITF) 발현량을 측정한 결과이다.
도 19는 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 멜라닌 형성에 중요한 단백질인 cAMP의 발현을 ELISA를 이용하여 측정한 결과이다.
도 20은 마우스 흑색종 세포에 shRNA를 이용하여 FAM86A를 knockdown 시킨 후 면역침전-MC1R로 진행하여 knockdown 된 세포에서 멜라닌 형성에 중추적인 MC1R 단백질에 바인딩하는 단백질들을 확인한 결과이다.
이하 본 발명을 상세히 설명한다.
본 발명자들은 실시예를 통하여, FAM86A와 멜라닌과의 관계를 연구하던 중, α-MSH로 유도하여 멜라닌 형성을 촉진시켰을 때, FAM86A 발현이 오히려 감소하는 것을 확인하였으며,
멜라닌 결핍 질환을 치료하기 위하여 멜라닌과 관련된 새로운 치료 표적을 연구하던 중 FAM86A 억제제가 백모증 및 백반증을 포함하는 멜라닌 결핍 질환에 대한 치료 및 개선 효과가 있음을 확인하여 본 발명을 완성하였다(본 발명의 실시예 참조).
본 명세서에서, 용어 "단백질"은 '폴리펩타이드(polypeptide)' 또는 '펩타이드(peptide)'와 호환성 있게 사용되며, 예컨대, 자연 상태의 단백질에서 일반적으로 발견되는 바와 같이 아미노산 잔기의 중합체를 말한다.
본 명세서에서, "폴리뉴클레오티드(polynucleotide)" 또는 "핵산"은 단일 또는 이중 가닥의 형태로 된 데옥시리보핵산(deoxyribonucleic acid, DNA) 또는 리보핵산(ribonucleic acid, RNA)를 말한다. 다른 제한이 없는한, 자연적으로 생성되는 뉴클레오티드와 비슷한 방법으로 핵산에 혼성화되는 자연적 뉴클레오티드의 공지된 아날로그도 포함된다. 일반적으로 DNA는 아데닌(adenine, A), 구아닌(guanine, G), 시토신(cytosine, C), 티민(thymine, T) 등 네 가지 염기로 구성되어 있으며, RNA는 티민 대신 우라실(Uracil, U)을 가지고 있다. 핵산 이중 가닥에서 A는 T 또는 U, C는 G 염기와 수소결합을 이루는데, 이러한 염기의 관계를 "상보적(complementary)'이라고 한다.
한편, 'mRNA(messenger RNA 또는 전령 RNA)'는 단백질 합성 과정에서 특정 유전자의 염기서열의 유전 정보를 리보솜(ribosome)으로 전달하여 폴리펩티드 합성(단백질 번역, translation)의 청사진 역할을 하는 RNA이다. 유전자를 주형(template)으로 하여 단일 가닥의 mRNA가 전사(transcription) 과정을 통하여 합성된다.
본 명세서에서, "FAM86"은 단백질 MTase 패밀리에 속하는 단백질로, 대부분 포유류의 게놈에는 단일 FAM86 유전자가 존재하며, 영장류의 FAM86은 종양이 발생하기 쉬운 부분의 복제영역 내에 포함되어 있고, 여러 게놈위치에 퍼져 있는 것으로 알려져 있다(Identification and Characterization of a Novel Evolutionarily Conserved Lysine-specific Methyltransferase Targeting Eukaryotic Translation Elongation Factor 2 (eEF2), JOURNAL OF BIOLOGICAL CHEMISTRY, VOLUME 289, NUMBER 44, OCTOBER 31, 2014).
본 명세서에서, 상기 FAM86은 FAM86A일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, FAM86A 단백질은 포유류에서 유래한 것일 수 있으며, 바람직하게는 인간에서 유래한 것이다. 가장 바람직하게, 본 발명에서의 FAM86A 단백질은 서열번호 1로 표시되는 인간의 FAM86A(NP_958802.1)로 표시되는 아미노산 서열을 포함하는 것을 특징으로 한다(괄호 안은 NCBI Genbank accession number).
상기 FAM86 mRNA는 바람직하게는 서열번호 6으로 표시되는 인간 FAM86A mRNA(NM_201400.4)로 표시되는 염기서열을 포함하는 것이다(괄호 안은 NCBI Genbankaccession number). 상기한 인간의 FAM86A mRNA transcript variant들의 coding region(exon) 등의 특징 사항은 괄호 안에 기재된 Genbank accession number로 NCBI 데이터베이스를 검색하여 나오는 서열정보에서 확인된다.
본 명세서에서 사용되는 용어 "상보적(complementary)"은 소정의 혼성화 또는 어닐링 조건, 구체적으로는 생리학적 조건 하(세포 내)에서 핵산 분자 내 타겟팅 모이어티가 타겟(예컨대, FAM86A 유전자)에 선택적으로 혼성화할 정도로 충분히 상보적인 것을 의미하는 것으로 하나 또는 그 이상의 미스매치(mismatch) 염기서열을 가질 수 있으며, 실질적으로 상보적(substantially complementary) 및 완전히 상보적(perfectly complementary)인 것을 모두 포괄하는 의미를 가지며, 보다 구체적으로는 완전히 상보적인 것을 의미한다.
이에, 본 발명은 FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 조성물 또는 색소관련 피부 상태 진단용 조성물을 제공한다.
또한, 본 발명은 FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 멜라닌 과다생성 검출용 조성물을 제공한다.
본 명세서에서, 용어 '검출'은 목적하는 물질(본 발명에서의 마커 단백질, FAM86A)의 존재(발현) 여부를 측정 및 확인하는 것, 또는 목적하는 물질의 존재 수준(발현 수준)의 변화를 측정 및 확인하는 것을 모두 포함하는 의미이다. 같은 맥락에서, 본 발명에서 상기 단백질의 발현수준을 측정하는 것은 발현 여부를 측정하는 것(즉, 발현 유무를 측정하는 것), 또는 상기 단백질의 질적, 양적 변화 수준을 측정하는 것을 의미한다. 상기 측정은 정성적인 방법(분석)과 정량적인 방법을 모두 포함하여 제한 없이 수행될 수 있다. 단백질 수준의 측정에 있어서 정성적 방법과 정량적 방법의 종류는 당업계에 잘 알려져 있으며, 본 명세서에서 기술한 실험법들이 이에 포함된다. 각 방법 별로 구체적 단백질 수준 비교 방식은 당업계에 잘 알려져 있다. 따라서 상기 FAM86A 단백질 검출은 FAM86A 단백질의 존재 여부 검출, 또는 상기 단백질 발현량의 증가(상향 조절) 또는 감소(하향 조절)를 확인하는 것을 포함하는 의미이다.
본 명세서에서, 단백질의 '발현 증가(또는 고발현)'라는 의미는 발현되지 않던 것이 발현된 것(즉, 검출되지 않던 것이 검출된 것) 또는 정상적인 수준보다 상대적으로 과발현된 것(즉, 검출량이 많아지는 것)을 의미한다. 이의 반대적 용어의 의미는 당업자라면 상기 정의에 준하여, 반대의미를 가지는 것으로 이해 가능하다.
본 명세서에서, 상기 mRNA의 발현 수준을 측정하는 제제는 FAM86A의 mRNA에 특이적으로 결합하는 프로브 또는 프라이머일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 상기 단백질의 발현 수준을 측정하는 제제는 FAM86A의 단백질에 특이적인 항체 또는 앱타머일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 다른 구현 예로서, 상기 FAM86A의 mRNA는 서열번호 6으로 표시되는 염기 서열을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 상기 FAM86A의 단백질은 서열번호 1로 표시되는 아미노산 서열을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 '프라이머(primer)'는 DNA 합성의 개시점(starting point)으로 작용하는 짧은 단일가닥 올리고뉴클레오티드(single strand oligonucleotide)이다. 프라이머는 적합한 완충액(buffer)와 온도 조건에서 주형(template)인 폴리뉴클레오티드에 특이적으로 결합하고, DNA 중합효소가 프라이머에 주형 DNA에 상보적인 염기를 갖는 뉴클레오사이드 트리포스페이트를 추가하여 연결함으로써 DNA가 합성된다. 프라이머는 일반적으로 15 내지 30개의 염기서열로 이루어져 있으며, 염기 구성과 길이에 따라 주형 가닥에 결합하는 온도(melting temperature, Tm)가 달라진다. 프라이머의 서열은 주형의 일부 염기 서열과 완전하게 상보적인 서열을 가질 필요는 없으며, 주형과 혼성화되어 프라이머 고유의 작용을 할 수 있는 범위 내에서의 충분한 상보성을 가지면 충분하다. 따라서 본 발명에서 상기 FAM86A mRNA의 발현 수준을 측정하기 위한 프라이머는 각 유전자 서열에 완벽하게 상보적인 서열을 가질 필요는 없으며, DNA 합성을 통해 mRNA 또는 cDNA의 특정 구간을 증폭하여 mRNA의 양을 측정하려는 목적에 맞는 길이와 상보성을 갖는 것이면 충분하다. 상기 증폭 반응을 위한 프라이머는 증폭하고자 하는 mRNA의 특정 구간의 양쪽 끝부분의 주형(또는 센스, sense)과 반대편(안티센스, antisense)에 각각 상보적으로 결합하는 한 세트(쌍)으로 구성된다. 프라이머는 당업자라면 KRS 또는 AIMP1의 mRNA 또는 cDNA 염기서열을 참조하여 용이하게 디자인할 수 있다. 본 발명에서 상기 프라이머는 바람직하게는 서열번호 6으로 표시되는 FAM86A의 mRNA에 특이적으로 결합하는 한 세트, 한 쌍 또는 이들의 조합일 수 있다.
상기 '프로브(probe)'는 특정 유전자의 mRNA나 cDNA(complementary DNA)에 특이적으로 결합할 수 있는 짧게는 수개 내지 길게는 수백 개의 염기(base pair) 길이의 RNA 또는 DNA 등 폴리뉴클레오티드의 단편을 의미하며, 표지(labeling)되어 있어서 결합하는 대상 mRNA나 cDNA의 존재 유무, 발현량 등을 확인할 수 있다. 본 발명의 목적을 위해서는 FAM86A mRNA에 상보적인 프로브를 피검체의 시료와 혼성화 반응(hybridization)을 수행하여 FAM86A mRNA의 발현량을 측정함으로써 색소관련 피부 상태의 진단 또는 멜라닌 과다생성 검출에 이용할 수 있다. 프로브의 선택 및 혼성화 조건은 당업계에 공지된 기술에 따라 적절하게 선택할 수 있다. 본 발명에서 상기 프라이머 또는 프로브는 포스포아미다이트(phosphoramidite) 고체지지체 합성법이나 기타 널리 공지된 방법을 이용하여 화학적으로 합성할 수 있다. 또한 프라이머 또는 프로브는 FAM86A mRNA와의 혼성화를 방해하지 않는 범위에서 당해 기술분야에 공지된 방법에 따라 다양하게 변형시킬 수 있다. 이러한 변형의 예로는 메틸화, 캡화, 천연 뉴클레오티드 하나 이상의 동족체로의 치환 및 뉴클레오티드 간의 변형, 예를 들면 하전되지 않은 연결체(예: 메틸 포스포네이트, 포스포트리에스테르, 포스포로아미데이트, 카바메이트 등) 또는 하전된 연결체(예: 포스포로티오에이트, 포스포로디티오에이트 등), 그리고 형광 또는 효소를 이용한 표지 물질(labeling material)의 결합 등이 있다.
상기 항체란 항원성 부위에 대해서 지시되는 특이적인 단백질 분자를 의미한다. 본 발명에 사용되는 항체는 단클론 또는 다클론 항체, 면역학적으로 활성인 단편(예를 들어, Fab 또는 (Fab)2 단편), 항체 중쇄, 인간화 항체, 항체 경쇄, 유전자 조작된 단일쇄 Fν 분자, 키메릭 항체 등일 수 있다.
상기 앱타머란 시료 내의 검출하고자 하는 분석물질과 특이적으로 결합할 수 있는 물질로 그 자체로 안정된 삼차 구조를 가지는 단일 가닥 핵산(DNA, RNA, 또는 변형 핵산)을 의미하는 것으로, 특이적으로 시료 내의 표적 단백질의 존재를 확인할 수 있다. 앱타머의 제조는 일반적인 앱타머의 제조 방법에 따라, 확인하고자 하는 표적 단백질에 대해 선택적이고 높은 결합력을 가지는 올리고뉴클레오티드의 서열을 결정하여 합성한 후, 올리고뉴클레오티드의 5' 말단이나 3' 말단을 앱타머 칩의 관능기에 결합할 수 있도록, -SH, -COOH, -OH 또는 NH 2로 변형을 시킴으로써 이루어질 수 있으나, 이에 제한되지 않는다.
FAM86A 단백질은 공지된 단백질이므로 본 발명에 사용되는 항체는 단백질을 항원으로 하여 면역학 분야에서 널리 알려져 있는 통상의 방법으로 제조할 수 있다. 본 발명에 따른 항체의 항원으로서 사용되는 FAM86A 단백질은 천연에서 추출하거나 합성될 수 있으며 DNA 서열을 기초로 하여 재조합 방법에 의해 제조될 수 있다. 유전자 재조합 기술을 이용할 경우 FAM86A 단백질을 코딩하는 핵산을 적절한 발현 벡터에 삽입하고, 재조합 발현 벡터로 형질전환된 형질전환체에서 FAM86A 단백질이 발현되도록 숙주 세포를 배양한 후 형질전환체로부터 FAM86A 단백질을 회수함으로써 수득될 수 있다.
예를 들어, 다클론 항체는 FAM86A 단백질 항원을 동물에 주사하고 동물로부터 채혈하여 항체를 포함하는 혈청을 수득하는 방법에 의해 생산할 수 있다. 이러한 항체는 말, 소, 염소, 양, 개, 닭, 칠면조, 토끼, 마우스 또는 래트와 같은 여러 온혈 동물을 이용하여 제조할 수 있다.
단클론 항체도 공지된 융합방법(fusion method)(Kohler and Milstein, European J. Immnunol. 6:511-519, 1976), 재조합 DNA 방법(미국특허 제4816567호) 및 파지 항체 라이브러리(Clackson et al., Nature, 352, 624-628, 1991; Marks et al., J. Mol. Biol. 222, 58:1-597, 1991) 기술을 이용하여 제조할 수 있다.
한편, 본 발명은 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 키트 또는 색소관련 피부 상태 진단용 키트를 제공한다.
본 발명의 키트는 FAM86A의 단백질 항체이외에 면역학적 분석에 사용되는 당 업계에 공지된 도구 및/또는 시약을 추가로 포함할 수 있다.
상기에서 면역학적 분석은 항원과 항체의 결합을 측정할 수 있는 있는 방법이라면 모두 포함될 수 있다. 이러한 방법들은 당 분야에 공지되어 있으며 예를 들어, 면역세포화학 및 면역조직화학, 방사선 면역 분석법(radioimmunoassays), 효소결합면역법(ELISA: Enzyme Linked Immunoabsorbent assay), 면역 블롯(immunoblotting), 파아르 분석법(Farr assay), 면역침강, 라텍스 응집, 적혈구 응집, 비탁계법, 면역확산법, 카운터-전류 전기영동법, 단일 라디칼 면역확산법, 단백질 칩 및 면역형광법이 있다.
면역학적 분석에 사용되는 도구 및/또는 시약으로는 적합한 담체 또는 지지체, 검출 가능한 신호를 생성할 수 있는 표지, 용해제, 세정제가 포함된다. 또한, 표지물질이 효소인 경우에는 효소활성을 측정할 수 있는 기질 및 반응 정지제를 포함할 수 있다.
본 발명의 검출용 또는 진단용 키트에 포함되는 FAM86A은 바람직하게는 적합한 담체 또는 지지체에 문헌에 개시된 바와 같은 다양한 방법을 이용하여 고정될 수 있으며(Antibodies: A Labotory Manual, Harlow ＆ Lane;Cold SpringHarbor, 1988), 적합한 담체 또는 지지체의 예로는 아가로스, 셀룰로즈, 니트로셀룰로즈, 덱스트란, 세파덱스, 세파로즈, 리포솜, 카복시메틸 셀룰로즈, 폴리아크릴아미드, 폴리스테린, 반려암, 여과지, 이온교환수지, 플라스틱 필름, 플라스틱 튜브, 유리, 폴리아민-메틸 비닐-에테르-말레산 공중합체, 아미노산 공중합체, 에틸렌-말레산 공중합체, 나일론, 컵, 플랫 팩(flat packs) 등이 포함된다. 그 외의 다른 고체 기질로는 세포 배양 플레이트, ELISA 플레이트, 튜브 및 폴리머성 막이 있다. 상기 지지체는 임의의 가능한 형태, 예를 들어 구형(비드), 원통형(시험관 또는 웰 내면), 평면형(시트, 시험 스트립)을 가질 수 있다.
검출 가능한 신호를 생성할 수 있는 표지는 항원-항체 복합체의 형성을 정성 또는 정량적으로 측정가능하게 하며, 이의 예로는 효소, 형광물질, 리간드, 발광물질, 미소입자(microparticle), 레독스 분자 및 방사성 동위원소 등을 사용할 수 있다. 효소로는 β-글루쿠로니다제, β-D-글루코시다제, 우레아제, 퍼옥시다아제, 알칼라인 포스파타아제, 아세틸콜린에스테라아제, 글리코즈 옥시다아제, 헥소키나제, 말레이트 디하이드로게나아제, 글루코스-6-인산디하이드로게나아제, 인버타아제 등을 사용할 수 있다. 형광물질로는 플루오레신, 이소티오시아네이트, 로다민, 피코에리테린, 피코시아닌, 알로피코시아닌, 플루오르신이소티옥시아네이트 등을 사용할 수 있다. 리간드로는 바이오틴 유도체 등이 있으며, 발광물질로는 아크리디늄 에스테르, 루시페린, 루시퍼라아제 등이 있다. 미소입자로는 콜로이드 금, 착색된 라텍스 등이 있고 레독스 분자로는 페로센, 루테늄 착화합물, 바이올로젠, 퀴논, Ti 이온, Cs 이온, 디이미드, 1,4-벤조퀴논, 하이드로퀴논 등이 있다. 그러나 상기 예시된 것들 외에 면역학적 분석법에 사용할 수 있은 것이라면 어느 것이라도 사용할 수 있다.
또한, 본 발명은 하기 단계를 포함하는 피부 미백 물질의 스크리닝 방법을 제공한다.
(a) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(b) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(c) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 증가시킨 물질을 피부 미백 물질로 선별하는 단계.
또한, 본 발명은 하기 단계를 포함하는 멜라닌 결핍 질환 예방 또는 치료제의 스크리닝 방법을 제공한다.
(A) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
(B) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
(C) 시험물질을 처리하지 않은 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 감소시킨 물질을 멜라닌 결핍 질환 예방 또는 치료제로 선별하는 단계.
본 명세서에서, 상기 FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포는 FAM86A의 단백질 또는 이의 mRNA가 내인적으로(endogenous) 발현 또는 일시적으로 고발현된 세포를 포함하며, 또는 FAM86A을 암호화하는 핵산을 세포 내에 도입하여 형질전환시킴으로써 과발현 되도록 하여 사용할 수 있으나, 이에 특별히 제한되지 않는다.
본 명세서에서, 상기 FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포는 멜라닌을 과다 생성하는 것일 수 있으나, 이에 특별히 제한되지 않는다.
본 명세서에서, "발현(expression)"은 세포에서 단백질 또는 핵산이 생성되는 것을 의미한다. 상기 FAM86A를 발현하는 세포는 FAM86A를 내재적으로 발현하는 세포일 수도 있고, FAM86A를 암호화하는 폴리뉴클레오티드를 포함하는 재조합 발현 벡터로 형질전환되어 FAM86A를 과발현하는 세포일 수도 있다. 바람직하게는 상기 FAM86A 유전자를 발현하는 세포는 멜라닌 세포에서 유래한 세포일 수 있다. 본 발명자들은 FAM86A를 내재적으로 발현하는 세포로서 B6F10 세포주를 사용한 바 있다.
본 발명 스크리닝 방법을 언급하면서 사용되는 용어 "시험물질"은 본 발명의 FAM86A의 발현에 영향을 미치는지 여부를 검사하기 위하여 스크리닝에서 이용되는 미지의 물질을 의미한다. 상기 시험물질은 siRNA(small interference RNA), shRNA(short hairpin RNA), miRNA(microRNA), 리보자임(ribozyme), DNAzyme, PNA(peptide nucleic acids), 안티센스 올리고뉴클레오타이드, 항체, 앱타머, 천연추출물 또는 화학물질을 포함하나, 이에 제한되는 것은 아니다.
또한, 상기 (a) 단계 또는 (A) 단계에서 사용되는 세포는 실험동물의 형태로 제공될 수 있으며, 이 경우 본 발명의 스크리닝 방법은 상기 실험동물에게 멜라닌 형성을 유도하는 단계를 추가로 포함하며, 시험물질과의 접촉은 비경구 또는 경구투여, 정위주사를 포함하나, 이로 제한하는 것은 아니며, 당업자라면 시험물질을 동물에게 테스트하기 위해 적절한 방법을 선택할 수 있을 것이다.
시험물질을 처리하는 것은 시험물질을 세포 또는 조직 배양 배지에 추가한 후 세포를 일정 시간 배양하는 것을 의미한다. 상기 세포가 실험동물 형태로 제공될 때, 시험물질과의 접촉은 비경구 또는 경구 투여, 정위주사를 포함하는 이로 제한되는 것은 아니며, 당업자라면 시험물질을 동물에게 테스트하기 위해 적절한 방법을 선택할 수 있을 것이다.
본 발명의 상기 (b) 단계 또는 (B) 단계에서 mRNA의 발현량 측정은 RT-PCR, 정량적 또는 반정량적 RT-PCR(Quentitative or semi-Quentitative RT-PCR), 정량적 또는 반정량적 리얼 타임 RT-PCR(Quentitative or semi-Quentitative real-timeRT-PCR), 노던 블롯(northern blot) 및 DNA 또는 RNA 칩(chip)으로 이루어지는 군에서 하나 이상 선택된 방법을 이용하여 측정되는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 상기 (b) 단계 또는 (B) 단계에서 상기 단백질 발현량 측정은 웨스턴 블롯, ELISA, 방사선면역분석법, 방사면역확산법, 오우크레로니(Ouchterlony) 면역확산법, 로케트 면역전기영동, 면역조직화학염색, 면역침전분석, 보체고정분석, FACS 및 단백질 칩으로 이루어진 군에서 하나 이상 선택된 방법을 이용하여 측정되는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 (c) 단계 또는 (C) 단계는 대조군 세포와 비교하여 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 증가시킨 물질을 피부 미백 물질로 선별하는 단계이다.
상기 (c) 단계 또는 (C) 단계는 대조군 세포와 비교하여 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 감소시킨 물질을 멜라닌 결핍 질환 예방 또는 치료제로 선별하는 단계이다.
상기 대조군 세포는 시험물질을 처리하지 않은 세포일 수 있으며, 이에 제한되는 것은 아니다.
본 명세서에서, 시험 물질이 접촉된 멜라닌 과다생성 시료에서의 FAM86 유전자 또는 단백질의 발현 정도가 후보물질 접촉되지 않은 멜라닌 과다생성 시료에서의 해당 유전자 또는 단백질의 발현 정도보다 증가된 경우, 상기 후보물질을 멜라닌 생성 억제제 및/또는 색소성 피부질환 치료제 및/또는 피부 미백제로 판단하는 단계를 포함하는 것일 수 있다.
본 명세서에서, 시험 물질이 접촉된 멜라닌 과다생성 시료에서의 FAM86 유전자 또는 단백질의 발현 정도가 후보물질 접촉되지 않은 멜라닌 과다생성 시료에서의 해당 유전자 또는 단백질의 발현 정도보다 감소된 경우, 상기 후보물질을 멜라닌 생성 촉진제 및/또는 색초 침착 질환 치료제로 판단하는 단계를 포함하는 것일 수 있다.
또한, 본 발명은 하기 단계를 포함하는 색소관련 피부 상태의 진단에 필요한 정보를 제공하기 위한 방법을 제공한다.
(i) 피검체로부터 수득한 시료에서 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 단계; 및
(ii) 상기 FAM86A 단백질 또는 이의 mRNA의 발현 수준을 정상 대조구와 비교하여 FAM86A 단백질 또는 이의 mRNA의 발현 수준이 감소한 피검체를 멜라닌이 과다 생성될 것으로 예측하는 단계.
본 발명에서 색소관련 피부 상태란, 멜라닌 색소와 관련된 피부 유형 내지 피부상태를 나타내는 피부 관련 정보를 의미한다. 본 발명은 다양한 피부 특성 중 특히, 색소침착과 관련된 정보를 그 진단 대상으로 한다.
본 발명에서 상기 생물학적 시료는 색소관련 피부 상태를 진단하고자 하는 피검체로부터 채취된 것이라면 제한없이 사용할 수 있으며, 예를 들어 생검 등으로 얻어진 세포나 조직, 혈액, 전혈, 혈청, 혈장, 타액, 뇌척수액, 각종 분비물, 소변, 대변 등일 수 있다. 바람직하게는 혈액, 혈장, 혈청, 타액, 비액, 객담, 복수, 질 분비물 및 소변으로 이루어진 군에서 선택될 수 있으며, 바람직하게는 조직 또는 세포일 수 있다.
상기 (i) 단계의 방법으로 측정한 피검체에서 FAM86A 단백질 또는 이의 mRNA의 발현 수준을 동일한 방법으로 측정한 정상 대조구와 비교하여, FAM86A 단백질 또는 이의 mRNA의 발현 수준이 감소한 경우, 상기 피검체를 멜라닌이 과다 형성된 것으로 판단할 수 있다.
본 명세서에서 사용된 피검체, 및 각종 시료는 모든 동물, 바람직하게는 포유류, 더욱 바람직하게는 인간, 또는 이로부터 얻은 시료 또는 생검 시료는 모든 조직, 체액, 또는 세포일 수 있으며, 예컨대 피부 조직 또는 피부 세포 또는 섬유아세포일 수 있다. 또한, 정상 개체는 멜라닌 과다생성 및 이로 인한 색소성 피부질환의 증상및 징후가 없으며, 개인적 및 가족적으로 멜라닌 과다생성 및 이로 인한 색소성 피부질환의 병력이 없는 개체를 의미한다.
상기 멜라닌 과다생성 시료는 동물, 예컨대 포유류, 바람직하게는 인간으로부터 자연적으로 얻어지거나 인위적인 방법으로 얻어진 것일 수 있으며, 상기 인위적 방법은 비색소 세포에 타이로시네이즈를 과발현시키는 것을 포함한다.
또한, 본 발명은 FAM86A 단백질, 아고니스트 또는 활성화제를 유효성분으로 포함하는 피부 미백용 조성물을 제공한다.
또한, 본 발명은 FAM86A 단백질, 아고니스트 또는 활성화제를 개체에 투여하는 단계를 포함하는 피부 미백 방법을 제공한다.
또한, 본 발명은 피부 미백용 제제를 제조하기 위한 FAM86A 단백질, 아고니스트 또는 활성화제의 용도를 제공한다.
상기 조성물은 약학적 조성물, 식품 조성물 또는 화장료 조성물의 형태로 제공되는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, 상기 아고니스트 또는 활성화제는 FAM86A 유전자를 포함하는 발현벡터, 상기 벡터를 포함하는 세포, 화합물 및 펩타이드로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, 상기 발현벡터는 FAM86A 유전자를 포함하며, FAM86A 재조합 발현벡터라면 이에 제한되는 것은 아니다. 예를 들어 선형 DNA, 플라스미드 DNA 또는 재조합 바이러스성 벡터일 수 있다.
본 발명에서, 상기 발현벡터에 포함된 FAM86A 유전자는 서열번호 47로 표시되는 염기서열을 포함하거나 그로 이루어질 수 있다.
본 발명에서, 상기 재조합 바이러스는 레트로 바이러스, 아데노 바이러스, 아데노 부속 바이러스, 헤르페스 심플렉스 바이러스, 및 렌티바이러스로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, '미백'이라 함은 멜라닌 색소의 합성을 저해함으로써 피부 톤을 밝게 할 뿐만 아니라, 자외선, 호르몬 또는 유전에 기인한 기미나 주근깨 등의 피부 과색소 침착을 개선하는 것을 말한다.
또한, 본 발명의 "미백"은 흑색이나 황색 피부를 미백하는 것을 포함하며, 흑색이나 황색 피부를 백색의 피부로 전환시키는 것을 포함할 수 있다.
본 발명에 따른 약학적 조성물은 과도한 멜라닌 색소 침착의 병리 상태, 예를 들어 노화/광노화, 임신 등 급격한 호르몬의 변화, 상처, 염증, 화상 등으로 인한 피부 손상과 재생 등을 원인으로 한 색소 침착, 기미, 주근깨, 잡티, 점, 반점, 오타모반, 푸른 흑피증(cyanic melasma), 임신성 갈색반(gravidic chloasma), 경구 피임약을 복용한 여성에서의 흑피증, 검버섯, 노인성 흑자, 상처, 피부염으로 인한 염증 후 과다 색소 침착 및 멜라닌 피부증 등을 개선하고 완화하기 위하여 사용될 수 있다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물을 제공한다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 피부 흑화용 조성물을 제공한다. 본 발명의 FAM86A 억제제는 쥐의 melanoma 세포에 적용하였을 때, 매우 강력한 멜라닌 생성 촉진 효과를 나타내었는 바, 피부 흑화제 또는 선태닝제로 이용될 수 있음을 확인하였다.
따라서, 본 발명의 FAM86A 억제제는 멜라닌 생성 촉진용 조성물로 이용될 수 있으며, 멜라닌 생성을 촉진함으로써 인간을 포함한 동물의 피부색 또는 털색을 조절할 수 있으며, 구체적으로 털색을 진하게 하는 효과를 나타낼 수 있다.
본 명세서에서, 상기 억제제는 FAM86A 활성 억제제 또는 발현 억제제일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 상기 활성 억제제는 FAM86A 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드모방체, 기질유사체, 앱타머 및 항체로 이루어진 군에서 하나 이상 선택된 것일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 상기 발현 억제제는 FAM86A 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, RNAi, siRNA, miRNA, shRNA 및 리보자임으로 이루어진 군에서 하나 이상 선택된 것일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 용어 "siRNA"는 센스 가닥(예를 들어, FAM86A 유전자 mRNA 서열에 상응하는 (corresponding) 서열)과 안티센스 가닥(예를 들어, FAM86A 유전자 mRNA 서열에 상보적인 서열)이 서로 반대쪽에 위치하여 이중쇄를 이루는 구조를 가질 수 있다. 또한, 본 발명에서 이용될 수 있는 siRNA 분자는, 자기-상보성(self-complementary) 센스 및 안티센스 가닥을 가지는 단일쇄 구조를 가질 수 있다. siRNA는 RNA끼리 짝을 이루는 이중사슬 RNA 부분이 완전히 쌍을 이루는 것에 한정되지 않고 미스매치(대응하는 염기가 상보적이지 않음), 벌지(일방의 사슬에 대응하는 염기가 없음) 등에 의하여 쌍을 이루지 않는 부분이 포함될 수 있다. 구체적으로는, 전체 길이는 10 내지 100 염기, 보다 구체적으로는 15 내지 80 염기, 그리고 보다 더 구체적으로는 20 내지 70 염기이다. 본 발명에서 상기 siRNA는 구체적으로 서열번호 31 내지 서열번호 39로 이루어진 군으로부터 하나 이상 선택된 염기서열을 타겟으로 하는 것일 수 있다.
본 명세서에서, 용어 "shRNA(small hairpin RNA 또는 short hairpin RNA)"는 견고한 헤어핀 턴을 만드는 RNA의 서열을 나타내며, 이는 RNA 간섭을 통해 유전자 발현을 사일런스시키는 데 이용될 수 있다. shRNA는 진핵세포에서 기능할 수 있는 프로모터라면 어떤 것이든 사용하여 세포에 도입될 수 있으나, 본 발명에서는 pLKO.1 벡터를 이용하였다. 이러한 벡터는 항상 딸세포로 전달되어 유전자 사일런싱이 유전될 수 있도록 한다. shRNA 헤어핀 구조는 세포 내 기작(machinery)인 siRNA로 분해되어 RNA-유도 사일런싱 복합체(RNA-induced silencing complex)에 결합된다. 상술한 복합체는 이에 결합된 siRNA에 상응하는(matched) mRNA에 결합하여 분해시킨다. shRNA는 RNA 폴리머라제 III에 의해 전사되며, 포유동물 세포에서 shRNA 생산은 세포가 shRNA를 바이러스 공격으로 인식하여 방어 수단을 찾는 것처럼 인터페론 반응을 야기시킬 수도 있다. 본 발명에서 상기 shRNA는 구체적으로 서열번호 11 내지 서열번호 20으로 이루어진 군으로부터 하나 이상 선택된 염기서열을 포함하는 것일 수 있으며, 바람직하게는 서열번호 11 내지 서열번호 20으로 이루어진 군으로부터 하나 이상 선택된 염기서열로 이루어진 것일 수 있다. 본 발명에서 상기 shRNA는 구체적으로 서열번호 21 내지 서열번호 30로 이루어진 군으로부터 하나 이상 선택된 염기서열을 타겟으로 하는 것일 수 있다.
본 명세서에서, 용어 "miRNA(마이크로RNA, microRNA)"는 21-25개의 뉴클레오타이드의 단일가닥 RNA 분자로서 mRNA(messengerRNA)의 3'-UTR에 결합하여 진핵생물의 유전자 발현을 제어하는 물질을 나타낸다(BartelDP, et al., Cell, 23;116(2): 281-297(2004)). miRNA의 생성은 Drosha(RNaseIII type 효소)에 의해 스템-루프 구조의 전구체 miRNA(pre-miRNA)로 만들어지고, 세포질로 이동하여 다이서(Dicer)에 의해 절단되어 성숙한 miRNA로 만들어진다. 본 발명에서 상기 miRNA는 구체적으로 서열번호 40 내지 서열번호 45로 이루어진 군으로부터 하나 이상 선택된 염기서열을 포함하는 것일 수 있으며, 바람직하게는 서열번호 40 내지 서열번호 45으로 이루어진 군으로부터 하나 이상 선택된 염기서열로 이루어진 것일 수 있다.
본 명세서에서, 용어 "안티센스 올리고뉴클레오타이드"는 특정 mRNA의 서열에 상보적인 핵산 서열을 함유하고 있는 DNA 또는 RNA 또는 이들의 유도체를 의미하고, mRNA 내의 상보적인 서열에 결합하여 mRNA의 단백질로의 번역을 저해하는 작용을 한다. 예를 들어, 본 발명의 안티센스 서열은 FAM86A에 상보적이고 FAM86A mRNA에 결합할 수 있는 DNA 또는 RNA 서열을 의미하고, FAM86A mRNA의 번역, 세포질 내로의 전위(translocation), 성숙(maturation) 또는 다른 모든 전체적인 생물학적 기능에 대한 필수적인 활성을 저해할 수 있다. 안티센스 핵산의 길이는 6내지 100 염기이고, 구체적으로는 8내지 60 염기이고, 보다 구체적으로는 10 내 40 염기이다.
본 명세서에서, 용어 "리보자임(ribozyme)"은 RNA의 일종으로 특정한 RNA의 염기 서열을 인식하여 자체 적으로 이를 절단하는 효소와 같은 기능을 가진 RNA이다. 리보자임은 타겟 전령 RNA 가닥의 상보적인 염기서열로 특이성을 가지고 결합하는 영역과 타겟 RNA를 절단하는 영역으로 구성된다. 본 명세서에서 사용되는 용어 "앱타머(aptamer)"는 특정 타겟에 결합하는 올리고뉴클레오타이드(일반적으로, RNA 분자)를 의미한다.구체적으로는, 본 명세서에서의 "앱타머"는 올리고뉴클레오타이드 앱타머(예컨대, RNA aptamer)를 의미한다.
본 명세서에서, siRNA 또는 shRNA는 올리고뉴클레오티드의 생체 내 안정성 향상, 핵산 분해효소 저항성 부여 및 비특이적 면역반응 감소를 위한 다양한 변형(modification)을 가한 것일 수 있다. 상기 올리고뉴클레오티드의 변형은 하나 이상의 뉴클레오티드 내 당 구조의 2´ 탄소 위치에서 OH기가 -CH 3(메틸), -OCH 3(methoxy), -NH 2, -F, -O-2-메톡시에틸, -O-프로필(propyl), -O-2-메틸티오에틸(methylthioethyl), -O-3-아미노프로필, -O-3-디메틸아미노프로필, -O-N-메틸아세트아미도 또는 -O-디메틸아미도옥시에틸로의 치환에 의한 변형; 뉴클레오티드 내 당(sugar) 구조 내의 산소가 황으로 치환된 변형; 또는 뉴클레오티드결합의 포스포로티오에이트(phosphorothioate) 또는 보라노포스페이트(boranophosphate), 메틸포스포네이트(methyl phosphonate) 결합으로의 변형에서 선택된 하나 이상의 변형이 조합되어 사용될 수 있으며, PNA(peptide nucleic acid), LNA(locked nucleic acid) 또는 UNA(unlocked nucleic acid) 형태로의 변형도 사용이 가능하다.
본 명세서에서 사용되는 용어 "상보적(complementary)"은 소정의 혼성화 또는 어닐링 조건, 구체적으로는 생리학적 조건 하(세포 내)에서 핵산 분자 내 타겟팅 모이어티가 타겟(예컨대, FAM86A 유전자)에 선택적으로 혼성화할 정도로 충분히 상보적인 것을 의미하는 것으로 하나 또는 그 이상의 미스매치(mismatch) 염기서열을 가질 수 있으며, 실질적으로 상보적(substantially complementary) 및 완전히 상보적(perfectly complementary)인 것을 모두 포괄하는 의미를 가지며, 보다 구체적으로는 완전히 상보적인 것을 의미한다.
본 명세서에서, 본 발명의 조성물이 적용될 수 있는 멜라닌 결핍 질환은 백색피부증(leukoderma), 백반증(vitiligo), 쿼디크롬 백반증(quadrichrome vitiligo), 반점성 백반증(vitiligo ponctue), 백색증 증후군(syndromic Albinism)[예컨대, 알레잔드리니 증후군(Alezzandrini syndrome), 헤르만스키-푸들라크 증후군(Hermansky-Pudlak syndrome), 세디아크-히가시 증후군(ChediakHigashi syndrome), 그리셀리 증후군(Griscelli syndrome)(엘레잘데 증후군(Elejalde syndrome), 그리셀리 증후군 타입 2(Griscelli syndrome type 2) 및 그리셀리 증후군 타입 3(Griscelli syndrome type 3), 바르덴부르크 증후군(Waardenburg syndrome), 티쩨 증후군(Tietz syndrome), 크로스-먹큐직-브린 증후군(CrossMuKusick-Breen syndrome), ABCD 증후군(ABCD syndrome), 백색증-청각장애 증후군(Albinism-deafness syndrome) 및 보그트-고야나기-하라다 증후군(Vogt-Koyanagi-Harada syndrome)], 눈 피부 백색증(oculocutaneous albinism), 백모증(canities), 멜라닌증(hypomelanosis)[물방울모양 저멜라닌증(idiopathic guttate hypomelanosis), 잎모양 저멜라닌증(phylloid hypomelanosis), 진행성 반상 저멜라닌증(progressive macular hypomelanosis)], 얼룩백색증(piebaldism), 탈색 모반(nevus depigmentosus), 염증후 색소침착저하증(postinflammatory hypopigmentation), 백색비강진(pityriasis alba), 바가본드 백반흑피증(Vagabond's leukomelanoderma), 예맨 시청각장애 색소침착저하 증후군(Yemenite deaf-blind hypopigmentation syndrome), 웬드-바우쿠스 증후군(Wende-Bauckus syndrome), 워로노프 반지증(Woronoff's ring), 멜라닌결핍증(amelanism), 루시즘(Leucism) 및 피부 탈색소 관련 질환을 포함하나, 이에 제한되는 것은 아니다.
본 발명의 개선, 치료 또는 예방의 대상인 "백반증(vitiligo)"은 피부 표피로부터의 멜라닌과 기능적인 멜라닌세포의 손실의 결과로 국한된 탈색소 반점을 특징으로 하는 색소 결핍증이다. 또한, "백모증(canities, Hair graying)"은 "모발의 회색화 또는 백발화"라고도 하는 증상으로서, 개개 모발의 색조가 점차 약해져, 정상 색조로부터 백색 모발 까지 다양한 색조의 털이 혼재하는 증상을 의미한다. 상기 백모증은 멜라닌 생합성 세포인 멜라노사이트(melanocyte)의 독성적 산화 손상에 의해 모발구근(hair bulbar) 멜라노사이트에서의 티로시나아제 활성이 감소되는 것이 원인인 것으로 알려져 있다.
본 발명의 조성물은 약학적 조성물, 식품 조성물, 또는 화장료 조성물의 형태로 제공되는 것일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 멜라닌 결핍 질환을 예방 또는 치료하는 방법을 제공한다.
또한, 본 발명은 멜라닌 결핍 질환의 예방 또는 치료를 위한 약제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 백모증 방지용 조성물을 제공한다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 백모증을 치료하는 방법을 제공한다.
또한, 본 발명은 백모증의 예방 또는 치료를 위한 약제를 제조하기 위한 FAM86A 억제제의 용도를 제공한다.
본 명세서에서, 상기 조성물은 멜라닌의 합성 또는 분비를 촉진하는 것일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 흑모 유발 촉진용 조성물을 제공한다. 이에 더하여, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 흑모 유발을 촉진하는 방법 및 FAM86A 억제제의 흑모 유발 촉진 용도를 제공한다.
또한, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 개체의 색 조절용 조성물을 제공하며, 구체적으로 반려동물의 털색 또는 피부색 조절용 조성물일 수 있다. 이에 더하여, 본 발명은 FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 개체의 색을 조절하는 방법 및 FAM86A 억제제의 개체의 색 조절 용도를 제공한다.
본 발명의 FAM86A 억제제는 멜라닌 생성을 촉진하는 효과를 갖고 있으므로, FAM86A 억제제를 포함하는 경우 백발의 생성을 예방하고 흑모의 유발 및 생성을 촉진시킬 수 있다.
본 발명은 또한, 목적하는 물질의 약학적으로 허용가능한 염을 유효성분으로 포함할 수 있다. 본 발명에서 용어, "약학적으로 허용 가능한 염"이란 약학적으로 허용되는 무기산, 유기산, 또는 염기로부터 유도된 염을 포함한다. 본 발명에서 용어, “식품학적으로 허용 가능한 염”이란 식품학적으로 허용되는 유기산, 무기산, 또는 염기로부터 유도된 염을 포함한다. 본 발명에서 용어, "수의학적으로 허용 가능한 염"이란 수의학적으로 허용되는 무기산, 유기산, 또는 염기로부터 유도된 염을 포함한다.
적합한 산의 예로는 염산, 브롬산, 황산, 질산, 과염소산, 푸마르산, 말레산, 인산, 글리콜산, 락트산, 살리실산, 숙신산, 톨루엔-p-설폰산, 타르타르산, 아세트산, 시트르산, 메탄설폰산, 포름산, 벤조산, 말론산, 글루콘산, 나프탈렌-2-설폰산, 벤젠설폰산 등을 들 수 있다. 산부가염은 통상의 방법, 예를 들면 화합물을 과량의 산 수용액에 용해시키고, 이 염을 메탄올, 에탄올, 아세톤 또는 아세토니트릴과 같은 수혼화성 유기 용매를 사용하여 침전시켜서 제조할 수 있다. 또한, 동몰량의 화합물 및 물 중의 산 또는 알코올을 가열하고 이어서 상기 혼합물을 증발시켜서 건조시키거나, 또는 석출된 염을 흡인 여과시켜 제조할 수 있다.
적합한 염기로부터 유도된 염은 나트륨, 칼륨 등의 알칼리 금속, 마그네슘 등의 알칼리 토금속, 및 암모늄 등을 포함할 수 있으나, 이에 제한되는 것은 아니다. 알칼리 금속 또는 알칼리 토금속염은, 예를 들면 화합물을 과량의 알칼리 금속 수산화물 또는 알칼리토 금속 수산화물 용액 중에 용해하고, 비용해 화합물염을 여과한 후 여액을 증발, 건조시켜 얻을 수 있다. 이 때, 금속염으로서는 특히 나트륨, 칼륨 또는 칼슘염을 제조하는 것이 제약상 적합하며, 또한 이에 대응하는 은염은 알칼리 금속 또는 알칼리토 금속염을 적당한 은염(예, 질산은)과 반응시켜 얻을 수 있다.
본 발명의 조성물 내의 상기 FAM86A 단백질, 이의 아고니스트, 이의 활성화제 또는 이의 억제제의 함량은 질환의 증상, 증상의 진행 정도, 환자의 상태 등에 따라서 적절히 조절 가능하며, 예컨대, 전체 조성물 중량을 기준으로 0.0001 내지 99.9중량%, 또는 0.001 내지 50중량%일 수 있으나, 이에 한정되는 것은 아니다. 상기 함량비는 용매를 제거한 건조량을 기준으로 한 값이다.
본 발명에 따른 약학적 조성물은 약학적 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다. 상기 부형제는 예를 들어, 희석제, 결합제, 붕해제, 활택제, 흡착제, 보습제, 필름-코팅 물질, 및 제어방출첨가제로 이루어진 군으로부터 선택된 하나 이상일 수 있다.
본 발명에 따른 약학적 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 서방형 과립제, 장용과립제, 액제, 점안제, 엘실릭제, 유제, 현탁액제, 주정제, 트로키제, 방향수제, 리모나아데제, 정제, 서방형정제, 장용정제, 설하정, 경질캅셀제, 연질캅셀제, 서방캅셀제, 장용캅셀제, 환제, 틴크제, 연조엑스제, 건조엑스제, 유동엑스제, 주사제, 캡슐제, 관류액, 경고제, 로션제, 파스타제, 분무제, 흡입제, 패취제, 멸균주사용액, 또는에어로졸 등의 외용제 등의 형태로 제형화하여 사용될 수 있으며, 상기 외용제는 크림, 젤, 패치, 분무제, 연고제, 경고제, 로션제, 리니멘트제, 파스타제 또는 카타플라스마제 등의 제형을 가질 수 있다.
본 발명에 따른 약학적 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 올리고당, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다.
제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다.
본 발명에 따른 정제, 산제, 과립제, 캡슐제, 환제, 트로키제의 첨가제로 옥수수전분, 감자전분, 밀전분, 유당, 백당, 포도당, 과당, 디-만니톨, 침강탄산칼슘, 합성규산알루미늄, 인산일수소칼슘, 황산칼슘, 염화나트륨, 탄산수소나트륨, 정제 라놀린, 미결정셀룰로오스, 덱스트린, 알긴산나트륨, 메칠셀룰로오스, 카르복시메칠셀룰로오스나트륨, 카올린, 요소, 콜로이드성실리카겔, 히드록시프로필스타치, 히드록시프로필메칠셀룰로오스, HPMC 1928, HPMC 2208, HPMC 2906, HPMC 2910, 프로필렌글리콜, 카제인, 젖산칼슘, 프리모젤 등 부형제; 젤라틴, 아라비아고무, 에탄올, 한천가루, 초산프탈산셀룰로오스, 카르복시메칠셀룰로오스, 카르복시메칠셀룰로오스칼슘, 포도당, 정제수, 카제인나트륨, 글리세린, 스테아린산, 카르복시메칠셀룰로오스나트륨, 메칠셀룰로오스나트륨, 메칠셀룰로오스, 미결정셀룰로오스, 덱스트린, 히드록시셀룰로오스, 히드록시프로필스타치, 히드록시메칠셀룰로오스, 정제쉘락, 전분호, 히드록시프로필셀룰로오스, 히드록시프로필메칠셀룰로오스, 폴리비닐알코올, 폴리비닐피롤리돈 등의 결합제가 사용될 수 있으며, 히드록시프로필메칠셀룰로오스, 옥수수전분, 한천가루, 메칠셀룰로오스, 벤토나이트, 히드록시프로필스타치, 카르복시메칠셀룰로오스나트륨, 알긴산나트륨, 카르복시메칠셀룰로오스칼슘, 구연산칼슘, 라우릴황산나트륨, 무수규산, 1-히드록시프로필셀룰로오스, 덱스트란, 이온교환수지, 초산폴리비닐, 포름알데히드처리 카제인 및 젤라틴, 알긴산, 아밀로오스, 구아르고무(Guar gum), 중조, 폴리비닐피롤리돈, 인산칼슘, 겔화전분, 아라비아고무, 아밀로펙틴, 펙틴, 폴리인산나트륨, 에칠셀룰로오스, 백당, 규산마그네슘알루미늄, 디-소르비톨액, 경질무수규산 등 붕해제; 스테아린산칼슘, 스테아린산마그네슘, 스테아린산, 수소화식물유(Hydrogenated vegetable oil), 탈크, 석송자, 카올린, 바셀린, 스테아린산나트륨, 카카오지, 살리실산나트륨, 살리실산마그네슘, 폴리에칠렌글리콜 4000, 6000, 유동파라핀, 수소첨가대두유(Lubri wax), 스테아린산알루미늄, 스테아린산아연, 라우릴황산나트륨, 산화마그네슘, 마크로골(Macrogol), 합성규산알루미늄, 무수규산, 고급지방산, 고급알코올, 실리콘유, 파라핀유, 폴리에칠렌글리콜지방산에테르, 전분, 염화나트륨, 초산나트륨, 올레인산나트륨, dl-로이신, 경질무수규산 등의 활택제;가 사용될 수 있다.
본 발명에 따른 액제의 첨가제로는 물, 묽은 염산, 묽은 황산, 구연산나트륨, 모노스테아린산슈크로스류, 폴리옥시에칠렌소르비톨지방산에스텔류(트윈에스텔), 폴리옥시에칠렌모노알킬에텔류, 라놀린에텔류, 라놀린에스텔류, 초산, 염산, 암모니아수, 탄산암모늄, 수산화칼륨, 수산화나트륨, 프롤아민, 폴리비닐피롤리돈, 에칠셀룰로오스, 카르복시메칠셀룰로오스나트륨 등이 사용될 수 있다.
본 발명에 따른 시럽제에는 백당의 용액, 다른 당류 혹은 감미제 등이 사용될 수 있으며, 필요에 따라 방향제, 착색제, 보존제, 안정제, 현탁화제, 유화제, 점조제 등이 사용될 수 있다.
본 발명에 따른 유제에는 정제수가 사용될 수 있으며, 필요에 따라 유화제, 보존제, 안정제, 방향제 등이 사용될 수 있다.
본 발명에 따른 현탁제에는 아카시아, 트라가칸타, 메칠셀룰로오스, 카르복시메칠셀룰로오스, 카르복시메칠셀룰로오스나트륨, 미결정셀룰로오스, 알긴산나트륨, 히드록시프로필메칠셀룰로오스(HPMC), HPMC 1828, HPMC 2906, HPMC 2910 등 현탁화제가 사용될 수 있으며, 필요에 따라 계면활성제, 보존제, 안정제, 착색제, 방향제가 사용될 수 있다.
본 발명에 따른 주사제에는 주사용 증류수, 0.9%염화나트륨주사액, 링겔주사액, 덱스트로스주사액, 덱스트로스+염화나트륨주사액, 피이지(PEG), 락테이티드 링겔주사액, 에탄올, 프로필렌글리콜, 비휘발성유-참기름, 면실유, 낙화생유, 콩기름, 옥수수기름, 올레인산에칠, 미리스트산 이소프로필, 안식향산벤젠과 같은 용제; 안식향산나트륨, 살리실산나트륨, 초산나트륨, 요소, 우레탄, 모노에칠아세트아마이드, 부타졸리딘, 프로필렌글리콜, 트윈류, 니정틴산아미드, 헥사민, 디메칠아세트아마이드와 같은 용해보조제; 약산 및 그 염(초산과 초산나트륨), 약염기 및 그 염(암모니아 및 초산암모니움), 유기화합물, 단백질, 알부민, 펩 톤, 검류와 같은 완충제; 염화나트륨과 같은 등장화제; 중아황산나트륨(NaHSO 3)이산화탄소가스, 메타중아황산나트륨(Na 2S 2O 3),아황산나트륨(Na 2SO 3), 질소가스(N 2), 에칠렌디아민테트라초산과 같은 안정제; 소디움비설파이드 0.1%, 소디움포름알데히드 설폭실레이트, 치오우레아, 에칠렌디아민테트라초산디나트륨, 아세톤소디움비설파이트와 같은 황산화제; 벤질알코올, 클로로부탄올, 염산프로카인, 포도당, 글루콘산칼슘과 같은 무통화제; 시엠시나트륨, 알긴산나트륨, 트윈 80, 모노스테아린산알루미늄과 같은 현탁화제를 포함할 수 있다.
본 발명에 따른 좌제에는 카카오지, 라놀린, 위텝솔, 폴리에틸렌글리콜, 글리세로젤라틴, 메칠셀룰로오스, 카르복시메칠셀룰로오스, 스테아린산과 올레인산의 혼합물, 수바날(Subanal), 면실유, 낙화생유, 야자유, 카카오버터+콜레스테롤, 레시틴, 라네트왁스, 모노스테아린산글리세롤, 트윈 또는 스판, 임하우젠(Imhausen), 모놀렌(모노스테아린산프로필렌글리콜), 글리세린, 아뎁스솔리두스(Adeps solidus), 부티룸 태고-G(Buytyrum Tego-G), 세베스파마 16 (Cebes Pharma 16), 헥사라이드베이스 95, 코토마(Cotomar), 히드록코테 SP, S-70-XXA, S-70-XX75(S-70-XX95), 히드록코테(Hydrokote) 25, 히드록코테 711, 이드로포스탈 (Idropostal), 마사에스트라리움(Massa estrarium, A, AS, B, C, D, E, I, T), 마사-MF, 마수폴, 마수폴-15, 네오수포스탈-엔, 파라마운드-B, 수포시로(OSI, OSIX, A, B, C, D, H, L), 좌제기제 IV 타입 (AB, B, A, BC, BBG, E, BGF, C, D, 299), 수포스탈 (N, Es), 웨코비 (W, R, S, M ,Fs), 테제스터 트리글리세라이드 기제(TG-95, MA, 57)와 같은 기제가 사용될 수 있다.
경구 투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 추출물에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(calcium carbonate), 수크로스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다.
경구 투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜 (propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다.
본 발명에 따른 약학적 조성물은 약학적으로 유효한 양으로 투여한다. 본 발명에 있어서, "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효용량 수준은 환자 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다.
본 발명에 따른 약학적 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 본 발명이 속하는 기술분야에 통상의 기술자에 의해 용이하게 결정될 수 있다.
본 발명의 약학적 조성물은 개체에게 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구 복용, 피하 주사, 복강 투여, 정맥 주사, 근육 주사, 척수 주위 공간(경막내) 주사, 설하 투여, 볼점막 투여, 직장 내 삽입, 질 내 삽입, 안구 투여, 귀 투여, 비강 투여, 흡입, 입 또는 코를 통한 분무, 피부 투여, 경피 투여 등에 따라 투여될 수 있다.
본 발명의 약학적 조성물은 치료할 질환, 투여 경로, 환자의 연령, 성별, 체중 및 질환의 중등도 등의 여러 관련 인자와 함께 활성성분인 약물의 종류에 따라 결정된다.
본 발명에서 "개체"란 질병의 치료를 필요로 하는 대상을 의미하고, 척추동물이라면 제한되지 아니하나, 구체적으로는 인간, 마우스, 래트, 기니어 피그, 토끼, 원숭이, 돼지, 말, 소, 양, 영양, 개, 고양이, 어류 및 파충류에 적용될 수 있으며, 바람직하게는 털을 가진 포유동물일 수 있으며, 보다 바람직하게는 인간일 수 있다.
본 발명에서 “투여”란 임의의 적절한 방법으로 개체에게 소정의 본 발명의 조성물을 제공하는 것을 의미한다.
본 발명에서 “예방”이란 목적하는 질환의 발병을 억제하거나 지연시키는 모든 행위를 의미하고, “치료”란 본 발명에 따른 약학적 조성물의 투여에 의해 목적하는 질환과 그에 따른 대사 이상 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미하며, “개선”이란 본 발명에 따른 조성물의 투여에 의해 목적하는 질환과 관련된 파라미터, 예를 들면 증상의 정도를 감소시키는 모든 행위를 의미한다.
또한, FAM86A 단백질, 아고니스트 또는 활성화제를 포함하는 조성물은 미백 목적으로 식품에 첨가될 수 있다.
또한, FAM86A 억제제를 포함하는 조성물은 멜라닌 결핍 질환의 개선을 목적으로 식품에 첨가될 수 있다.
본 발명에 있어서 식품은 기능성 식품 및 건강기능성 식품을 포함한다.
바람직하게는, 상기건강기능성 식품은 이너뷰티 푸드(inner beauty) 형태로 섭취함으로써 더욱 우수한 효과를 갖는 장점을 가진다. 상기 이너뷰티(inner beauty)는 '먹는 화장품 또는 뷰티 푸드'로 일컬어지는 푸드로, 피부에 좋은 여러 가지 성분을 몸속으로 흡수시켜 피부 체질을 건강하게 바꾸는 식품을 지칭하며, 피부 타입에 맞는 화장품을 고르듯 피부 컨디션과 라이프스타일을 고려해 개개인에게 맞는 이너 뷰티 푸드를 선택하여 섭취할 수 있다. 보다 바람직하게는 상기 화장료 조성물을 포함하는 화장품과 상기 FAM86A 단백질, 아고니스트, 활성화제를 포함하는 이너뷰티 푸드를 혼용할 경우, 화장품 또는 약제만 사용하는 것에 비해 미백 효과가 월등히 높아져 더욱 효과적인 피부 미백 효과를 볼 수 있는 장점을 가진다. 보다 바람직하게는 상기 화장료 조성물을 포함하는 화장품과 상기 FAM86A 억제제를 포함하는 이너뷰티 푸드를 혼용할 경우, 화장품 또는 약제만 사용하는 것에 비해 백반증 및 백모증을 포함하는 멜라닌 결핍 질환 치료 또는 개선 효과가 월등히 높아져 더욱 효과적인 멜라닌 관련 피부 질환 치료 또는 개선 효과를 볼 수 있는 장점을 가진다.
본 발명의 FAM86A 단백질, 이의 아고니스트, 이의 활성화제 또는 이의 억제제를 식품 첨가물로 사용할 경우, 상기 FAM86A 단백질, 이의 아고니스트, 이의 활성화제 또는 이의 억제제를 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효성분의 혼합양은 사용 목적(예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다. 일반적으로, 식품 또는 음료의 제조 시 본 발명의 FAM86A 단백질, 이의 아고니스트, 이의 활성화제 또는 이의 억제제는 원료에 대하여 15 중량% 이하, 바람직하게는 10 중량% 이하의 양으로 첨가된다. 그러나 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하는 장기간의 섭취의 경우 상기 양은 상기 범위 이하일 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다.
상기 식품의 종류에는 특별한 제한은 없다. 상기 물질을 첨가할 수 있는 식품의 예로는 육류, 소세지, 빵, 쵸코렛, 캔디류, 스넥류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종 스프, 음료수, 차, 드링크제, 알콜 음료 및 비타민 복합제 등이 있으며, 통상적인 의미에서의 건강기능식품을 모두 포함한다.
본 발명에 따른 건강음료 조성물은 통상의 음료와 같이 여러 가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있다. 상술한 천연 탄수화물은 포도당 및 과당과 같은 모노사카라이드, 말토오스 및 수크로오스와 같은 디사카라이드, 덱스트린 및 시클로덱스트린과 같은 폴리사카라이드, 및 자일리톨, 소르비톨 및 에리트리톨 등의 당알콜이다. 감미제로서는 타우마틴, 스테비아 추출물과 같은 천연 감미제나, 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다. 상기 천연 탄수화물의 비율은 본 발명의 조성물 100 mL당 일반적으로 약 0.01-0.20g, 바람직하게는 약 0.04-0.10g이다.
상기 외에 본 발명의 조성물은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알콜, 탄산 음료에 사용되는 탄산화제 등을 함유할 수 있다. 그 밖에 본 발명의 조성물은 천연 과일쥬스, 과일쥬스 음료 및 야채 음료의 제조를 위한 과육을 함유할 수 있다. 이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 이러한 첨가제의 비율은 크게 중요하진 않지만 본 발명의 조성물 100 중량부 당 0.01-0.20 중량부의 범위에서 선택되는 것이 일반적이다.
상기 FAM86A 단백질, 이의 아고니스트, 이의 활성화제 또는 이의 억제제는 화장료 조성물의 형태로 제공될 수 있다.
본 발명에 따른 화장료 조성물의 제형은 스킨로션, 스킨소프너, 스킨토너, 아스트린젠트, 로션, 밀크로션, 모이스쳐 로션, 영양로션, 맛사지크림, 영양크림, 모이스쳐 크림, 핸드크림, 파운데이션, 에센스, 영양에센스, 팩, 비누, 클렌징폼, 클렌징로션, 클렌징크림, 바디로션 또는 바디클렌저의 형태일 수 있다.
본 발명의 화장료 조성물은 수용성 비타민, 유용성 비타민, 고분자 펩티드, 고분자 다당, 및 스핑고 지질로 이루어진 군에서 선택된 조성물을 더 포함할 수 있다.
수용성 비타민으로서는 화장품에 배합 가능한 것이라면 어떠한 것이라도 되지만, 바람직하게는 비타민 B1, 비타민 B2, 비타민 B6, 피리독신, 염산피리독신, 비타민 B12, 판토텐산, 니코틴산, 니코틴산아미드, 엽산, 비타민 C, 비타민 H 등을 들 수 있으며, 그들의 염 (티아민염산염, 아스코르빈산나트륨염 등)이나 유도체 (아스코르빈산-2-인산나트륨염, 아스코르빈산-2-인산마그네슘염 등)도 본 발명에서 사용할 수 있는 수용성 비타민에 포함된다. 수용성 비타민은 미생물 변환법, 미생물의 배양물로부터의 정제법, 효소법 또는 화학 합성법 등의 통상의 방법에 의해 수득할 수 있다.
유용성 비타민으로서는 화장품에 배합 가능한 것이라면 어떠한 것이라도 되지만, 바람직하게는 비타민 A, 카로틴, 비타민 D2, 비타민 D3, 비타민 E (d1-알파 토코페롤, d-알파 토코페롤, d-알파 토코페롤) 등을 들 수 있으며, 그들의 유도체 (팔미틴산아스코르빈, 스테아르산아스코르빈, 디팔미틴산아스코르빈, 아세트산dl-알파 토코페롤, 니코틴산dl-알파 토코페롤비타민 E, DL-판토테닐알코올, D-판토테닐알코올, 판토테닐에틸에테르 등) 등도 본 발명에서 사용되는 유용성 비타민에 포함된다. 유용성 비타민은 미생물 변환법, 미생물의 배양물로부터의 정제법, 효소 또는 화학 합성법 등의 통상의 방법에 의해 취득할 수 있다.
고분자 펩티드로서는 화장품에 배합 가능한 것이라면 어떠한 것이라도 되지만, 바람직하게는 콜라겐, 가수 분해 콜라겐, 젤라틴, 엘라스틴, 가수 분해 엘라스틴, 케라틴 등을 들 수 있다. 고분자 펩티드는 미생물의 배양액으로부터의 정제법, 효소법 또는 화학 합성법 등의 통상의 방법에 의해 정제 취득할 수 있으며, 또는 통상 돼지나 소 등의 진피, 누에의 견섬유 등의 천연물로부터 정제하여 사용할 수 있다.
고분자 다당으로서는 화장품에 배합 가능한 것이라면 어떠한 것이라도 되지만, 바람직하게는 히드록시에틸셀룰로오스, 크산탄검, 히알루론산나트륨, 콘드로이틴 황산 또는 그 염 (나트륨염 등) 등을 들 수 있다. 예를 들어, 콘드로이틴 황산 또는 그 염 등은 통상 포유 동물이나 어류로부터 정제하여 사용할 수 있다.
스핑고지질로서는 화장품에 배합 가능한 것이라면 어떠한 것이라도 되지만, 바람직하게는 세라미드, 피토스핑고신, 스핑고당지질 등을 들 수 있다. 스핑고지질은 통상 포유류, 어류, 패류, 효모 또는 식물 등으로부터 통상의 방법에 의해 정제하거나 화학 합성법에 의해 취득할 수 있다.
본 발명의 화장료 조성물에는 상기 필수 성분과 더불어 필요에 따라 통상 화장품에 배합되는 다른 성분을 배합해도 된다.
이외에 첨가해도 되는 배합 성분으로서는 유지 성분, 보습제, 에몰리엔트제, 계면 활성제, 유기 및 무기 안료, 유기 분체, 자외선 흡수제, 방부제, 살균제, 산화 방지제, 식물 추출물, pH 조정제, 알콜, 색소, 향료, 혈행 촉진제, 냉감제, 제한(制汗)제, 정제수 등을 들 수 있다.
유지 성분으로서는 에스테르계 유지, 탄화수소계 유지, 실리콘계 유지, 불소계 유지, 동물 유지, 식물 유지 등을 들 수 있다.
에스테르계 유지로서는 트리2-에틸헥산산글리세릴, 2-에틸헥산산세틸, 미리스틴산이소프로필, 미리스틴산부틸, 팔미틴산이소프로필, 스테아르산에틸, 팔미틴산옥틸, 이소스테아르산이소세틸, 스테아르산부틸, 리놀레산에틸, 리놀레산이소프로필, 올레인산에틸, 미리스틴산이소세틸, 미리스틴산이소스테아릴, 팔미틴산이소스테아릴, 미리스틴산옥틸도데실, 이소스테아르산이소세틸, 세바신산디에틸, 아디핀산디이소프로필, 네오펜탄산이소알킬, 트리(카프릴, 카프린산)글리세릴, 트리2-에틸헥산산트리메틸롤프로판, 트리이소스테아르산트리메틸롤프로판, 테트라2-에틸헥산산펜타엘리슬리톨, 카프릴산세틸, 라우린산데실, 라우린산헥실, 미리스틴산데실, 미리스틴산미리스틸, 미리스틴산세틸, 스테아르산스테아릴, 올레인산데실, 리시노올레인산세틸, 라우린산이소스테아릴, 미리스틴산이소트리데실, 팔미틴산이소세틸, 스테아르산옥틸, 스테아르산이소세틸, 올레인산이소데실, 올레인산옥틸도데실, 리놀레산옥틸도데실, 이소스테아르산이소프로필, 2-에틸헥산산세토스테아릴, 2-에틸헥산산스테아릴, 이소스테아르산헥실, 디옥탄산에틸렌글리콜, 디올레인산에틸렌글리콜, 디카프린산프로필렌글리콜, 디(카프릴,카프린산)프로필렌글리콜, 디카프릴산프로필렌글리콜, 디카프린산네오펜틸글리콜, 디옥탄산네오펜틸글리콜, 트리카프릴산글리세릴, 트리운데실산글리세릴, 트리이소팔미틴산글리세릴, 트리이소스테아르산글리세릴, 네오펜탄산옥틸도데실, 옥탄산이소스테아릴, 이소노난산옥틸, 네오데칸산헥실데실, 네오데칸산옥틸도데실, 이소스테아르산이소세틸, 이소스테아르산이소스테아릴, 이소스테아르산옥틸데실, 폴리글리세린올레인산에스테르, 폴리글리세린이소스테아르산에스테르, 시트르산트리이소세틸, 시트르산트리이소알킬, 시트르산트리이소옥틸, 락트산라우릴, 락트산미리스틸, 락트산세틸, 락트산옥틸데실, 시트르산트리에틸, 시트르산아세틸트리에틸, 시트르산아세틸트리부틸, 시트르산트리옥틸, 말산디이소스테아릴, 히드록시스테아르산 2-에틸헥실, 숙신산디2-에틸헥실, 아디핀산디이소부틸, 세바신산디이소프로필, 세바신산디옥틸, 스테아르산콜레스테릴, 이소스테아르산콜레스테릴, 히드록시스테아르산콜레스테릴, 올레인산콜레스테릴, 올레인산디히드로콜레스테릴, 이소스테아르산피트스테릴, 올레인산피트스테릴, 12-스테알로일히드록시스테아르산이소세틸, 12-스테알로일히드록시스테아르산스테아릴, 12-스테알로일히드록시스테아르산이소스테아릴 등의 에스테르계 등을 들 수 있다.
탄화 수소계 유지로서는 스쿠알렌, 유동 파라핀, 알파-올레핀올리고머, 이소파라핀, 세레신, 파라핀, 유동 이소파라핀, 폴리부덴, 마이크로크리스탈린왁스, 와셀린 등의 탄화 수소계 유지 등을 들 수 있다.
실리콘계 유지로서는 폴리메틸실리콘, 메틸페닐실리콘, 메틸시클로폴리실록산, 옥타메틸폴리실록산, 데카메틸폴리실록산, 도데카메틸시클로실록산, 디메틸실록산ㆍ메틸세틸옥시실록산 공중합체, 디메틸실록산ㆍ메틸스테알록시실록산 공중합체, 알킬 변성 실리콘유, 아미노 변성 실리콘유 등을 들 수 있다.
불소계 유지로서는 퍼플루오로폴리에테르 등을 들 수 있다.
동물 또는 식물 유지로서는 아보카도유, 아르몬드유, 올리브유, 참깨유, 쌀겨유, 새플라워유, 대두유, 옥수수유, 유채유, 행인(杏仁)유, 팜핵유, 팜유, 피마자유, 해바라기유, 포도종자유, 면실유, 야자유, 쿠쿠이너트유, 소맥배아유, 쌀 배아유, 시아버터, 월견초유, 마커데이미아너트유, 메도홈유, 난황유, 우지(牛脂), 마유, 밍크유, 오렌지라피유, 호호바유, 캔데리러왁스, 카르나바왁스, 액상 라놀린, 경화피마자유 등의 동물 또는 식물 유지를 들 수 있다.
보습제로서는 수용성 저분자 보습제, 지용성 분자 보습제, 수용성 고분자, 지용성 고분자 등을 들 수 있다.
수용성 저분자 보습제로서는 세린, 글루타민, 솔비톨, 만니톨, 피롤리돈-카르복실산나트륨, 글리세린, 프로필렌글리콜, 1,3-부틸렌글리콜, 에틸렌글리콜, 폴리에틸렌글리콜B(중합도 n = 2 이상), 폴리프로필렌글리콜(중합도 n = 2 이상), 폴리글리세린B(중합도 n = 2 이상), 락트산, 락트산염 등을 들 수 있다.
지용성 저분자 보습제로서는 콜레스테롤, 콜레스테롤에스테르 등을 들 수 있다.
수용성 고분자로서는 카르복시비닐폴리머, 폴리아스파라긴산염, 트라가칸트, 크산탄검, 메틸셀룰로오스, 히드록시메틸셀룰로오스, 히드록시에틸셀룰로오스, 히드록시프로필셀룰로오스, 카르복시메틸셀룰로오스, 수용성 키틴, 키토산, 덱스트린 등을 들 수 있다.
지용성 고분자로서는 폴리비닐피롤리돈ㆍ에이코센 공중합체, 폴리비닐피롤리돈ㆍ헥사데센 공중합체, 니트로셀룰로오스, 덱스트린지방산에스테르, 고분자 실리콘 등을 들 수 있다.
에몰리엔트제로서는 장쇄아실글루타민산콜레스테릴에스테르, 히드록시스테아르산콜레스테릴, 12-히드록시스테아르산, 스테아르산, 로진산, 라놀린지방산콜레스테릴에스테르 등을 들 수 있다.
계면 활성제로서는 비이온성 계면 활성제, 음이온성 계면 활성제, 양이온성 계면 활성제, 양성 계면 활성제 등을 들 수 있다.
비이온성 계면 활성제로서는 자기 유화형 모노스테아르산글리세린, 프로필렌글리콜지방산에스테르, 글리세린지방산에스테르, 폴리글리세린지방산에스테르, 솔비탄지방산에스테르, POE (폴리옥시에틸렌)솔비탄지방산에스테르, POE 솔비트지방산에스테르, POE 글리세린지방산에스테르, POE 알킬에테르, POE 지방산에스테르, POE 경화피마자유, POE 피마자유, POEㆍPOP (폴리옥시에틸렌ㆍ폴리옥시프로필렌) 공중합체, POEㆍPOP 알킬에테르, 폴리에테르변성실리콘, 라우린산알카놀아미드, 알킬아민옥시드, 수소첨가대두인지질 등을 들 수 있다.
음이온성 계면 활성제로서는 지방산비누, 알파-아실술폰산염, 알킬술폰산염, 알킬알릴술폰산염, 알킬나프탈렌술폰산염, 알킬황산염, POE 알킬에테르황산염, 알킬아미드황산염, 알킬인산염, POE 알킬인산염, 알킬아미드인산염, 알킬로일알킬타우린염, N-아실아미노산염, POE 알킬에테르카르복실산염, 알킬술포숙신산염, 알킬술포아세트산나트륨, 아실화 가수분해 콜라겐펩티드염, 퍼플루오로알킬인산에스테르 등을 들 수 있다.
양이온성 계면 활성제로서는 염화알킬트리메틸암모늄, 염화스테아릴트리메틸암모늄, 브롬화스테아릴트리메틸암모늄, 염화세토스테아릴트리메틸암모늄, 염화디스테아릴디메틸암모늄, 염화스테아릴디메틸벤질암모늄, 브롬화베헤닐트리메틸암모늄, 염화벤잘코늄, 스테아르산디에틸아미노에틸아미드, 스테아르산디메틸아미노프로필아미드, 라놀린 유도체 제 4급 암모늄염 등을 들 수 있다.
양성 계면 활성제로서는 카르복시베타인형, 아미드베타인형, 술포베타인형, 히드록시술포베타인형, 아미드술포베타인형, 포스포베타인형, 아미노카르복실산염형, 이미다졸린 유도체형, 아미드아민형 등의 양성 계면 활성제 등을 들 수 있다.
유기 및 무기 안료로서는 규산, 무수규산, 규산마그네슘, 탤크, 세리사이트, 마이카, 카올린, 벵갈라, 클레이, 벤토나이트, 티탄피막운모, 옥시염화비스무트, 산화지르코늄, 산화마그네슘, 산화아연, 산화티탄, 산화알루미늄, 황산칼슘, 황산바륨, 황산마그네슘, 탄산칼슘, 탄산마그네슘, 산화철, 군청, 산화크롬, 수산화크롬, 칼라민 및 이들의 복합체등의 무기 안료; 폴리아미드, 폴리에스테르, 폴리프로필렌, 폴리스티렌, 폴리우레탄, 비닐수지, 요소수지, 페놀수지, 불소수지, 규소수지, 아크릴수지, 멜라민수지, 에폭시수지, 폴리카보네이트수지, 디비닐벤젠ㆍ스티렌 공중합체, 실크파우더, 셀룰로오스, CI 피그먼트옐로우, CI 피그먼트오렌지 등의 유기 안료 및 이들의 무기 안료와 유기 안료의 복합 안료 등을 들 수 있다.
유기 분체로서는 스테아르산칼슘 등의 금속비누; 세틸린산아연나트륨, 라우릴린산아연, 라우릴린산칼슘 등의 알킬인산금속염 ; N-라우로일-베타-알라닌칼슘, N-라우로일-베타-알라닌아연, N-라우로일글리신칼슘 등의 아실아미노산 다가금속염 ; N-라우로일-타우린칼슘, N-팔미토일-타우린칼슘 등의 아미드술폰산 다가금속염 ; N-엡실론-라우로일-L-리진, N-엡실론-팔미토일리진, N-알파-파리토일올니틴, N-알파-라우로일아르기닌, N-알파-경화우지지방산아실아르기닌 등의 N-아실염기성아미노산 ; N-라우로일글리실글리신 등의 N-아실폴리펩티드 ; 알파-아미노카프릴산, 알파-아미노라우린산 등의 알파-아미노지방산 ; 폴리에틸렌, 폴리프로필렌, 나일론, 폴리메틸메타크릴레이트, 폴리스티렌, 디비닐벤젠ㆍ스티렌 공중합체, 사불화에틸렌 등을 들 수 있다.
자외선 흡수제로서는 파라아미노벤조산, 파라아미노벤조산에틸, 파라아미노벤조산아밀, 파라아미노벤조산옥틸, 살리실산에틸렌글리콜, 살리신산페닐, 살리신산옥틸, 살리신산벤질, 살리신산부틸페닐, 살리신산호모멘틸, 계피산벤질, 파라메톡시계피산-2-에톡시에틸, 파라메톡시계피산옥틸, 디파라메톡시계피산모노-2-에틸헥산글리세릴, 파라메톡시계피산이소프로필, 디이소프로필ㆍ디이소프로필계피산에스테르 혼합물, 우로카닌산, 우로카닌산에틸, 히드록시메톡시벤조페논, 히드록시메톡시벤조페논술폰산 및 그 염, 디히드록시메톡시벤조페논, 디히드록시메톡시벤조페논디술폰산나트륨, 디히드록시벤조페논, 테트라히드록시벤조페논, 4-tert-부틸-4'-메톡시디벤조일메탄, 2,4,6-트리아닐리노-p-(카르보-2'-에틸헥실-1'-옥시)-1,3,5-트리아진, 2-(2-히드록시-5-메틸페닐)벤조트리아졸 등을 들 수 있다.
살균제로서는 히노키티올, 트리클로산, 트리클로로히드록시디페닐에테르, 크로르헥시딘글루콘산염, 페녹시에탄올, 레조르신, 이소프로필메틸페놀, 아줄렌, 살리칠산, 진크필리티온, 염화벤잘코늄, 감광소 301 호, 모노니트로과이어콜나트륨, 운데시렌산 등을 들 수 있다.
산화 방지제로서는 부틸히드록시아니솔, 갈릭산프로필, 엘리소르빈산 등을 들 수 있다.
pH 조정제로서는 시트르산, 시트르산나트륨, 말산, 말산나트륨, 프말산, 프말산나트륨, 숙신산, 숙신산나트륨, 수산화나트륨, 인산일수소나트륨 등을 들 수 있다.
알코올로서는 세틸알코올 등의 고급 알코올을 들 수 있다.
또한, 이외에 첨가해도 되는 배합 성분은 이에 한정되는 것은 아니며, 또, 상기 어느 성분도 본 발명의 목적 및 효과를 손상시키지 않는 범위 내에서 배합 가능하지만, 총중량에 대하여 바람직하게는 0.01-5% 중량 백분율, 보다 바람직하게는 0.01-3% 중량 백분율로 배합된다.
본 발명의 제형이 로션, 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물섬유, 식물섬유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있다.
본 발명의 제형이 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로히드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진체를 포함할 수 있다.
본 발명의 제형이 용액 또는 유탁액의 경우에는 담체 성분으로서 용매, 용매화제 또는 유탁화제가 이용되고, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌 글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 있다.
본 발명의 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌 글리콜과 같은 액상 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있다.
본 발명의 제형이 계면-활성제 함유 클렌징인 경우에는 담체 성분으로서 지방족 알코올 설페이트, 지방족 알코올 에테르 설페이트, 설포숙신산 모노에스테르, 이세티오네이트, 이미다졸리늄 유도체, 메틸타우레이트, 사르코시네이트, 지방산 아미드 에테르 설페이트, 알킬아미도베타인, 지방족 알코올, 지방산 글리세리드, 지방산 디에탄올아미드, 식물성 유, 리놀린 유도체 또는 에톡실화 글리세롤 지방산 에스테르 등이 이용될 수 있다.
본 명세서에서, 상기 조성물은 샴푸, 린스, 헤어토닉, 모발 영양화장수, 헤어에센스, 헤어세럼 스칼프트리트먼트, 헤어트리트먼트, 헤어컨디셔너, 헤어샴푸 및 헤어로션으로 이루어진 군으로부터 하나 이상 선택된 제형일 수 있으며, 이에 제한되는 것은 아니다.
본 발명에 따른 조성물은 상기 제형에 따라 적절한 성분을 더 함유할 수 있으며, 이를 구체적으로 설명하면 하기와 같다.
본 명세서에서, 계면활성제, 방부제 및 점도 조절제, pH 조절제, 향료, 염료, 모발 컨디셔닝제 및 물로 이루어진 군에서 선택되는 어느 하나 이상을 더 함유한다.
본 명세서에서, 상기 계면활성제는 음이온성 계면활성제, 양쪽성 계면활성제 및 비이온성 계면활성제에서 선택되는 어느 하나 이상이다.
본 명세서에서, 상기 음이온성 계면활성제는 알킬 설페이트 또는 알킬 에테르 설페이트일 수 있으며, 그 구체적인 예로는 라우릴 황산나트륨, 라우릴 황산암모늄, 라우릴 황산 트리에탄올아민, 폴리옥시에틸렌 라우릴 황산나트륨, 폴리옥시에틸렌 라우릴 황산암모늄 등을 들 수 있다.
본 명세서에서, 상기 양쪽성 계면활성제는 알킬 베타인 또는 알킬 아미도프로필 베타인일 수 있으며, 그 구체적인 예로는 코코디메틸 카복시메틸 베타인, 라우릴디메틸 카복시메틸 베타인, 라우릴디메틸 알파-카복시에틸 베타인, 세틸디메틸 카복시메틸 베타인, 코카미도 프로필 베타인 등을 들 수 있다.
본 명세서에서, 상기 비이온성 계면활성제는 알카놀 아미드 또는 아민 옥사이드일 수 있으며, 그 구체적인 예로는 라우릴 디에틸 아민옥사이드, 야자유 알킬디메틸 아민옥사이드, 라우린산 디에탄올아미드, 야자유 지방산 디에탄올아미드, 야자유 지방산 모노에탄올아미드 등을 들 수 있다.
본 명세서에서, 상기 방부제는 파라옥시안식향산메틸, 파라옥시안식향산프로필, 안식향산 나트륨, 메칠클로로이소치아졸리논, 메틸이소치아졸리논 및 소듐벤조에이트로 이루어진 군에서 선택된 어느 하나 이상이다.
본 명세서에서, 상기 점도 조절제는 코카마이드엠이에이(CME), 코카마이드디이에이(CDE) 및 소듐클로라이드로 이루어진 어느 하나 이상이다.
본 명세서에서, 상기 pH조절제는 인산나트륨, 인산이나트륨, 구연산 및 구연산나트륨으로 이루어진 어느 하나 이상이다.
본 명세서에서, 상기 모발 컨디셔닝제는 디메치콘 베이스, 양이온성 폴리머 또는 이들의 조합이다.
본 명세서에서, 상기 모발 컨디셔닝제는 3급 아미도아민, 4급 암모늄화합물, 고융점 화합물 및 실리콘 화합물 중 어느 하나 이상을 더 포함할 수 있다.
상기 3급 아미도아민의 구체적인 예로는 코카아미도프로필 디메틸아민, 스테아르아미도프로필 디메틸아민, 베헤니르아미도프로필 디메틸아민, 올레아미도프로필 디메틸아민, 이소스테아르아미도프로필 디메틸아민 등을 들 수 있다.
상기 4급 암모늄화합물의 구체적인 예로는 알킬(탄소수 14 내지 22) 트리메틸 암모늄 클로라이드, 디알킬(탄소수 14 내지 22) 디메틸 암모늄 클로라이드, 수소화 탈로우 알킬 트리메틸 암모늄 클로라이드 및 디탈로우 알킬 디메틸 암모늄 클로라이드 등을 들 수 있다.
상기 고융점 화합물의 구체적인 예로는 지방알코올계, 지방산계, 지방알코올 유도체, 탄화수소계 등이며, 더 구체적으로는 세틸알코올, 스테아릴알코올, 세토스테아릴알코올 등을 들 수 있다.
상기 실리콘 화합물의 구체적인 예로는 폴리알킬실록산계, 폴리아릴실록산계, 폴리알킬아릴실록산계, 폴리에테르실록산 공중합체 등을 들 수 있다.
본 발명에서 사용되는 용어는 본 발명에서의 기능을 고려하면서 가능한 현재 널리 사용되는 일반적인 용어들을 선택하였으나, 이는 당 분야에 종사하는 기술자의 의도 또는 판례, 새로운 기술의 출현 등에 따라 달라질 수 있다. 또한, 특정한 경우는 출원인이 임의로 선정한 용어도 있으며, 이 경우 해당되는 발명의 설명 부분에서 상세히 그 의미를 기재할 것이다. 따라서 본 발명에서 사용되는 용어는 단순한 용어의 명칭이 아닌, 그 용어가 가지는 의미와 본 발명의 전반에 걸친 내용을 토대로 정의되어야 한다.
본 발명의 명세서 전체에서, 어떤 부분이 어떤 구성 요소를 "포함" 한다고 할 때, 이는 특별히 반대되는 기재가 없는 한 다른 구성 요소를 제외하는 것이 아니라 다른 구성 요소를 더 포함할 수 있는 것을 의미한다. 본 발명의 명세서 전체에서 사용되는 정도의 용어 "약", "실질적으로" 등은 언급된 의미에 고유한 제조 및 물질 허용오차가 제시될 때 그 수치에서 또는 그 수치에 근접한 의미로 사용되고, 본 발명의 이해를 돕기 위해 정확하거나 절대적인 수치가 언급된 개시 내용을 비양심적인 침해자가 부당하게 이용하는 것을 방지하기 위해 사용된다.
본 발명의 명세서 전체에서, 마쿠시 형식의 표현에 포함된 "이들의 조합"의 용어는 마쿠시 형식의 표현에 기재된 구성 요소들로 이루어진 군에서 선택되는 하나 이상의 혼합 또는 조합을 의미하는 것으로서, 상기 구성 요소들로 이루어진 군에서 선택되는 하나 이상을 포함하는 것을 의미한다.
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
[실시예]
실시예 1. 세포 배양
쥐의 멜라닌 세포주(murine melanoma cell)인 B16F10 세포와 세포를 10% FBS(fetal bovine serum)와 페니실린-스트렙토마이신이 포함된 DMEM(Dulbecco's modified Eagle's medium) 배양액을 이용하여 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 배양하였다.
실시예 2. 멜라닌 형성 검출 확인
실시예 2-1. UVB에 의한 멜라닌 형성 및 FAM86A 단백질 확인을 위한 웨스턴 블롯팅(Western blotting)
C57BL/6 쥐에 UVB(1mJ)를 처리한뒤 시간별로 피부조직을 적출한 후, PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 조직 용해 및 염색 시약인 RIPA 버퍼 200㎕를 처리하였다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였으며, 전기영동한 SDS-PAGE젤의 단백질을 PVDF막으로 이동시킨 후, 단백질 이동이 완료된 PVDF막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다. 그리고나서 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1 시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system 을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 단백질 양의 보정은 PVDF 막을 재활용(stripping )하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz에서 구입하였다.
도 1에 나타난 바와 같이, UVB에 의해 멜라닌 형성 과정이 진행되면서 FAM86A 단백질 발현량이 감소되는 것을 확인하였다. 또한, 동일한 샘플을 이용하여 실시예 2-2을 통하여 FAM86A의 발현량과 멜라닌 형성량을 비교했을 때 반비례하는 것을 확인할 수 있었다.
이를 통해, 멜라닌 형성에 FAM86A가 영향이 있음을 확인하였다.
실시예 2-2. UVB에 의한 멜라닌 형성 증가 확인
C57BL/6 쥐에 UVB(1mJ)를 처리한뒤 시간별로 피부조직을 적출 하였다. 얻어낸 조직에 cell lysis를 200㎕를 처리하여 조직를 용해시킨 후 4℃에서 12,000rpm으 로 5분간 원심분리한 뒤 상층액을 제거하였다. 확보한 침전물에 10% Sodium dodecyl sulfate - 1M NaOH 용액을 100㎕ 씩 분주하고 30분간 60℃로 가열하였다. 그 후 가열된 용액을 상온에 방치하여 25℃ 까지 냉각 후 405㎚에서 흡광도를 측정하였다. 이때, UVB를 처리하지 않은 세포에서의 멜라닌 형성 양을 100% 기준으로 하여, 멜라닌 양을 계산하였다.
도 1에 나타난 바와 같이, UVB에 의해 멜라닌 함량이 시간에 따라 점차 증가함을 확인하였다.
실시예 2-3. 마우스 색 종류에 따른 FAM86A 발현량 확인을 위한 웨스턴 블롯팅(Western blotting)
C57BL/6, ICR 마우스의 피부조직을 적출하고, PBS로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 조직 용해 및 염색 시약인 RIPA 버퍼 200㎕를 처리하였다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였다. 전기영동한 SDS-PAGE젤의 단백질을 PVDF막으로 이동시킨 후, 단백질 이동이 완료된 PVDF막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다. 그 다음 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 단백질 양의 보정은 PVDF 막을 재활용(stripping)하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz에서 구입하였다.
도 2에 나타난 바와 같이, 피부의 색에 따라 FAM86A 단백질 발현량이 변화되는 것을 확인하였다. 구체적으로, 검정색 마우스 피부에서는 FAM86A가 거의 발현되지 않은 한편, 흰색 마우스 피부에서는 FAM86A가 고발현되는 것을 확인하였다. 이는 멜라닌 형성에 FAM86A가 영향이 있음을 나타내는 결과이다.
실시예 2-4. 마우스의 피부 부위 색에 따른 FAM86A 발현량 확인을 위한 웨스턴 블롯팅(Western blotting)
C57BL/6 마우스의 귀 뒤(white skin) 및 귀와 귀 사이(black skin)의 피부조직을 적출한 후, PBS로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 조직 용해 및 염색 시약인 RIPA 버퍼 200㎕를 처리하였다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였다. 전기영동한 SDS-PAGE 젤의 단백질을 PVDF 막으로 이동시킨 후, 단백질 이동이 완료된 PVDF 막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다. 그 다음 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 그 결과를 도 3에 나타내었다. 단백질 양의 보정은 PVDF 막을 재활용(stripping)하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz에서 구입하였다.
도 3에 나타난 바와 같이, 피부의 색에 따라 FAM86A 단백질 발현량이 변화되는 것을 확인하였다. 구체적으로, 검정 피부에 해당하는 귀와 귀 사이의 피부 조직에서는 FAM86A가 거의 발현되지 않은 반편, 귀 뒤의 흰색 피부에서는 FAM86A가 고발현 되는 것을 확인하였다. 이는 멜라닌 형성에 FAM86A가 영향이 있음을 나타내는 결과이다.
실시예 2-5. α-MSH에 의한 멜라닌 형성 유도 및 FAM86A 단백질 발현량 확인을 위한 웨스턴 블롯팅(Western blotting)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4 개의 세포가 되도록 분주하여 24시간 동안 배양한 후, α-MSH를 100nM이 되도록 처리하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후, PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였다. 전기영동한 SDS-PAGE 젤의 단백질을 PVDF 막으로 이동시킨 후, 단백질 이동이 완료된 PVDF 막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다. 그 다음 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 단백질 양의 보정은 PVDF 막을 재활용 (stripping)하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz 에서 구입하였다.
도 4에 나타난 바와 같이, 멜라닌 형성 유도 물질인 α-MSH에 의해 멜라닌 생성이 증가하며, 그에 따라 FAM86A의 단백질 발현량이 감소하는 것을 확인하였다. 이를 통해 멜라닌 형성에 FAM86A가 영향이 있음을 확인하였다.
실시예 2-6. 멜라닌 형성 관련 유전자 발현량 확인(realtime PCR)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, α-MSH를 100nM이 되도록 처리하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양하였다. 48시간 후 세포 배양액을 모두 걷어 내고, TRI-Zol을 이용하여 상기 세포를 분해하고, BCP를 이용하여 중화시켰다. 중화시킨 액체에 isopropanol을 이용하여 mRNA를 침강시켰다. 이어서 원심분리기를 이용하여 침강된 mRNA만을 모아 실험에 이용하였다. 세포내 mRNA는 cDNA kit를 이용하여 cDNA로 합성하여, PCR을 통해 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, TYRP-2, MITF , FAM86A 유전자의 발현량을 확인하였다.
도 5에 나타난 바와 같이, α-MSH에 의해 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, TYRP-2, MITF 유전자의 발현량이 현저히 증가하였고, FAM86A는 반대로 감소하는 것을 확인 하였다. 이를 통해, 멜라닌 형성시 FAM86A 유전자의 발현량이 감소하는 것을 알 수 있었다.
실시예 3. FAM86A 과발현 여부에 따른 멜라닌 형성 감소 효과 확인
실시예 3-1. cAMP의 발현량 확인(ELISA)
마우스 흑색종 B16F10 세포에서 FAM86A 단백질의 과발현을 위해서 서열번호 47로 표시되는 FAM86A를 포함하는 벡터(pCMV Myc mFAM86A; 서열번호 46)와 Empty Vector(pCMV Myc; 서열번호 48)를 lipopectamine을 이용하여 각각 세포 내 형질 주입하여 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양하였다. 그 후 배양된 세포를 PBS로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 cAMP ELISA KIT(ab65355)를 이용하여 cAMP 단백질의 발현을 측정하였다.
그 결과, 도 6에 나타난 바와 같이, FAM86A 과발현 결과 cAMP의 발현이 감소함을 확인하였다.
실시예 3-2. FAM86A 과발현에 따른 폰타나 마손 염색(Fontana-Masson stain)을 통한 멜라닌 형성 감소 효과 확인
실시예 3-1과 같이, 마우스 흑색종 B16F10 세포에 Myc-FAM86A를 형질주입하여 FAM86A를 과발현 시킨 후 폰타나 마손 염색을 통하여 멜라닌을 염색하여 멜라닌 형성 정도를 현미경을 통해 확인하였다.
구체적으로, 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후 PBS 로 2회 세척후 1% amonical silver nitrate 용액을 1ml 씩 각 웰에 처리한 뒤 1시간 동안 60℃ 건조기를 통해 가열하였다. 그 후 흐르는 물에 3회 세척 후 Gold chloride 0.2% 용액을 1ml 씩 30초동안 처리하였다. 그 후 흐르는 물에 2회 세척 후 Sodium thiosulfate 5% 용액을 1ml 씩 처리하였고, 흐르는 물에 2회 세척 후 neutral red 0.5% 용액을 1ml 씩 2분간 처리한 뒤 흐르는 물에 세척하였다. 그 후 현미경을 통하여 결과를 확인하였다.
도 7에 나타난 바와 같이, FAM86A 과발현 결과 대조군에 비해 멜라닌이 감소 하는 것을 확인하였다. 이 결과를 통해 FAM86A가 과발현되었을 때 세포 내 및 세포 외에서 멜라닌이 감소됨을 확인하였다.
실시예 3-3. FAM86A 과발현에 따른 멜라닌 분비 감소 확인
실시예 3-1과 같이, 마우스 흑색종 B16F10 세포에 Myc-FAM86A를 형질주입하여 FAM86A를 과발현 시킨 후 멜라닌 분비 어세이(melanin secretion assay)를 통해 멜라닌 분비량을 확인하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후 세포 배양액 800㎕를 새 튜브에 옮기고 4℃에서 12,000rpm으로 5분간 원심 분리하여 상등액을 확보하였다. 확보한 상등액 중 100㎕를 96웰 플레이트에 분주하고 475㎚에서 흡광도를 측정하였다. 이때, FAM86A 유전자를 과발현하지 않은 세포에서의 멜라닌 양을 100% 기준으로 하여, 멜라닌 분비량을 계산하였다.
도 8에 나타난 바와 같이, FAM86A 과발현 결과 멜라닌 분비량이 대조군에 비해 크게 감소한 것을 확인하였다. 이에 따라 FAM86A가 증가되었을 때 멜라닌 분비를 감소시킴을 확인하였다.
실시예 3-4. FAM86A 과발현에 따른 멜라닌 생성량 확인
실시예 3-1과 같이, 마우스 흑색종 B16F10 세포에 Myc-FAM86A를 형질주입하여 FAM86A를 과발현 시킨 후 멜라닌 분비 어세이(melanin secretion assay)를 통해 멜라닌 생성량을 확인하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후에 세포 배양액을 제거하고 cell lysis buffer를 각 웰에 200㎕를 처리하여 세포를 용해시킨 후 4℃에서 12,000rpm으로 5분간 원심 분리한 뒤 상층액을 제거하였다. 확보한 침전물에 10% Sodium dodecyl sulfate - 1M NaOH 용액을 100㎕ 씩 분주하고 30분간 60℃로 가열하였다. 그 후 가열된 용액을 상온에 방치하여 25℃ 까지 냉각 후 405㎚에서 흡광도를 측정하였다. 이때, FAM86A 유전자를 과발현하지 않은 세포에서의 멜라닌 양을 100% 기준으로 하여, 멜라닌 양을 계산하였다.
도 9에 나타난 바와 같이, FAM86A 과발현 결과 멜라닌 생성량이 대조군에 비해 크게 감소한 것을 확인하였다. 이에 따라 FAM86A가 증가되었을 때 멜라닌 생성을 감소시킴을 확인하였다.
실시예 3-5. FAM86A 과발현에 따른 멜라닌 형성 관련 유전자 발현량 확인 (realtime PCR)
실시예 3-1과 같이, 마우스 흑색종 B16F10 세포에 Myc-FAM86A를 형질주입하여 FAM86A를 과발현 시킨 후 실시예 2-6의 real-time PCR법을 이용하여 멜라닌 형성에 중추적인 유전자(Tyrosinase, TYRP-1, TYRP-2, MITF) 발현량을 측정하였다.
구체적으로, 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양 하였다. 48시간 후 세포 배양액을 모두 걷어 내고, TRI-Zol을 이용하여 상기 세포를 분해하고, BCP를 이용하여 중화시켰다. 중화시킨 액체에 isopropanol을 이용하여 mRNA를 침강시켰다. 이어서 원심분리기를 이용하여 침강된 mRNA만을 모아 실험에 이용하였다. 세포 내 mRNA는 cDNA kit를 이용하여 cDNA로 합성하여, PCR을 통해 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, TYRP-2, MITF 유전자의 발현량을 확인하였다.
도 10에 나타난 바와 같이, FAM86A 과발현 결과 멜라닌 형성 관련 유전자들이 하향 조절됨을 확인하였다. 따라서, FAM86A의 과발현이 단백질 수준에서 뿐만 아니라 유전자 수준에서도 멜라닌 형성을 감소시킴을 확인하였다.
실시예 3-6. FAM86A 과발현에 따른 멜라닌 형성 관련 단백질 발현량 확인 (Western blotting)
실시예 3-1과 같이, 마우스 흑색종 B16F10 세포에 Myc-FAM86A를 형질주입하여 FAM86A를 과발현 시킨 후 실시예 2-5의 웨스턴 블롯팅을 통해 FAM86A K/D 수준 및 멜라닌 형성과 관련된 MAPK & MC1R 신호전달경로 단백질들의 발현량을 확인하였다.
구체적으로, 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양 하였다. 그 후 PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였다. 전기영동한 SDS-PAGE젤의 단백질을 PVDF막으로 이동시킨 후, 단백질 이동이 완료된 PVDF막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다.그 다음 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1 시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system 을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 단백질 양의 보정은 PVDF 막을 재활용 (stripping )하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz 에서 구입하였다.
도 11에 나타난 바와 같이, FAM86A 과발현 결과 MC1R 신호전달경로의 단백질인 MC1R, p-CREB 및 MITF 단백질의 발현량이 현저히 감소함을 확인하였다. 상기 결과를 통해 FAM86A의 발현이 높아짐에 따라 멜라닌 형성 신호전달경로인 MC1R의 활성도가 감소함을 확인함으로써 FAM86A 가 증가되면 멜라닌 형성을 감소시킴을 확인하였다.
실시예 4. FAM86A 넉다운 여부에 따른 멜라닌 형성 증가 확인
실시예 4-1. α-MSH 유도 멜라닌 세포에서 멜라닌 형성 증가 확인
멜라닌 세포주에서의 멜라닌 형성 유도를 위해 멜라닌 합성 촉진 호르몬인 α-MSH(melanocyte stimulating hormone)를 이용하였다.
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4 개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 표 1의 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자를 넉다운 시킨후. α-MSH를 100nM이 되도록 처리하였다. 처리한 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후에 세포 배양액을 제거하고, cell lysis buffer 를 각 웰에 200㎕를 처리하여 세포를 용해시킨 후, 4℃에서 12,000rpm으로 5분간 원심 분리한 뒤 상층액을 제거하였다. 확보한 침전물에 10% Sodium dodecyl sulfate- 1M NaOH 용액을 100㎕ 씩 분주하고 30분간 60℃로 가열하였다. 그 후 가열된 용액을 상온에 방치하여 25℃ 까지 냉각 후 405㎚에서 흡광도를 측정하였고, 그 결과를 도 12에 나타내었다. 이때, α-MSH 를 처리하지 않은 세포에서의 멜라닌 형성량을 100% 기준으로 하여, 멜라닌 양을 계산하였다.
도 12에 나타난 바와 같이, 멜라닌 합성 촉진 효소인 α-MSH 처리에 의해 형성이 증가된 멜라닌의 양이 FAM86A 넉다운 그룹에서 증가된 것을 확인하였다. 이를 통해, FAM86A 억제를 통해 멜라닌 형성을 증가시킬 수 있음을 알 수 있었다.
FAM86A의 shRNA( Homo sapiens, Mus musculus) sequence 및 Target sequence 서열(실시예에서 사용한 shRNA 서열 진하게 표시)
Species shRNA No. Gene NCBI accession No. shRNA sequence Target sequence Vector Mean Knockdown level
Homo sapiens 1 FAM86A NM_201400.4 CCGGGCAGAAACTGTTTCCCTACGACTCGAGTCGTAGGGAAACAGTTTCTGCTTTTTG (서열번호 11) GCAGAAACTGTTTCCCTACGA(서열번호 21) pLKO.1 0.93
2 FAM86A NM_201400.4 CCGGCGAGGGAATGTCCTTCTCAATCTCGAGATTGAGAAGGACATTCCCTCGTTTTTG (서열번호 12) CGAGGGAATGTCCTTCTCAAT(서열번호 22) pLKO.1 0.84
3 FAM86A NM_201400.4 CCGGGATGTTGTCATTGCAGCAGATCTCGAGATCTGCTGCAATGACAACATCTTTTTG (서열번호 13) GATGTTGTCATTGCAGCAGAT(서열번호 23) pLKO.1 0.79
4 FAM86A NM_201400.4 CCGGGCCAGCAGTTCTGGTTCTTAACTCGAGTTAAGAACCAGAACTGCTGGCTTTTTG(서열번호 14) GCCAGCAGTTCTGGTTCTTAA(서열번호 24) pLKO.1 0.77
5 FAM86A NM_201400.4 CCGGGCAGACATCACTGCCAAGTTACTCGAGTAACTTGGCAGTGATGTCTGCTTTTTG(서열번호 15) GCAGACATCACTGCCAAGTTA(서열번호 25) pLKO.1 0.6
Mus musculus 1 FAM86 NM_027446.2 CCGGGAGCATTCAGCCATCGTAATCCTCGAGGATTACGATGGCTGAATGCTCTTTTTG(서열번호 16) GAGCATTCAGCCATCGTAATC(서열번호 26) pLKO.1 0.56
2 FAM86 NM_027446.2 CCGGGTCTATGTAGCCTATACTATCCTCGAGGATAGTATAGGCTACATAGACTTTTTG(서열번호 17) GTCTATGTAGCCTATACTATC(서열번호 27) pLKO.1 0.87
3 FAM86 NM_027446.2 CCGGGCCTTACAGGCCTGGCAATTTCTCGAGAAATTGCCAGGCCTGTAAGGCTTTTTG(서열번호 18) GCCTTACAGGCCTGGCAATTT(서열번호 28) pLKO.1 unverified
4 FAM86 NM_027446.2 CCGGACGGACCTTCTGTGAAGTATGCTCGAGCATACTTCACAGAAGGTCCGTTTTTG(서열번호 19) ACGGACCTTCTGTGAAGTATG(서열번호 29) pLKO.1 unverified
5 FAM86 NM_027446.2 CCGGGTTGTCATTGCAGCAGATGTACTCGAGTACATCTGCTGCAATGACAACTTTTTG(서열번호 20) GTTGTCATTGCAGCAGATGTA(서열번호 30) pLKO.1 unverified
FAM86A의 siRNA( Homo sapiens) Target sequence 서열
Species siRNA No. Gene NCBI accession No. siRNA target sequence
Homo sapiens 1 FAM86A NM_201400.4 aactcttgctgcagagttt(서열번호 31)
2 FAM86A NM_201400.4 cttagaagcaaagttaaga(서열번호 32)
3 FAM86A NM_201400.4 ttaagagactcatcagatt(서열번호 33)
4 FAM86A NM_201400.4 tctcaatggcctctcatta(서열번호 34)
5 FAM86A NM_201400.4 gaatgtttggagaatgtta(서열번호 35)
Species siRNA No. Gene NCBI accession No. siRNA target sequence
Mus musculus 1 FAM86A NM_027446 AAGAGCATTCAGCCATCGTAA(서열번호 36)
2 FAM86A NM_027446 AAGATGCTCGAGGACTGCCAG(서열번호 37)
3 FAM86A NM_027446 AACTCAGTTACACTCTCTGAG(서열번호 38)
4 FAM86A NM_027446 AAACTCAGTTACACTCTCTGA (서열번호 39)
FAM86A의 miRNA( Homo sapiens, Mus musculus) sequence 및 target sequenc 서열
Species miRNA miRNA target gene miRNA target region miRNA sequence miRNA target sequence Reference
Homo sapiens miR-145 FAM86A 397-404 of 3' UTR caccttgtcctcacggtccagttttcccaggaatcccttagatgctaagatggggattcctggaaatactgttcttgaggtcatggtttggaaatactgttcttgagg tcatggtt(서열번호 40) aggaatc Integrated MicroRNA-mRNA profiling identifies oncostatin M as a marker of mesenchymal-like ER-negative/HER2-negative breast cancer, Target scan human_prediction of microRNA targets
miR-204 FAM86A 767-773 of 3' UTR ggctacagtctttcttcatgtgactcgtggacttccctttgtcatcctatgcctgagaatatatgaaggaggctgggaaggcaaagggacgttcaattgtcatcactggc(서열번호 41) aaaggga Target scan human_prediction of microRNA targets
miR-211 FAM86A 767-773 of 3' UTR tcacctggccatgtgacttgtgggcttccctttgtcatccttcgcctagggctctgagcagggcagggacagcaaaggggtgctcagttgtcacttcccacagcacggag(서열번호 42) aaaggga Target scan human_prediction of microRNA targets
Mus musculus miR-370 FAM86 796-802 of 3' UTR agacggagagaccaggtcacgtctctgcagttacacagctcatgagtgcctgctggggtggaacctggtttgtctgtct(서열번호 43) cagcagg Target scan mouse_prediction of microRNA targets
miR-290 FAM86 813-819 of 3' UTR ctcatcttgcggtactcaaactatgggggcacttttttttttctttaaaaagtgccgcctagttttaagccccgccggttgag(서열번호 44) tttgaga Target scan mouse_prediction of microRNA targets
miR-292 FAM86 813-819 of 3' UTR cagcctgtgatactcaaactgggggctcttttggattttcatcggaagaaaagtgccgccaggttttgagtgtcaccggttg(서열번호 45) tttgaga Target scan mouse_prediction of microRNA targets
FAM86 패밀리의 Sequence ( Homo sapiens, Mus musculus) 서열
Species Gene NCBI accession No. Sequence
Homo sapiens FAM86A NM_201400.4(서열번호 6) atggcgcccgaggagaacgcggggaccgaactcttgctgcagagtttcgagcgccgcttcctggcggcacgcacactgcgctccttcccctggcagagcttagaagcaaagttaagagactcatcagattctgagctgctgcgggatattttgcacaagactgtgaagcatcctgtgtgtgtgaagcacccgccgtccgtcaaatatgcccggtgctttctctcagaactcatcaaaaagcacgaggctgtccacacagagcctttggacgagctgtatgaagcgctggcggagaccctgatggccaaggagtccacccagggccaccggagctatttgctgccctcgggaggctcggtcacactctccgagagcacggccatcatctcctacggtaccacaggcctggtcacatgggacgccgccctctaccttgcagaatgggccatcgagaacccggcagtcttcactaacaggactgtcctagagcttggcagtggtgctggcctcacaggcctggccatctgcaagatgtgccgcccccgggcatacatcttcagcgactgtcacagccgggtccttgagcagctccgagggaatgtccttctcaatggcctctcattagaggcagacatcactgccaagttagacagccccagggtgacagtggcccagctggactgggacgtcgcgacggtccatcagctctctgccttccagccagatgttgtcattgcagcagatgtgctgtattgcccagaagccatcatgtcgctggtcggcgtcctgcggaggctggctgcctgccgggagcaccagcgggctcctgaggtctacgtggcctttaccgtccgcaacccagagacgtgccagctgttcaccaccgagctaggccgggccgggatcagatgggaagtggaacctcgtcatgagcagaaactgtttccctacgaagagcacttggagatggcaatgctgaatctcaccctgtag
Amino acid Sequence
FAM86A(NP_958802.1) mapeenagtelllqsferrflaartlrsfpwqsleaklrdssdsellrdilhktvkhpvcvkhppsvkyarcflselikkheavhtepldelyealaetlmakestqghrsyllpsggsvtlsestaiisygttglvtwdaalylaewaienpavftnrtvlelgsgagltglaickmcrprayifsdchsrvleqlrgnvllnglsleaditakldsprvtvaqldwdvatvhqlsafqpdvviaadvlycpeaimslvgvlrrlaacrehqrapevyvaftvrnpetcqlfttelgragirweveprheqklfpyeehlemamlnltl(서열번호 1)
FAM86B1(NP_001077006.1) mapeenagtelllqgferrflavrtlrsfpwqsleaklrdssdsellrdilqktvrhpvcvkhppsvkyawcflselikkssggsvtlskstaiishgttglvtwdaalylaewaienpaafinrtvlelgsgagltgla ickmcrprayifsdphsrvleqlrgnvllnglsleaditgnldsprvtvaqldwdvamvhqlsafqpdvviaadvlycpeaivslvgvlq rlaacrehkrapevyvaftvrnpetcqlfttelgrdgirweaeahhdqklfpygehlemamlnltl(서열번호 2)
FAM86B2(NP_001131082.1) mapeenagtelllqgferrflavrtlrsfpwqsleaklrdssdsellrdilqktvrhpvcvkhppsvkyawcflselikkheavhtepldklyevlaetlmakestqghrsyllssggsvtlskstaiishgttglvtwdaalylaewaienpaafinrtvlelgsgagltglaickmcrprayifsdphsrileqlrgnvllnglsleaditgnldsprvtvaqldwdvamvhqlsafqpdvviaadvlycpeaivslvgvlqrlaacrehkrapevyvaftvrnpetcqlfttelgrdgirweaeahhdqklfpygehlemamlnltl(서열번호 3)
FAM86C1(NP_060642.2) mapeenagselllqsfkrrflaaralrsfrwqsleaklrdssdsellrdilqkheavhtepldelyevlvetlmakestqghrsylltcciaqkpscrwsgscggwlpagstsgllnstwplpsatqrcascsppsyaglgsdgkrklimtrncfptestwrwqs(서열번호 4)
FAM86(NP_081722.1) mapedhegatsllqsferrflaaralpsfpwqsleeklkdpsgselllailqrtvkhpvcvqhgpsvkyarcflsklikkheavptepldalyealaevlmtqestqchrsyllpsgnsvtlsestaivshgttglvtwdaalylaewaienpaaftdrtilelgsgagltglaickaccprayifsdchaqvleqlrgnvllngfslephtpidagsskvtvaqldwdevtasqlsafqadvviaadvlycwemtlslvrvlkmledcqrksapdvyvaytirsqdtgklfieeldragiyweevpphtgklfpyeehsaivilklvltsrhgv(서열번호 5)
실시예 4-2. α-MSH 유도 멜라닌 세포에서 멜라닌 분비 증가 확인
멜라닌 세포주에서의 멜라닌 형성 유도를 위해 멜라닌 합성 촉진 호르몬인 α-MSH(melanocyte stimulating hormone)를 이용하였다.
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A(family with sequence similarity 86, member A) shRNA를 이용하여 FAM86A 유전자를 넉다운 시킨 후 α-MSH를 100nM이 되도록 처리하였다. 처리한 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후에 세포 배양액 800㎕를 새 튜브에 옮기고 4℃에서 12,000rpm으로 5분간 원심 분리하여 상등액을 확보하였다. 확보한 상등액 중 100㎕를 96웰 플레이트에 분주하고 475㎚에서 흡광도를 측정하였다. 이때, α-MSH를 처리하지 않은 세포 배양액에서의 멜라닌 분비 양을 100% 기준으로 하여, 멜라닌 양을 계산하였다.
도 13에 나타난 바와 같이, 멜라닌 합성 촉진 효소인 α-MSH 처리에 의해 형성이 증가된 멜라닌의 분비량이 FAM86A 넉다운 그룹에서 증가된 것을 확인하였다. 이를 통해, FAM86A 억제에 의해 멜라닌 분비가 증가하는 효과를 나타낸다는 것을 알 수 있었다.
실시예 4-3. FAM86A 넉다운 유무에 따른 멜라닌 형성 증가 확인
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후에 세포 배양액을 제거하고 cell lysis buffer를 각 웰에 200㎕를 처리하여 세포를 용해시킨 후 4℃에서 12,000rpm으로 5분간 원심 분리한 뒤 상층액을 제거하였다. 확보한 침전물에 10% Sodium dodecyl sulfate - 1M NaOH 용액을 100㎕ 씩 분주하고 30분간 60℃로 가열하였다. 그 후 가열된 용액을 상온에 방치하여 25℃ 까지 냉각 후 405㎚에서 흡광도를 측정하였다. 이때, FAM86A 유전자를 넉다운하지 않은 세포에서의 멜라닌양을 100% 기준으로 하여, 멜라닌 양을 계산하였다.
도 14에 나타난 바와 같이, 멜라닌의 양이 FAM86A 넉다운 그룹에서 증가된 되는 것을 확인하였다. 이를 통해, FAM86A 억제에 의해 멜라닌 형성 증가하는 효과를 나타낸다는 것을 알 수 있었다.
실시예 4-4. FAM86A 넉다운 유무에 따른 멜라닌 분비 증가 확인
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후 세포 배양액 800㎕를 새 튜브에 옮기고 4℃에서 12,000rpm으로 5분간 원심 분리하여 상등액을 확보하였다. 확보한 상등액 중 100㎕를 96웰 플레이트에 분주하고 475㎚에서 흡광도를 측정하였다. 이때, FAM86A 유전자를 넉다운하지 않은 세포에서의 멜라닌양을 100% 기준으로 하여, 멜라닌 분비량을 계산하였다.
도 15에 나타난 바와 같이, 멜라닌 분비량이 FAM86A 넉다운 그룹에서 증가된 되는 것을 확인하였다. 이를 통해, FAM86A 억제에 의해 멜라닌 분비가 증가되는 효과를 나타낸다는 것을 알 수 있었다.
실시예 4-5. 멜라닌 형성 신호전달경로 단백질 발현 확인을 위한 웨스턴 블롯팅(Western blotting)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양 하였다. 그 후 PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 10% SDS-PAGE를 이용하여 전기영동을 수행하였다. 전기영동한 SDS-PAGE젤의 단백질을 PVDF막으로 이동시킨 후, 단백질 이동이 완료된 PVDF막을 상온에서 TBS-T(in 100mM NaCl, 10mM Tris, 0.1%(v/v) Tween-20, pH 7.4 (PBST)containing 3% BSA)로 블록킹하였다.그 다음 TBS-T를 사용하여 10분간 3회 세척한 후, 3% BSA를 녹인 TBS-T에 1차 항체를 1시간 처리하고, TBS-T로 충분히 세척하였다. 그리고 2차 항체를 1 시간 동안 처리하고 PBS-T로 10분씩 3회 세척하였다. 그 다음 ECL detection system 을 사용하여 특정 단백질의 양 및 위치를 확인하였다. 단백질 양의 보정은 PVDF 막을 재활용(stripping) 하여 액틴 단백질의 양을 확인함으로써 동량임을 확인하였다. 각각의 항체는 Cell signaling 및 Santacruz 에서 구입하였다.
도 16에 나타난 바와 같이, 멜라닌 형성과 관련된 MAPK & MC1R 신호전달경로 단백질들의 발현량을 확인하였다. FAM86A가 K/D 군에서는 멜라닌 형성과 관련된 p-JNK , p-p38을 증가되었며, p-ERK 는 감소하였고, MC1R 신호전달경로의 단백질인 p-PKA, p-CREB 및 MITF 단백질의 발현량은 현저히 증가함을 확인하였다. 이러한 결과를 통해 FAM86A의 발현이 낮아짐에 따라 멜라닌 형성 신호전달경로인 MC1R 의 활성도가 증가함을 확인함으로써, FAM86A가 감소되면 멜라닌 형성을 증가시킴을 확인하였다. 이를 통해, FAM86A에 의해 멜라닌 분비를 증가하는 효과를 나타낸다는 것을 알 수 있었다.
실시예 4-6. 세포에서 멜라닌 존재 확인을 위한 폰타나 마손 염색법(Fontana-Masson staining)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양한 후 PBS 로 2회 세척후 1% amonical silver nitrate 용액을 1ml 씩 각 웰에 처리한 뒤 1시간 동안 60℃ 건조기를 통해 가열하였다. 그 후 흐르는 물에 3회 세척 후 Gold chloride 0.2% 용액을 1ml 씩 30초동안 처리하였다. 그 후 흐르는 물에 2회 세척 후 Sodium thiosulfate 5% 용액을 1ml 씩 처리하였고, 흐르는 물에 2회 세척 후 neutral red 0.5% 용액을 1ml 씩 2분간 처리한 뒤 흐르는 물에 세척하였다. 그 후 현미경을 통하여 결과를 확인하였다.
도 17에 나타난 바와 같이, 멜라닌이 FAM86A 넉다운 그룹에서 더욱 많이 존재하는 것을 확인하였다. 이를 통해, FAM86A 억제에 의해 세포 내 및 세포외 멜라닌이 증가되는 것을 나타낸다는 것을 알 수 있었다.
실시예 4-7. 멜라닌 형성 관련 유전자 발현량 확인 (realtime PCR)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 세포는 37℃, 5% 이산화탄소(CO 2) 조건의 세포 배양기에서 48시간 동안 배양 하였다. 48시간 후 세포 배양액을 모두 걷어 내고, TRI-Zol을 이용하여 상기 세포를 분해하고, BCP를 이용하여 중화시켰다. 중화시킨 액체에 상층액을 따로 분리한 뒤 isopropanol을 이용하여 mRNA를 침강시켰다. 이어서 원심분리기를 이용하여 침강된 mRNA만을 모아 실험에 이용하였다. 세포내 mRNA는 cDNA kit를 이용하여 cDNA로 합성하여, PCR을 통해 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, TYRP-2, MITF 유전자의 발현량을 확인하였다.
도 18에 나타난 바와 같이, 멜라닌 형성이 FAM86A 넉다운 그룹에서 멜라닌 형성에 중요한 유전자인 Tyrosinase, TYRP-1, TYRP-2, MITF 유전자의 발현량이 현저히 증가하는 것을 확인 하였다. 이를 통해, FAM86A 억제에 의해 멜라닌 형성이 증가하는 효과를 나타낸다는 것을 알 수 있었다.
실시예 4-8. cAMP 발현량 확인(ELISA)
상기 실시예 1에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 그 후 PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 cAMP ELISA KIT(ab65355)를 이용하여 cAMP 단백질의 발현을 측정하였다.
도 19에 나타난 바와 같이, FAN86A 넉다운 그룹에서는 cAMP의 발현이 증가함을 확인하였다.
실시예 4-9. MC1R 단백질에 바인딩하는 단백질 확인(면역침전법)
상기 실시예 1 에서 배양한 B16F10 세포를 6웰 플레이트에 웰 당 5×10 4개의 세포가 되도록 분주하여 24시간 동안 배양한 후, 서열번호 17로 표시되는 FAM86A shRNA를 이용하여 FAM86A 유전자의 넉다운을 유도하였다. 그 후 PBS 로 2회 세척하였다. 그 다음 PBS를 완전히 제거한 후 세포 용해 및 염색 시약인 RIPA 버퍼 200㎕를 각각의 접시에 넣고 스크래퍼를 이용하여 긁었다. 그 다음 BCA assay로 단백질을 정량한 후 면역침강 분석을 수행하기 위해서, 세포 용해액을 항-MC1R 항체(3㎍)를 처리하여 PBS에서 1시간 동안 반응시켰고, 그 후 단백질 A/G-아가로스 비드(protein A/G-agarose beads)를 첨가하여 4℃ 조건에서 24시간 동안 반응시켰다. 상기 비드를 1 mM DTT가 함유된 PBS로 3회 세척하고, 2X protein loading dye(25 % SDS, 62.5mM Tris-HCl (pH 6.8), 25% Gylcerol, and 0.01% Bromophenol Blue)와 함 께 5분간 95℃ 온도로 가열하였다. 상기 샘플들을 SDS-PAGE를 이용하여 전기 영동을 진행하여 넉다운된 세포에서 멜라닌 형성에 중추적인 MC1R 단백질에 바인딩하는 단백질들을 확인 하였다.
도 20에 나타난 바와 같이, MC1R이 FAM86A와 결합하여 멜라닌 형성에 작용하는 것을 확인하였다.
이상의 실시예를 종합하여, 본 발명자들은 FAM86A를 멜라닌 생성의 검출 바이오마커로서 활용할 수 있음을 확인하였는 바, FAM86A 수준을 측정함으로써 멜라닌 형성 검출하고, 그에 따라 색소관련 피부 상태를 진단할 수 있음을 확인하였다.
뿐만 아니라, 본 발명의 FAM86A 단백질을 포함하는 미백용 건강기능식품, 화장료 조성물과 이들 개발을 위한 마커로 이용될 수 있음을 알 수 있다.
이에 더하여, 본 발명의 FAM86A 단백질 또는 이의 아고니스트를 피부 미백용 화장료 조성물로 이용할 수 있음을 알 수 있다.
또한, 본 발명자들은 FAM86A 억제를 통하여 멜라닌 형성 및 분비가 증가됨에 따라 멜라닌 결핍 질환의 예방 및 치료 효과가 있음을 확인하였는 바, FAM86A의 발현 또는 활성을 제어하는 억제제를 멜라닌 결핍 질환의 예방, 치료, 또는 개선을 위한 약제 및 건강기능식품, 화장료 조성물과 이들의 개발을 위한 선도물질에 이용될 수 있음을 알 수 있다.
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가지는 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
본 발명의 FAM86A는 멜라닌 분비 또는 형성량의 증가에 따라 그 수준이 감소하므로, FAM86A 단백질 또는 그 아고니스트를 이용하여 피부 미백이 가능하고, FAM86A 억제 시 멜라닌 형성 및 분비가 촉진되어 백반증 등 멜라닌 결핍 질환의 예방, 치료, 또는 개선이 가능하므로, FAM86A 단백질 또는 아고니스트를 이용한 피부 미백용 조성물 및 FAM86A 억제제를 이용한 멜라닌 결핍 질환의 예방과 치료를 위한 조성물 등 다양한 방면으로 이용될 수 있으므로 산업상 이용가능성이 있다.

Claims (28)

  1. FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 조성물.
  2. 제1항에 있어서,
    상기 mRNA의 발현 수준을 측정하는 제제는 FAM86A의 mRNA에 특이적으로 결합하는 프로브 또는 프라이머인 것을 특징으로 하는, 멜라닌 형성 검출용 조성물.
  3. 제1항에 있어서,
    상기 단백질의 발현 수준을 측정하는 제제는 FAM86A의 단백질에 특이적인 항체 또는 앱타머인 것을 특징으로 하는, 멜라닌 형성 검출용 조성물.
  4. FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 제제를 포함하는 멜라닌 형성 검출용 키트.
  5. FAM86A의 단백질 또는 이의 mRNA 발현 수준을 측정하는 제제의 멜라닌 형성 검출 용도.
  6. 하기 단계를 포함하는 피부 미백 물질의 스크리닝 방법:
    (a) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
    (b) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
    (c) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 증가시킨 물질을 피부 미백 물질로 선별하는 단계.
  7. 하기 단계를 포함하는 멜라닌 결핍 질환 예방 또는 치료제의 스크리닝 방법:
    (A) FAM86A의 단백질 또는 이의 mRNA를 발현하는 세포에 시험물질을 처리하는 단계;
    (B) 시험물질을 처리한 세포와 처리하지 않은 세포에서 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 측정하는 단계; 및
    (C) 대조군 세포와 비교해 상기 FAM86A의 단백질 또는 이의 mRNA의 발현량을 감소시킨 물질을 멜라닌 결핍 질환 예방 또는 치료제로 선별하는 단계.
  8. 하기 단계를 포함하는 색소관련 피부 상태의 진단에 필요한 정보를 제공하기 위한 방법:
    (i) 피검체로부터 수득한 시료에서 FAM86A의 단백질 또는 이의 mRNA의 발현 수준을 측정하는 단계; 및
    (ii) 상기 FAM86A 단백질 또는 이의 mRNA의 발현 수준을 정상 대조구와 비교하여 FAM86A 단백질 또는 이의 mRNA의 발현 수준이 감소한 피검체를 멜라닌이 과다 생성될 것으로 예측하는 단계.
  9. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 피부 미백용 조성물.
  10. 제9항에 있어서,
    상기 조성물은 화장료 조성물 또는 식품 조성물인 것을 특징으로 하는, 조성물.
  11. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물을 개체에 투여하는 단계를 포함하는 피부 미백 방법.
  12. 피부 미백용 제제를 제조하기 위한 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제의 용도.
  13. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물의 피부 미백 용도.
  14. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 유효성분으로 포함하는 색소 침착 질환의 예방 또는 치료용 약학적 조성물.
  15. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물을 개체에 투여하는 단계를 포함하는 색소 침착 질환의 예방 또는 치료 방법.
  16. 색소 침착 질환 약제를 제조하기 위한 FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제의 용도.
  17. FAM86A 단백질, 이의 아고니스트 또는 이의 활성화제를 포함하는 조성물의 색소 침착 질환의 예방 또는 치료 용도.
  18. FAM86A 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물.
  19. 제18항에 있어서,
    상기 조성물은 약학적 조성물, 식품 조성물 및 화장료 조성물로 이루어진 군에서 선택된 하나인 것을 특징으로 하는, 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물.
  20. 제18항에 있어서,
    상기 억제제는 FAM86A 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, RNAi, siRNA, miRNA, shRNA 및 리보자임으로 이루어진 군에서 하나 이상 선택된 것을 특징으로 하는, 멜라닌 결핍 질환의 예방, 치료 또는 개선용 조성물.
  21. FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 멜라닌 결핍 질환을 예방 또는 치료하는 방법.
  22. 멜라닌 결핍 질환의 예방 또는 치료를 위한 약제를 제조하기 위한 FAM86A 억제제의 용도.
  23. FAM86A 억제제를 유효성분으로 포함하는 조성물의 멜라닌 결핍 질환의 예방 또는 치료 용도.
  24. FAM86A 억제제를 유효성분으로 포함하는 멜라닌 생성 촉진용 조성물.
  25. 제24항에 있어서,
    상기 조성물은 흑모 유발 촉진용 또는 개체의 색 조절용인 것을 특징으로 하는, 조성물.
  26. FAM86A 억제제를 유효성분으로 포함하는 조성물을 개체에 투여하여 멜라닌 생성을 촉진하는 방법.
  27. 멜라닌 생성 촉진제를 제조하기 위한 FAM86A 억제제의 용도.
  28. FAM86A 억제제를 유효성분으로 포함하는 조성물의 멜라닌 생성 촉진 용도.
PCT/KR2020/095119 2019-08-16 2020-08-14 Fam86a를 이용한 멜라닌 형성 검출 방법 WO2021034179A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/635,294 US20220334130A1 (en) 2019-08-16 2020-08-14 Melanogenesis detection method using fam86a

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
KR10-2019-0100307 2019-08-16
KR20190100307 2019-08-16
KR10-2019-0100308 2019-08-16
KR20190100308 2019-08-16
KR1020200101716A KR102372647B1 (ko) 2019-08-16 2020-08-13 멜라닌 형성 검출용 조성물 및 피부 미백 물질의 스크리닝 방법
KR1020200101715A KR102531515B1 (ko) 2019-08-16 2020-08-13 Fam86a 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료, 또는 개선용 조성물
KR10-2020-0101716 2020-08-13
KR10-2020-0101715 2020-08-13

Publications (1)

Publication Number Publication Date
WO2021034179A1 true WO2021034179A1 (ko) 2021-02-25

Family

ID=74659708

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/095119 WO2021034179A1 (ko) 2019-08-16 2020-08-14 Fam86a를 이용한 멜라닌 형성 검출 방법

Country Status (2)

Country Link
US (1) US20220334130A1 (ko)
WO (1) WO2021034179A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080207497A1 (en) * 2000-12-04 2008-08-28 Immunotope, Inc. Cytotoxic t-lymphocyte-inducing immunogens for prevention, treatment, and diagnosis of cancer
KR20100082202A (ko) * 2009-01-08 2010-07-16 사회복지법인 삼성생명공익재단 멜라닌 과다 생성 검출용 마커 및 이의 용도
US20150064236A1 (en) * 2012-04-02 2015-03-05 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins
KR20190016624A (ko) * 2010-10-26 2019-02-18 센자겐 아베 인간 피부의 민감화를 유도하는 물질의 동정에 사용하기 위한 분석 방법 및 어레이
KR20190032250A (ko) * 2017-09-19 2019-03-27 주식회사 스킨큐씨 D-타이로신 또는 이를 포함하는 펩타이드를 포함하는 피부 미백용 조성물

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080207497A1 (en) * 2000-12-04 2008-08-28 Immunotope, Inc. Cytotoxic t-lymphocyte-inducing immunogens for prevention, treatment, and diagnosis of cancer
KR20100082202A (ko) * 2009-01-08 2010-07-16 사회복지법인 삼성생명공익재단 멜라닌 과다 생성 검출용 마커 및 이의 용도
KR20190016624A (ko) * 2010-10-26 2019-02-18 센자겐 아베 인간 피부의 민감화를 유도하는 물질의 동정에 사용하기 위한 분석 방법 및 어레이
US20150064236A1 (en) * 2012-04-02 2015-03-05 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins
KR20190032250A (ko) * 2017-09-19 2019-03-27 주식회사 스킨큐씨 D-타이로신 또는 이를 포함하는 펩타이드를 포함하는 피부 미백용 조성물

Also Published As

Publication number Publication date
US20220334130A1 (en) 2022-10-20

Similar Documents

Publication Publication Date Title
WO2017030410A1 (ko) 검정콩잎 추출물 및 이로부터 분리한 플라보놀배당체를 유효성분으로 함유하는 대사증후군의 예방 또는 치료용, 또는 항산화용 조성물
WO2017123066A1 (ko) Pgc-1알파의 발현을 증가시키는 조성물
WO2017142305A1 (ko) 발모 촉진 활성 및/또는 멜라닌 생성 촉진 활성을 나타내는 펩타이드 및 이의 용도
WO2018124508A1 (ko) 3,5-디카페오일퀴닉에시드 또는 국화 추출물을 함유하는 근육 질환 예방 및 치료용 또는 근 기능 개선용 조성물
WO2019182370A1 (ko) Cox2 아세틸화제를 유효성분으로 포함하는 퇴행성 신경질환의 예방 또는 치료용 약학적 조성물
WO2016080796A2 (ko) 세스퀴테르펜 화합물을 포함하는, stat3 매개 질환의 예방 또는 치료용 약학적 조성물 및 이의 용도
WO2021034179A1 (ko) Fam86a를 이용한 멜라닌 형성 검출 방법
WO2022114728A2 (ko) Shmt 억제제 또는 mthfr 억제제를 포함하는 박테리아 감염 치료용 조성물
WO2021107547A1 (ko) 호흡기 질환의 예방, 개선 또는 치료용 조성물
WO2018128479A1 (ko) 수베르산 또는 이의 약학적으로 허용 가능한 염을 유효성분으로 포함하는 근육 질환 예방 또는 치료용 조성물
WO2019059634A1 (ko) D-타이로신 또는 이를 포함하는 펩타이드를 포함하는 피부 미백용 조성물
WO2018236186A1 (ko) 세스퀴테르펜 유도체를 유효성분으로 함유하는 근육 질환 예방 또는 치료용 조성물
WO2019017677A2 (ko) 시트랄을 유효성분으로 함유하는 근력강화, 근육증강, 근육분화, 근육재생 또는 근감소증 억제효과를 갖는 조성물
WO2020055129A1 (ko) 베르베논 유도체를 포함하는 암 치료 또는 예방용 조성물
WO2017213435A1 (ko) Slit-robo 시스템을 이용한 근감소증 예방 또는 치료용 조성물
WO2022050634A1 (ko) 펩타이드 및 이를 포함하는 화장료 조성물 및 약학 조성물
WO2022014975A1 (ko) Bi-1 길항제 및 그의 용도
WO2022231294A1 (ko) 피부 색소침착의 예방, 개선, 또는 치료용 조성물
KR20210020825A (ko) Fam86a 억제제를 유효성분으로 포함하는 멜라닌 결핍 질환의 예방, 치료, 또는 개선용 조성물
WO2019103572A1 (ko) Mirna를 포함하는 탈모 방지 또는 발모 촉진용 조성물
WO2023195749A1 (ko) 신규한 foxn1 변이체 및 이의 용도
WO2017192013A1 (ko) 팥을 포함하는 근 기능 개선 또는 운동수행능력 향상용 조성물
WO2018155933A1 (ko) 아쿠아포린-3의 발현을 증가시키는 6,7-디메톡시-2,2-디메틸-2h-크로멘 및 이의 용도
WO2018012889A1 (ko) Itac의 억제제를 포함하는 조성물
WO2023106896A1 (ko) 신규 아디포넥틴 유래 펩토이드 유도체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20855194

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20855194

Country of ref document: EP

Kind code of ref document: A1