WO2020160514A1 - Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors - Google Patents
Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors Download PDFInfo
- Publication number
- WO2020160514A1 WO2020160514A1 PCT/US2020/016285 US2020016285W WO2020160514A1 WO 2020160514 A1 WO2020160514 A1 WO 2020160514A1 US 2020016285 W US2020016285 W US 2020016285W WO 2020160514 A1 WO2020160514 A1 WO 2020160514A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- deaminase
- fusion protein
- cas9
- amino acid
- terminal fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/80—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/10—Applications; Uses in screening processes
- C12N2320/11—Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/04—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
- C12Y305/04005—Cytidine deaminase (3.5.4.5)
Definitions
- nucleobase editors have the ability to introduce specific point mutations into target polynucleotides.
- Nucleobase editors induce base changes without introducing double- stranded DNA breaks, and include adenosine base editors that convert target A ⁇ T to G*C and cytidine base editors that convert target C * G to T * A.
- introduction of nucleobase editors in cells has the potential to generate undesired base editor-associated edits, including genome-wide spurious deamination, bystander mutation, and target proximal edits.
- Spurious deamination events may occur throughout the genome, catalyzed by the base editor deamination domain acting independently of targeted base editing via programming of CRISPR-Cas domain by a guide RNA. Without being bound by theory, genome-wide spurious deamination events have the potential to occur where a single stranded DNA substrate is formed, for example due to“DNA breathing” or at DNA replication forks.
- Target proximal edits are base editing events that occur outside the on-target sequence, but are within ⁇ 200bp upstream or downstream of the targeted region.
- Bystander mutations are mutations that occur within the on-target, Cas9/sgRNA guided, base editing window which are not the desired target nucleobase. Bystander mutation may result in either silent mutation (no amino acid change) or non-synonymous mutation (amino acid change). Thus, there is a need for base editors having reduced non-target deamination.
- fusion protein comprising a deaminase inserted within a flexible loop of a Cas9 polypeptide, wherein the fusion protein comprises the structure:
- a fusion protein comprising a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide, wherein the C- terminus of the N terminal fragment or the N-terminus of the C terminal fragment comprises a part of a flexible loop of the Cas9 polypeptide.
- the deaminase of the fusion protein deaminates a target nucleobase in a target polynucleotide sequence.
- the flexible loop comprises an amino acid in proximity to the target nucleobase when the fusion protein deaminates the target nucleobase.
- the flexible loop comprises a part of an alpha-helix structure of the Cas9 polypeptide.
- the target nucleobase is deaminated with lower off-target deamination as compared to an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of SEQ ID NO: 1.
- the target nucleobase is 1-20 nucleobases away from a Protospacer Adjacent Motif (PAM) sequence in the target polynucleotide sequence. In some embodiments, the target nucleobase is 2-12 nucleobases upstream of the PAM sequence. In some embodiments, the flexible loop comprises a region selected from the group consisting of amino acid residues at positions 530-537, 569-579, 686-691, 768-793, 943-947, 1002- 1040, 1052-1077, 1232-1248, and 1298-1300 as numbered in SEQ ID NO: 1, or a corresponding region thereof.
- the deaminase is inserted between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029- 1030, 1040-1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase is inserted between amino acid positions 768- 769, 792-793, 1022-1023, 1026-1027, 1040-1041, 1068-1069, or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof. In some embodiments, the deaminase is inserted between amino acid positions 1016-1017, 1023-1024, 1029-1030, 1040-1041, 1069-1070 or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the N-terminal fragment comprises amino acid residues 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, and/or 1248-1297 of the Cas9 polypeptide as numbered in SEQ ID NO: 1, or corresponding residues thereof.
- the C-terminal fragment comprises amino acid residues 1301-1368, 1248- 1297, 1078-1231, 1026-1051, 948-1001, 692-942, 580-685, and/or 538-568 of the Cas9 polypeptide as numbered SEQ ID NO: 1, or corresponding residues thereof.
- the N terminal fragment or the C terminal fragment of the Cas9 polypeptide binds the target polynucleotide sequence.
- the N- terminal fragment or the C-terminal fragment of the Cas9 polypeptide comprises a DNA binding domain. In some embodiments, the N-terminal fragment or the C-terminal fragment comprises a RuvC domain. In some embodiments, the N-terminal fragment or the C terminal fragment comprises a HN ⁇ domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises a HNH domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises a RuvC domain. In some embodiments, the Cas9 polypeptide comprises a partial or complete deletion in one or more structural domains. In some embodiments, the deaminase is inserted at the partial or complete deletion position of the Cas9 polypeptide.
- the deletion is within a RuvC domain. In some embodiments, the deletion is within an HNH domain. In some embodiments, the deletion bridges a RuvC domain and a C-terminal domain, a L-I domain and a HNH domain, or a RuvC domain and a L-I domain.
- the Cas9 polypeptide comprises a deletion of amino acids 1017-1069 as numbered in SEQ ED NO: 1 or corresponding amino acids thereof. In some embodiments, the Cas9 polypeptide comprises a deletion of amino acids 792-872 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof. In some embodiments, the Cas9 polypeptide comprises a deletion of amino acids 792-906 as numbered in SEQ ID NO:
- fusion protein comprising a deaminase inserted within a Cas9 polypeptide, wherein the fusion protein comprises the structure:
- the C terminal amino acid of the N terminal fragment is amino acid 791 as numbered in SEQ ID NO: 1.
- the N terminal amino acid of the C terminal fragment is amino acid 907 as numbered in SEQ ID NO: 1.
- the N terminal amino acid of the C terminal fragment is amino acid 873 as numbered in SEQ ID NO: 1.
- fusion protein comprising a deaminase inserted within a Cas9 polypeptide, wherein the fusion protein comprises the structure:
- the deaminase is a cytidine deaminase or an adenosine deaminase.
- the cytidine deaminase is an APOBEC cytidine deaminase, an activation induced cytidine deaminase (AID), or a CDA.
- AID activation induced cytidine deaminase
- the APOBEC deaminase is APOBEC 1, APOBEC2, APOBEC3A,
- APOBEC3B APOBEC3C
- APOBEC3D APOBEC3D
- APOBEC3E APOBEC3F
- APOBEC3G APOBEC3G
- the APOBEC deaminase is rAPOBECl.
- the fusion protein of any one of aspects above further comprises a UGI domain.
- the adenosine deaminase is a TadA deaminase. In some embodiments, the TadA deaminase is a modified TadA. In some embodiments, the TadA deaminase is a TadA 7.10. In some embodiments, the adenosine deaminase is a TadA dimer. In some embodiments, the TadA dimer comprises a TadA 7.10 and a wild type TadA.
- the optional linker comprises (SGGS)n, (GGGS)n, (GGGGS) n, (G)n, (EAAAK)n, (GGS)n, SGSETPGTSESATPES, or (XP)n motif, or a combination thereof, wherein n is independently an integer between 1 and 30.
- the N terminal fragment of the Cas9 polypeptide is fused to the deaminase without a linker.
- the C terminal fragment of the Cas9 is fused to the deaminase without a linker.
- the fusion protein of any one of aspects above further comprises an additional catalytic domain.
- the additional catalytic domain is a second deaminase.
- the second deaminase is fused to the N terminus or the C terminus of the fusion protein.
- the deaminase is a cytidine deaminase or an adenosine deaminase.
- the fusion protein of any one of aspects above further comprises a nuclear localization signal.
- the nuclear localization signal is a bipartite nuclear localization signal.
- the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9),
- the Cas9 polypeptide is a modified Cas9 and has specificity for an altered PAM.
- the Cas9 polypeptide is a nickase.
- the Cas9 polypeptide is nuclease inactive.
- the fusion protein is further complexed with the target polynucleotide.
- an expression vector comprising the polynucleotide described above.
- the expression vector is a mammalian expression vector.
- the vector is a viral vector selected from the group consisting of adeno- associated virus (AAV), retroviral vector, adenoviral vector, lentiviral vector, Sendai virus vector, and herpesvirus vector.
- AAV adeno-associated virus
- retroviral vector adenoviral vector
- lentiviral vector lentiviral vector
- Sendai virus vector Sendai virus vector
- herpesvirus vector a promoter.
- a cell comprising the fusion protein of any one of aspects above, the polynucleotide described above, or the vector described above.
- the cell is a bacterial cell, plant cell, insect cell, a human cell, or mammalian cell.
- kits comprising the fusion protein of any one of aspects above, the polynucleotide described above, or the vector described above.
- a method for base editing comprising contacting a polynucleotide sequence with the fusion protein of any one of aspects above, wherein the deaminase of the fusion protein deaminates a nucleobase in the polynucleotide, thereby editing the
- the method further comprises contacting the target polynucleotide sequence with a guide nucleic acid sequence to effect deamination of the target nucleobase.
- a method for editing a target nucleobase in a target polynucleotide sequence comprising: contacting the target polynucleotide sequence with a fusion protein comprising a deaminase flanked by a N- terminal fragment and a C-terminal fragments of a Cas9 polypeptide, wherein the deaminase of the fusion protein deaminates the target nucleobase in the target polynucleotide sequence, and wherein the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment comprises a part of a flexible loop of the Cas9 polypeptide.
- a method for editing a target nucleobase in a target polynucleotide sequence comprising: contacting the target polynucleotide sequence with a fusion protein comprising a deaminase inserted within a flexible loop of a Cas9 polypeptide, wherein the fusion protein comprises the structure NH2-[N-terminal fragment of a Cas9]- [deaminase]-[C-terminal fragment of a Cas9]-COOH, wherein each instance of is an optional linker, wherein the deaminase of the fusion protein deaminates the target nucleobase in the target polynucleotide sequence.
- the method further comprises contacting the target polynucleotide sequence with a guide nucleic acid sequence to effect deamination of the target nucleobase.
- the guide nucleic acid sequence comprises a spacer sequence complementary to a protospacer sequence of the target polynucleotide sequence, thereby forming a R-loop.
- the target nucleobase is deaminated with lower off-target deamination as compared to an end terminus method comprising the deaminase fused to a N terminus or a C terminus of SEQ ID NO: 1.
- the deaminase of the fusion protein deaminates no more than two nucleobases within the range of the R-loop.
- the target nucleobase is 1-20 nucleobases away from a PAM sequence in the target polynucleotide sequence. In some embodiments, the target nucleobase is 2-12 nucleobases upstream of the PAM sequence.
- the flexible loop comprises an amino acid in proximity to the target nucleobase when the deaminase of the fusion protein deaminates the target nucleobase.
- the flexible loop comprises a region selected from the group consisting of amino acid residues at positions 530-537, 569-579, 686-691, 768-793, 943-947, 1002-1040, 1052-1077, 1232-1248, and 1298-1300 as numbered in SEQ ID NO: 1, or a corresponding region thereof.
- the deaminase is inserted between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029- 1030, 1040-1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1040-1041, 1068-1069, or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase is inserted between amino acid positions 1016-1017, 1023-1024, 1029-1030, 1040-1041, 1069- 1070 or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the N-terminal fragment comprises amino acid residues 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, and/or 1248-1297 of the Cas9 polypeptide as numbered in SEQ ID NO: 1, or corresponding residues thereof.
- the C-terminal fragment comprises amino acid residues 1301-1368, 1248- 1297, 1078-1231, 1026-1051, 948-1001, 692-942, 580-685, and/or 538-568 of the Cas9 polypeptide as numbered SEQ ID NO: 1, or corresponding residues thereof.
- the N terminal fragment or the C terminal fragment of the Cas9 polypeptide binds the target polynucleotide sequence.
- the N-terminal fragment or the C-terminal fragment comprises a RuvC domain.
- the N-terminal fragment or the C-terminal fragment comprises a HNH domain.
- neither of the N-terminal fragment and the C-terminal fragment comprises a HNH domain.
- neither of the N-terminal fragment and the C-terminal fragment comprises a RuvC domain.
- the Cas9 polypeptide comprises a partial or complete deletion in one or more structural domains.
- the deaminase is inserted at the partial or complete deletion position of the Cas9 polypeptide.
- the deletion is within a RuvC domain.
- the deletion is within an HNH domain.
- the deletion bridges a RuvC domain and a C-terminal domain, a L-I domain and a HNH domain, or a RuvC domain and a L-I domain.
- the Cas9 polypeptide comprises a deletion of amino acids 1017-1069 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof.
- the Cas9 polypeptide comprises a deletion of amino acids 792- 872 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof. In some embodiments, the Cas9 polypeptide comprises a deletion of amino acids 792-906 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof.
- the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an adenosine deaminase.
- the Cas9 polypeptide is a modified Cas9 and has specificity for an altered protospacer-adjacent motif (PAM). In some embodiments, the Cas9 polypeptide is a nickase. In some embodiments, the Cas9 polypeptide is nuclease inactive.
- the contacting is performed in a cell.
- the cell is a mammalian cell or a human cell.
- the cell is a pluripotent cell.
- the cell is in vivo or ex vivo.
- the contacting is performed in a population of cells.
- the population of cells are mammalian cells or human cells.
- a method for treating a genetic condition in a subject comprising: administering to the subject a fusion protein comprising a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide or a polynucleotide encoding the fusion protein, and a guide nucleic acid sequence or a polynucleotide encoding the guide nucleic acid sequence, wherein the guide nucleic acid sequence directs the fusion protein to deaminate a target nucleobase in a target
- a method for treating a genetic condition in a subject comprising: administering to the subject a fusion protein comprising a deaminase inserted within a flexible loop of a Cas9 polypeptide, wherein the fusion protein comprises the structure H2-[N-terminal fragment of a Cas9]-[deaminase]-[C-terminal fragment of a Cas9]-COOH, wherein each instance of is an optional linker, wherein the deaminase of the fusion protein deaminates the target nucleobase in the target polynucleotide sequence of the subject, thereby treating the genetic condition.
- the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment comprises a part of a flexible loop of the Cas9 polypeptide.
- the method further comprises administering to the subject a guide nucleic acid sequence to effect deamination of the target nucleobase.
- the target nucleobase comprises a mutation associated with the genetic condition.
- the deamination of the target nucleobase replaces the target nucleobase with a wild type nucleobase.
- the deamination of the target nucleobase replaces the target nucleobase with a non-wild type nucleobase, and wherein the deamination of the target nucleobase ameliorates symptoms of the genetic condition.
- the target polynucleotide sequence comprises a mutation associated with the genetic condition at a nucleobase other than the target nucleobase.
- the deamination of the target nucleobase ameliorates symptoms of the genetic condition.
- the target nucleobase is 1-20 nucleobases away from a PAM sequence in the target polynucleotide sequence.
- the target nucleobase is 2-12 nucleobases upstream of the PAM sequence.
- the flexible loop comprises an amino acid in proximity to the target nucleobase when the deaminase of the fusion protein deaminates the target nucleobase.
- the flexible loop comprises a region selected from the group consisting of amino acid residues at positions 530-537, 569-579, 686-691, 768-793, 943-947, 1002-1040, 1052-1077, 1232-1248, and 1298-1300 as numbered in SEQ ID NO: 1, or a corresponding region thereof.
- the deaminase is inserted between amino acid positions 768- 769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029-1030, 1040-1041, 1052- 1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1040-1041, 1068-1069, or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase is inserted between amino acid positions 1016-1017, 1023-1024, 1029-1030, 1040-1041, 1069-1070 orl247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the N-terminal fragment comprises amino acid residues 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, and/or 1248-1297 of the Cas9 polypeptide as numbered in SEQ ID NO: 1, or corresponding residues thereof.
- the C-terminal fragment comprises amino acid residues 1301-1368, 1248- 1297, 1078-1231, 1026-1051, 948-1001, 692-942, 580-685, and/or 538-568 of the Cas9 polypeptide as numbered SEQ ID NO: 1, or corresponding residues thereof.
- the N terminal fragment or the C terminal fragment of the Cas9 polypeptide binds the target polynucleotide sequence.
- the N-terminal fragment or the C-terminal fragment comprises a RuvC domain.
- the N-terminal fragment or the C-terminal fragment comprises a HNH domain.
- neither of the N-terminal fragment and the C-terminal fragment comprises a HNH domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises a RuvC domain.
- the Cas9 polypeptide comprises a partial or complete deletion in one or more structural domains. In some embodiments, the deaminase is inserted at the partial or complete deletion position of the Cas9 polypeptide. In some embodiments, the deletion is within a RuvC domain. In some embodiments, the deletion is within an HNH domain.
- the deletion bridges a RuvC domain and a C-terminal domain, a L-I domain and a HNH domain, or a RuvC domain and a L-I domain.
- the Cas9 polypeptide comprises a deletion of amino acids 1017-1069 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof.
- the Cas9 polypeptide comprises a deletion of amino acids 792- 872 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof.
- the Cas9 polypeptide comprises a deletion of amino acids 792-906 as numbered in SEQ ID NO: 1 or corresponding amino acids thereof.
- the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the Cas9 polypeptide is a modified Cas9 and has specificity for an altered PAM. In some embodiments, the Cas9 polypeptide is a nickase. In some embodiments, the Cas9 polypeptide is nuclease inactive. In some embodiments, the subject is a mammal. In some embodiments, the subject is a human.
- a protein library for optimized base editing comprising a plurality of fusion proteins, wherein each one of the plurality of fusion proteins comprises a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide, wherein the N-terminal fragment of each one of the fusion proteins differs from the N-terminal fragments of the rest of the plurality of fusion proteins or wherein the C-terminal fragment of each one of the fusion proteins differs from the C-terminal fragments of the rest of the plurality of fusion proteins, wherein the deaminase of each one of the fusion proteins deaminates a target nucleobase in proximity to a Protospacer Adjacent Motif (PAM) sequence in a target polynucleotide sequence, and wherein the N terminal fragment or the C terminal fragment binds the target polynucleotide sequence.
- PAM Protospacer Adjacent Motif
- At least one of the plurality of fusion proteins deaminates the nucleobase.
- the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment of the Cas9 polypeptide of each one of the plurality of fusion proteins comprises a part of a flexible loop of the Cas9 polypeptide.
- at least one of the plurality of fusion proteins deaminates the target nucleobase with lower off-target deamination as compared to an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of SEQ ID NO: 1.
- At least one of the plurality of the fusion proteins deaminates a target nucleobase 2-12 nucleobases upstream of the PAM sequence.
- the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment of a fusion protein of the plurality comprises an amino acid in proximity to the target nucleobase when the fusion protein deaminates the target nucleobase.
- the deaminase of at least one of the fusion proteins is between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029- 1030, 1040-1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the deaminase of at least one of the fusion proteins is between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1040-1041, 1068-1069, or 1247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof. In some embodiments, the deaminase of at least one of the fusion proteins is between amino acid positions 1016-1017, 1023-1024, 1029-1030, 1040-1041, 1069-1070 orl247-1248 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the deaminase is a cytidine deaminase.
- the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (StlCas9), or variants thereof.
- the Cas9 polypeptide is a modified Cas9 and has specificity for an altered protospacer-adjacent motif (PAM).
- the Cas9 polypeptide is a nickase.
- the Cas9 polypeptide is nuclease inactive.
- adenosine deaminase is meant a polypeptide or fragment thereof capable of catalyzing the hydrolytic deamination of adenine or adenosine.
- the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine to inosine or deoxy adenosine to deoxyinosine.
- the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA).
- the adenosine deaminases e.g.
- engineered adenosine deaminases, evolved adenosine deaminases) provided herein may be from any organism, such as a bacterium.
- the deaminase or deaminase domain is a variant of a naturally-occurring deaminase from an organism.
- the deaminase or deaminase domain does not occur in nature. For example, in some
- the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase.
- the adenosine deaminase is from a bacterium, such as, E. coli, S. aureus, S. typhi, S. putrefaciens, H. influenzae, or C.
- the adenosine deaminase is a TadA deaminase.
- the TadA deaminase is an E. coli TadA (ecTadA) deaminase or a fragment thereof.
- the truncated ecTadA may be missing one or more N-terminal amino acids relative to a full-length ecTadA.
- the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length ecTadA.
- the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length ecTadA.
- the ecTadA deaminase does not comprise an N-terminal methionine.
- the TadA deaminase is an N-terminal truncated TadA.
- the TadA is any one of the TadA described in PCT/US2017/045381, which is incorporated herein by reference in its entirety.
- the adenosine deaminase comprises the amino acid sequence: MSEVEFSHEYWMRHALTLAKRAWDEREVPYGAVLVHNNRVIGEGWNRPIGRHDPT AHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKT GAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD, which is termed“the TadA reference sequence”.
- the TadA deaminase is a full-length A. coli TadA deaminase.
- the adenosine deaminase comprises the amino acid sequence:
- adenosine deaminase may be a homolog of adenosine deaminase acting on tRNA (AD AT).
- AD AT homologs include, without limitation:
- Bacillus subtilis TadA Bacillus subtilis TadA:
- Caulobacter crescentus (C. crescentus ) TadA Caulobacter crescentus (C. crescentus ) TadA:
- Exemplary sequences containing TadA7.10 or TadA7.10 variants include
- agent is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
- alteration is meant a change in the structure, expression levels or activity of a gene or polypeptide as detected by standard art known methods such as those described herein.
- an alteration e.g., increase or decrease
- an alteration includes a 10% change in expression levels, a 25% change, a 40% change, and a 50% or greater change in expression levels.
- analog is meant a molecule that is not identical, but has analogous functional or structural features.
- a polynucleotide analog retains the biological activity of a corresponding naturally-occurring polynucleotide while having certain modifications that enhance the analog’s function relative to a naturally occurring polynucleotide. Such modifications could increase the polynucleotide’s affinity for DNA, half-life, and/or nuclease resistance.
- An analog may include an unnatural nucleotide or amino acid.
- base editor or “nucleobase editor (NBE)” is meant an agent that binds a polynucleotide and has nucleobase modifying activity.
- the agent is a fusion protein comprising a domain having base editing activity, i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
- the domain having base editing activity is capable of deaminating a base within a nucleic acid molecule.
- the base editor is capable of deaminating a base within a DNA molecule.
- the base editor is capable of deaminating a cytosine (C) or an adenosine within DNA.
- the base editor is a cytidine base editor (CBE).
- the base editor is an adenosine base editor (ABE).
- the base editor is an adenosine base editor (ABE) and a cytidine base editor (CBE)
- the base editor is a nuclease-inactive Cas9 (dCas9) fused to an adenosine deaminase.
- the Cas9 is a circular permutant Cas9 (e.g., spCas9 or saCas9). Circular permutant Cas9s are known in the art and described, for example, in Oakes et al., Cell 176, 254-267, 2019.
- the base editor is fused to an inhibitor of base excision repair, for example, a UGI domain.
- the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI domain.
- the base editor is an abasic base editor.
- an adenosine deaminase is evolved from TadA.
- the polynucleotide programmable DNA binding domain is a CRISPR associated (e.g., Cas or Cpfl) enzyme.
- the base editor is a catalytically dead Cas9 (dCas9) fused to a deaminase domain.
- the base editor is a Cas9 nickase (nCas9) fused to a deaminase domain.
- the deaminase domain is a N-terminal or C-terminal fragment of the polynucletide programmable DNA binding domain.
- the deaminase is flanked by an N-terminal and C-terminal fragment of a polynucleotide programmable DNA binding domain. In some embodiments, the deaminase domain is inserted into a site of the polynucleotide programmable DNA binding domain.
- the base editor is fused to an inhibitor of base excision repair (BER). In some embodiments, the inhibitor of base excision repair is a uracil DNA glycosylase inhibitor (UGI). In some embodiments, the inhibitor of base excision repair is an inosine base excision repair inhibitor. Details of base editors are described in International PCT Application Nos. PCT/2017/045381
- the deaminase domain is inserted into regions of the polynucleotide programmable DNA binding domain.
- the insertion site is determined by structural analysis of an napDNAbp.
- the insertion site is a flexible loop.
- the deaminase domain is inserted into a site in the polynucleotide programmable DNA binding domain, wherein the site is selected from at least one from a group of amino acid positions consisting of 1029, 1026, 1054, 1022, 1015, 1068, 1247, 1040, 1248, and 768.
- the deaminase domain is inserted in place of a domain of polynucleotide programmable DNA binding domain.
- the domain is selected from the group consisting of RuvC, Reel, Rec2, and HNH.
- the deaminase domain in inserted in place of a range of amino acid residues in the polynucleotide programmable DNA binding domain, wherein in the range of amino acid residues are selected from a group consisting of resdidues 530-537, 569- 579, 686-691, 768-793, 943-947, 1002-1040, 1052-1077, 1232-1248, and 1298-1300 of Cas9 as numbered in SEQ ID NO: 1 or corresponding positions thereof. It would be apparent to the skilled artisan how to identify homologous regions in a different polynucleotide
- the base editor comprises more than one deaminase domain inserted into more than one site of a polynucleotide programmable DNA binding domain, wherein the sites are described above.
- base editors are generated by cloning an adenosine deaminase variant (e.g ., TadA*7.10) into a scaffold that includes a circular permutant Cas9 (e.g., spCAS9) and a bipartite nuclear localization sequence.
- Circular permutant Cas9s are known in the art and described, for example, in Oakes et al. , Cell 176, 254-267, 2019.
- Exemplary circular permutant sequences are set forth below, in which the bold sequence indicates sequence derived from Cas9, the italics sequence denotes a linker sequence, and the underlined sequence denotes a bipartite nuclear localization sequence.
- the nucleobase components and the polynucleotide programmable nucleotide binding component of a base editor system may be associated with each other covalently or non- covalently.
- the deaminase domain can be targeted to a target nucleotide sequence by a polynucleotide programmable nucleotide binding domain.
- a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain.
- a polynucleotide programmable nucleotide binding domain can target a deaminase domain to a target nucleotide sequence by non-covalently interacting with or associating with the deaminase domain.
- the nucleobase editing component e.g., the deaminase component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
- the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
- the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a steril alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
- KH K Homology
- a base editor system may further comprise a guide polynucleotide component. It should be appreciated that components of the base editor system may be associated with each other via covalent bonds, noncovalent interactions, or any combination of associations and interactions thereof.
- a deaminase domain can be targeted to a target nucleotide sequence by a guide polynucleotide.
- the nucleobase editing component of the base editor system e.g., the deaminase component
- the nucleobase editing component of the base editor system can comprise an additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) that is capable of interacting with, associating with, or capable of forming a complex with a portion or segment (e.g., a polynucleotide motif) of a guide polynucleotide.
- the additional heterologous portion or domain e.g., polynucleotide binding domain such as an RNA or DNA binding protein
- the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
- the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
- a base editor system can further comprise an inhibitor of base excision repair (BER) component. It should be appreciated that components of the base editor system may be associated with each other via covalent bonds, noncovalent interactions, or any combination of associations and interactions thereof.
- the inhibitor of BER component may comprise a base excision repair inhibitor.
- the inhibitor of base excision repair can be a uracil DNA glycosylase inhibitor (UGI). In some embodiments, the inhibitor of base excision repair can be an inosine base excision repair inhibitor. In some embodiments, the inhibitor of base excision repair can be targeted to the target nucleotide sequence by the polynucleotide programmable nucleotide binding domain. In some embodiments, a polynucleotide programmable nucleotide binding domain can be fused or linked to an inhibitor of base excision repair. In some embodiments, a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain and an inhibitor of base excision repair.
- UMI uracil DNA glycosylase inhibitor
- the inhibitor of base excision repair can be targeted to the target nucleotide sequence by the polynucleotide programmable nucleotide binding domain.
- a polynucleotide programmable nucleotide binding domain can target an inhibitor of base excision repair to a target nucleotide sequence by non-covalently interacting with or associating with the inhibitor of base excision repair.
- the inhibitor of base excision repair component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
- the inhibitor of base excision repair can be targeted to the target nucleotide sequence by the guide polynucleotide.
- the inhibitor of base excision repair can comprise an additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) that is capable of interacting with, associating with, or capable of forming a complex with a portion or segment (e.g., a polynucleotide motif) of a guide polynucleotide.
- the additional heterologous portion or domain of the guide polynucleotide e.g., polynucleotide binding domain such as an RNA or DNA binding protein
- the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a
- the additional heterologous portion may be a protein domain.
- the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
- KH K Homology
- base editing activity is meant acting to chemically alter a base within a polynucleotide.
- a first base is converted to a second base.
- the base editing activity is cytidine deaminase activity, e.g., converting target C * G to T * A.
- the base editing activity is adenosine deaminase activity, e.g., converting A ⁇ T to G * C.
- Cas9 or“Cas9 domain” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
- a Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease.
- CRISPR is an adaptive immune system that provides protection against mobile genetic elements (vimses, transposable elements and conjugative plasmids).
- CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (me) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
- tracrRNA trans-encoded small RNA
- me endogenous ribonuclease 3
- Cas9 protein The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA.
- RNA single guide RNAs
- sgRNA single guide RNAs
- Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
- Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g.,“Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti et al, J.J., McShan W.M., Ajdic D.J., Savic D.J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A.N., Kenton S., Lai H.S., Lin S.P., Qian Y., Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White T, Yuan X., Clifton S.W., Roe B.A., McLaughlin R.E., Proc.
- Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus . Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier,“The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
- a nuclease-inactivated Cas9 protein may interchangeably be referred to as a“dCas9” protein (for nuclease-“dead” Cas9) or catalytically inactive Cas9.
- Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al, Science. 337:816-821(2012); Qi et al,“Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell.
- the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvCl subdomain.
- the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvCl subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9.
- the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science. 337:816-821(2012); Qi et al.,
- a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for“nickase” Cas9).
- proteins comprising fragments of Cas9 are provided.
- a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9.
- proteins comprising Cas9 or fragments thereof are referred to as“Cas9 variants.”
- a Cas9 variant shares homology to Cas9, or a fragment thereof.
- a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas9.
- Cas9 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46,
- the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas9.
- a fragment of Cas9 e.g., a gRNA binding domain or a DNA-cleavage domain
- the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas9.
- the fragment is at least 100 amino acids in length. In some embodiments, the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
- wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, nucleotide and amino acid sequences as follows).
- wild type Cas9 corresponds to, or comprises the following nucleotide and/or amino acid sequences:
- wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCB I Reference Sequence: NC_002737.2 (nucleotide sequence as follows); and Uniprot Reference Sequence: Q99ZW2 (amino acid sequence as follows).
- Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC 015683.1, NC 017317.1); Corynebacterium diphtheria (NCBI Refs:
- NCBI Ref NC_017861.1
- Spiroplasma taiwanense NCBI Ref:
- NC 021846.1 Streptococcus iniae
- NCBI Ref: NC 021314.1 Belliella baltica
- NCBI Ref: NC_018010.1 Psychroflexus torquisl
- NCBI Ref: NC_018721.1 Streptococcus thermophilus
- NCBI Ref: YP_820832.1 Listeria innocua
- NCBI Ref: NP_472073.1 Campylobacter jejuni
- NCBI Ref: YP_002344900.1 Neisseria meningitidis
- NCBI Ref: YP_002342100.1 Neisseria meningitidis
- dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
- a dCas9 domain comprises D10A and an H840A mutation or corresponding mutations in another Cas9.
- the dCas9 comprises the amino acid sequence of dCas9 (D10A and H840A):
- the Cas9 domain comprises a D10A mutation, while the residue at position 840 remains a histidine in the amino acid sequence provided above, or at corresponding positions in any of the amino acid sequences provided herein.
- dCas9 variants having mutations other than D10A and H840A are provided, which, e.g., result in nuclease inactivated Cas9 (dCas9).
- Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvCl subdomain).
- variants or homologues of dCas9 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical.
- variants of dCas9 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
- Cas9 fusion proteins as provided herein comprise the full- length amino acid sequence of a Cas9 protein, e.g., one of the Cas9 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only one or more fragments thereof. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art.
- Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs:
- NCBI Ref NC_017861.1
- Spiroplasma taiwanense NCBI Ref: NC_021846.1
- Streptococcus iniae NCBI Ref: NC_021314.1
- Belliella baltica NCBI Ref: NC_018010.1
- Psychroflexus torquisl NCBI Ref: NC_018721.1
- Streptococcus thermophilus NCBI Ref: YP_820832.1
- Listeria innocua NCBI Ref: NP_472073.1
- NCBI Ref Campylobacter jejuni
- NCBI Ref Neisseria meningitidis
- Cas9 proteins e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure.
- Exemplary Cas9 proteins include, without limitation, those provided below.
- the Cas9 protein is a nuclease dead Cas9 (dCas9).
- the Cas9 protein is a Cas9 nickase (nCas9).
- the Cas9 protein is a nuclease active Cas9.
- nCas9 nickase nCas9
- Cas9 refers to a Cas9 from archaea (e.g. nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
- archaea e.g. nanoarchaea
- Cas9 refers to a Cas9 from archaea (e.g. nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
- Cas9 refers to CasX or CasY, which have been described in, for example, Burstein et ah, "New CRISPR-Cas systems from uncultivated microbes.” Cell Res. 2017 Feb 21. doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference.
- genome-resolved metagenomics a number of CRISPR-Cas systems were identified, including the first reported Cas9 in the archaeal domain of life. This divergent Cas9 protein was found in little- studied nanoarchaea as part of an active CRISPR-Cas system.
- Cas9 refers to CasX, or a variant of CasX. In some embodiments, Cas9 refers to a CasY, or a variant of CasY. It should be appreciated that other RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp), and are within the scope of this disclosure. In some embodiments, the nucleic acid programmable DNA binding protein
- napDNAbp of any of the fusion proteins provided herein may be a CasX or CasY protein.
- the napDNAbp is a CasX protein. In some embodiments, the napDNAbp is a CasY protein. In some embodiments, the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring CasX or CasY protein. In some embodiments, the napDNAbp is a naturally-occurring CasX or CasY protein.
- the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any CasX or CasY protein described herein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
- cytidine deaminase is meant a polypeptide or fragment thereof capable of catalyzing a deamination reaction that converts an amino group to a carbonyl group.
- the cytidine deaminase converts cytosine to uracil or 5-methylcytosine to thymine.
- PmCDAl which is derived from Petromyzon marinus (Petromyzon marinus cytosine deaminase 1,“PmCDAl”), AID (Activation-induced cytidine deaminase; AICDA), which is derived from a mammal (e g., human, swine, bovine, horse, monkey etc.), and APOBEC are exemplary cytidine deaminases.
- Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like (APOBEC) is a family of evolutionarily conserved cytidine deaminases. Members of this family are C-to-U editing enzymes.
- the N-terminal domain of APOBEC like proteins is the catalytic domain, while the C-terminal domain is a pseudocatalytic domain. More specifically, the catalytic domain is a zinc dependent cytidine deaminase domain and is important for cytidine deamination.
- APOBEC family members include APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D ("APOBEC3E” now refers to this), APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, and Activation-induced (cytidine) deaminase.
- modified cytidine deaminases are commercially available, including but not limited to SaBE3, SaKKH-BE3, VQR-BE3, EQR-BE3, VRER-BE3, YE1-BE3, EE-BE3, YE2-BE3, and YEE-BE3, which are available from Addgene (plasmids 85169, 85170,
- the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localization sequence, without nuclear export signal, cytoplasmic localizing signal).
- Human AID Human AID:
- Bovine AID
- Bovine APOBEC-3B Bovine APOBEC-3B
- Bovine APOBEC-3 A Bovine APOBEC-3 A:
- SIRNSR Human APOBEC-3D
- Human APOBEC-1 Human APOBEC-1 :
- Rat APOBEC-1 (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 + (0.05 * (1 +
- Bovine APOBEC-2 Bovine APOBEC-2
- deaminase or “deaminase domain” refers to a protein or fragment thereof that catalyzes a deamination reaction.
- Detect refers to identifying the presence, absence or amount of the analyte to be detected. In one embodiment, a sequence alteration in a polynucleotide or polypeptide is detected. In another embodiment, the presence of indels is detected.
- detectable label is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
- useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an ELISA), biotin, digoxigenin, or haptens.
- fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
- a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
- Hybridization means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases.
- adenine and thymine are complementary nucleobases that pair through the formation of hydrogen bonds.
- IBR inhibitor of base repair
- nucleic acid repair enzyme for example a base excision repair enzyme.
- the IBR is an inhibitor of inosine base excision repair.
- Exemplary inhibitors of base repair include inhibitors of APE1, Endo III, Endo IV, Endo V, Endo VIII, Fpg, hOGGl, h EILl, T7 Endol, T4PDG, UDG, hSMUGl, and hAAG.
- the IBR is an inhibitor of Endo V or hAAG.
- the IBR is a catalytically inactive EndoV or a catalytically inactive hAAG.
- isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
- Isolate denotes a degree of separation from original source or surroundings.
- Purify denotes a degree of separation that is higher than isolation.
- a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
- the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
- modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
- isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
- the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
- the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
- an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
- the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
- An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
- linker refers to a bond (e.g., covalent bond), chemical group, or a molecule linking two molecules or moieties, e g., two domains of a fusion protein.
- a linker joins a gRNA binding domain of an RNA-programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic-acid editing protein (e.g., cytidine or adenosine deaminase).
- a linker joins a dCas9 and a nucleic-acid editing protein.
- the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two.
- the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein).
- the linker is an organic molecule, group, polymer, or chemical moiety.
- the linker is 5- 200 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 35, 45, 50, 55, 60, 60, 65, 70, 70, 75, 80, 85, 90, 90, 95, 100, 101, 102, 103, 104, 105,
- a linker comprises the amino acid sequence SGSETPGTSESATPES, which may also be referred to as the XTEN linker.
- a linker comprises the amino acid sequence SGGS.
- a linker comprises (SGGS) n , (GGGS) n , (GGGGS) n , (G)n , (EAAAK) n , (GGS) n , SGSETPGTSESATPES, or (XP) n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30, and wherein X is any amino acid. In some embodiments, n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
- the domains of the nucleobase editor are fused via a linker that comprises the amino acid sequence of SGGSSGSETPGTSESATPESSGGS,
- domains of the nucleobase editor are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES, which may also be referred to as the XTEN linker.
- the linker is 24 amino acids in length.
- the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPES.
- the linker is 40 amino acids in length.
- the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSSGGSSGGS.
- the linker is 64 amino acids in length.
- the linker comprises the amino acid sequence
- the linker is 92 amino acids in length. In some embodiments, the linker comprises the amino acid sequence
- mutation refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4 th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
- nucleic acid and“nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e g., a nucleoside, a nucleotide, or a polymer of nucleotides.
- polymeric nucleic acids e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage.
- “nucleic acid” refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides).
- “nucleic acid” refers to an oligonucleotide chain comprising three or more individual nucleotide residues.
- polynucleotide can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides).
- “nucleic acid” encompasses RNA as well as single and/or double- stranded DNA. Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule.
- a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides.
- the terms“nucleic acid,” “DNA,”“RNA,” and/or similar terms include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc.
- nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications.
- a nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated.
- a nucleic acid is or comprises natural nucleosides ( e.g .
- nucleoside analogs e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, and 2-thiocyt
- nuclear localization sequence refers to an amino acid sequence that promotes import of a protein into the cell nucleus.
- Nuclear localization sequences are known in the art and described, for example, in Plank et al. , International PCT application, PCT/EP2000/011690, filed November 23, 2000, published as WO/2001/038547 on May 31, 2001, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.
- the NLS is an optimized NLS described, for example, by Koblan et al., Nature Biotech. 2018 doi: 10.1038/nbt.4172.
- an NLS comprises the amino acid sequence KRTADGSEFESPKKKRKV, KRPAATKKAGQAKKKK,
- KKTELQTTNAENKTKKL KRGINDRNF WRGEN GRKTR, RKSGKIAAIVVKRPRK, PKKKRKV, or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC.
- nucleic acid programable nucleic-acid e.g., DNA or RNA binding proteins.
- the nucleic acid programable nucleic-acid binding protein can be, for example, "nucleic acid programmable DNA binding protein" or "napDNAbp".
- nucleic acid programmable DNA binding protein or "napDNAbp” refers to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide nucleic acid, that guides the napDNAbp to a specific nucleic acid sequence.
- a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that is complementary to the guide RNA.
- the napDNAbp is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
- nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), CasX, CasY, Cpfl, Casl2b/C2cl, and Casl2c/C2c3.
- Other nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure.
- “obtaining” as in“obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
- RNA-programmable nuclease and "RNA-guided nuclease” are used with (e.g., binds or associates with) one or more RNA(s) that is not a target for cleavage.
- an RNA-programmable nuclease when in a complex with an RNA, may be referred to as a nuclease:RNA complex.
- the bound RNA(s) is referred to as a guide RNA (gRNA).
- gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
- gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though "gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules.
- gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein.
- domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure.
- domain (2) is identical or homologous to a tracrRNA as provided in Jinek et ah, Science 337:816-821(2012), the entire contents of which is incorporated herein by reference.
- gRNAs e.g., those including domain 2
- a gRNA comprises two or more of domains (1) and (2), and may be referred to as an "extended gRNA.”
- an extended gRNA will, e.g., bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein.
- the gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex.
- the RNA- programmable nuclease is the (CRIS PR-associated system) Cas9 endonuclease, for example, Cas9 (Csnl) from Streptococcus pyogenes (see, e.g., "Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti J.J., McShan W.M., Ajdic D.J., Savic D.J., Savic G , Lyon K., Primeaux C, Sezate S., Suvorov A N., Kenton S., Lai H.S., Lin S.P., Qian Y , Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White L, Yuan X., Clifton S.W., Roe B.A., McLaughlin R.E., Proc.
- Cas9 endonuclease for example, Cas9
- recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
- a "reference sequence” is a defined sequence used as a basis for sequence comparison.
- a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
- the length of the reference polypeptide sequence will generally be at least about 16 amino acids, at least about 20 amino acids, more at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids.
- the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, at least about 60 nucleotides, at least about 75 nucleotides, and about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
- nucleic acid molecule e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
- compound e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
- molecule that recognizes and binds a polypeptide and/or nucleic acid molecule of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
- Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
- hybridize pair to form a double- stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- complementary polynucleotide sequences e.g., a gene described herein
- stringency See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
- stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
- Various levels of stringency are accomplished by combining these various conditions as needed.
- hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 .mu.g/ml denatured salmon sperm DNA (ssDNA).
- hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 pg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
- wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art.
- Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). In one embodiment, such a sequence is at least 60%, 80% or 85%, 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705,
- BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine;
- a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
- subject is meant a mammal, including, but not limited to, a human or non human mammal, such as a bovine, equine, canine, ovine, or feline.
- Subjects include livestock, domesticated animals raised to produce labor and to provide commodities, such as food, including without limitation, cattle, goats, chickens, horses, pigs, rabbits, and sheep.
- target site refers to a sequence within a nucleic acid molecule that is modified by a nucleobase editor.
- the target site is deaminated by a deaminase or a fusion protein comprising a deaminase (e.g., cytidine or adenine deaminase).
- RNA-programmable nucleases e.g., Cas9
- Cas9 RNA:DNA hybridization to target DNA cleavage sites
- these proteins are able to be targeted, in principle, to any sequence specified by the guide RNA.
- Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et ah, Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et ah, RNA-guided human genome engineering via Cas9. Science 339, 823- 826 (2013); Hwang, W.Y.
- et ah Efficient genome editing in zebrafish using a CRISPR-Cas system. Nature biotechnology 31, 227-229 (2013); Jinek, M. et ah, RNA-programmed genome editing in human cells. eLife 2, e00471 (2013); Dicarlo, J.E. et ah, Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic acids research (2013); Jiang, W. et ah RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference).
- Ranges provided herein are understood to be shorthand for all of the values within the range.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
- the term“about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
- the recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups.
- the recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
- compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
- FIG. 1 depicts a model of an adenosine nucleobase editor and provides in part a structural basis for bystander mutagenesis.
- FIG. 2 is a model depicting prediction of the location of target DNA for base editing.
- FIG. 3 depicts a model showing positions of a deaminase domain in proximity to the locations of target DNA in FIG. 2.
- FIG. 4 is a model of an adenosine nucleobase editor depicting regions identified where one or more deaminase domains may be inserted into Cas9. Loops (yellow) that are in proximity to where a deaminase domain may target single stranded DNA (magenta). Regions of interest include those marked A, B, C, D, E, F, G, and H.
- FIG. 5 is a magnified view of the model in FIG. 4, showing residues in regions B, C, D, E, and F.
- FIG. 6 is a magnified view of the model in FIG. 4, showing residues in regions F, G, and H.
- FIG. 7 is a magnified view of the model in FIG. 4, showing residues in regions A, B, C, D, and E.
- FIG. 8 depicts a high-throughput in vitro deamination assay.
- Spurious deamination of the probe can be distinguished from on-target deamination by comparing reactions containing nucleobase editor with an on-target probe containing a substrate for the base editor and a reaction in the absence of the base editor containing a probe for detecting off-target deamination.
- FIG. 9 is a graph depicting results of a fluorescence assay for off-target deamination.
- FIG. 10 is a graph depicting a comparison of adenosine base editor (ABE) v. an ABE system with TadA in trans.
- ABE adenosine base editor
- FIG. 11 depicts potential substrates for spurious off-target base editing.
- FIG. 12 depicts an assay to evaluate the activities of deaminases in cis and in trans.
- FIG. 13 is a graph depicting the activities of rAPOBECl in the in cis-in trans assay.
- FIG. 14 is a graph depicting the activities of TadA-TadA7.10 in the in cis-in irons assay.
- FIG. 15 depicts that lower in trans activity was observed for TadA-TadA7.10 in base editor context (in trans ABE).
- FIG. 16 is a graph depicting the results of dose-response for expression of GFP. Titration of pmaxGFP plasmid with empty vector resulted in decreased expression level of GFP.
- FIG. 17 is a graph depicting dose-response for in-cis and in-trans activities of adenosine nucleobase editor ABE.
- FIG. 18 is a graph depicting dose-response for in-cis and in-trans activities of cytidine nucleobase editor BE4.
- FIG. 19 is a graph showing the results of screening of deaminases for reduced spurious deamination.
- the deaminases ppAPOBEC-2 (10), mAPOBEC-2 (8), mAPOBEC- 3(12), and mfAPOBEC-4 (22) showed high in cis/in trans activity.
- FIGs. 20A-Q depict base editing activity of the editors exmined.
- FIG. 20A is a schematic of ABE7.10, with TadA fused to Cas9 by an XTEN linker.
- FIG. 20B-Q show base editing activity of exemplary internal fusion base editors in percentage A to G deamination on the targeting strand within the range of the R-loop with target sequences
- FIG. 20B editing activity of ABE7.10.
- FIG. 20C editing activity of ISLAY008.
- FIG. 20D editing activity of ISLAY003.
- FIG. 20E editing activity of ISLAY002.
- FIG. 20F editing activity of ISLAY007.
- FIG. 20G editing activity of ISLAY001.
- FIG. 20H editing activity of ISLAY005.
- FIG. 201 editing activity of ISLAY006.
- FIG. 20J editing activity of ISLAY004.
- FIG. 20K editing activity of ISLAY021.
- FIG. 20L editing activity of ISLAY031.
- FIG. 20M editing activity of ISLAY020.
- FIG. 20N editing activity of ISLAY036.FIG. 200, editing activity of ISLAY035.
- FIG. 20P editing activity of ISLAY028.
- FIG. 20Q editing activity of ISLAY009.
- FIGs. 21A-B show schematics of exemplary base editors.
- FIG. 21A shows a schematic of exemplary base editor ABE7.10 and exemplary base editors (IBE002, IBE004, P3E005, P3E006, P3E008, P3E009, and IBE020).
- FIG. 21B shows a spatial cartoon representation of the above base editors, showing the location of deaminase insertion.
- FIGs. 22A - D depict base editing efficiency of exemplary internal fusion base editors compared to ABE7.10 at 29 different genomic targets.
- FIG. 22A shows editing efficiency is normalized to ABE7.10 editing at the best position.
- FIG. 22B shows max editing efficiency of IBEs summarized and compared to ABE7.10.
- FIG. 22C shows a Gaussian smoothened representation of the peak editing position for each base editor.
- FIG. 22D shows a heatmap of normalized editing from the 29 tested targets.
- FIG. 23 depicts spurious deamination measured by trans editing assay as 29 different targets normalized to ABE7.10 at each site.
- FIGs. 24A-F show the percent editing of A-base editors at 6 genomic loci: HEK4 (FIG. 24 A), FANCF (FIG. 24B), HEK-3 (FIG. 24C), HEK2-YY (FIG. 24D), EMX1 (FIG. 24E), HEK2 (FIG. 24F).
- X-axis nucleobase positions with 1 being furthest from the PAM and 20 being PAM proximal (PAM being positions 21-23).
- Y axis percentage of A to G editing measured by Illumina sequencing.
- FIGs. 25A-F Percent editing of C-base editors at 6 genomic loci: HEK4 (FIG. 25 A), FANCF (FIG. 25B), HEK-3 (FIG. 25C), HEK2-YY (FIG. 25D), EMX1 (FIG. 25E), HEK2 (FIG. 25F).
- X-axis nucleobase positions with 1 being furthest from the PAM and 20 being PAM proximal (PAM being positions 21-23).
- Y axis percentage of A to G editing measured by Illumina sequencing.
- the present invention features base editors having reduced non target deamination, methods of using the base editors, and assays for characterizing base editors as having decreased non-target deamination, e g. compared to programmed, on-target deamination.
- the nucleobase editors of the invention comprise an adenosine deaminase domain.
- the adenosine deaminases provided herein are capable of deaminating adenine.
- the adenosine deaminases provided herein are capable of deaminating adenine in a deoxyadenosine residue of DNA.
- the adenosine deaminase may be derived from any suitable organism (e.g., E. coli).
- the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
- mutations in ecTadA e.g., mutations in ecTadA.
- One of skill in the art will be able to identify the corresponding residue in any homologous protein, e.g., by sequence alignment and determination of homologous residues.
- adenosine deaminase e.g., having homology to ecTadA
- the adenosine deaminase is from a prokaryote.
- the adenosine deaminase is from a bacterium In some embodiments, the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli.
- a fusion protein of the invention comprises a wild-type TadA is linked to TadA7.10, which is linked to Cas9 nickase.
- the fusion proteins comprise a single TadA7.10 domain (e.g., provided as a monomer).
- the ABE7.10 editor comprises TadA7.10 and TadA(wt), which are capable of forming heterodimers.
- the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein. It should be appreciated that adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
- the disclosure provides any deaminase domains with a certain percent identiy plus any of the mutations or combinations thereof described herein.
- the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine deaminases provided herein.
- the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
- the adenosine deaminase comprises a D108X mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a D108G, D108N, D108V, D108A, or D108Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase. It should be appreciated, however, that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
- the adenosine deaminase comprises an A106X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an A106V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises a E155X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a E155D, E155G, or E155V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises a D147X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a D147Y, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- any of the mutations provided herein may be introduced into other adenosine deaminases, such as S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases).
- adenosine deaminases such as S. aureus TadA (saTadA)
- other adenosine deaminases e.g., bacterial adenosine deaminases.
- any of the mutations identified in ecTadA may be made in other adenosine deaminases that have homologous amino acid residues.
- any of the mutations provided herein may be made individually or in any combination in ecTadA or another adenosine deaminase.
- an adenosine deaminase may contain a D108N, a A106V, a E155V, and/or a D147Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- an adenosine deaminase comprises the following group of mutations (groups of mutations are separated by a in TadA reference sequence, or corresponding mutations in another adenosine deaminase: D108N and A106V; D108N and E155V; D108N and D147Y; A106V and E155V; A106V and D147Y; E155V and D147Y; D108N, A 106V, and E55V; D108N, A106V, and D147Y; D108N, E55V, and D147Y;
- adenosine deaminase e.g., ecTadA
- the adenosine deaminase comprises one or more of a H8X, T17X, L18X, W23X, L34X, W45X, R51X, A56X, E59X, E85X, M94X, I95X, V102X, F104X, A106X, R107X, D108X, K1 10X, M118X, N127X, A138X, F149X, M151X, R153X, Q154X, I156X, and/or K157X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one or more of H8Y, T17S, L18E, W23L, L34S, W45L, R51H, A56E, or A56S, E59G, E85K, or E85G, M94L, 1951, VI 02 A, F104L, A106V, R107C, or R107H, or R107P, D108G, or D108N, or D108V, or D108A, or D108Y, K1 101, Ml 18K, N127S, A138V, F149Y, M151V, R153C, Q154L, I156D, and/or K157R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of H8X, D108X, and/or N127X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid.
- the adenosine deaminase comprises one or more of a H8Y, D108N, and/or N127 S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one or more of H8Y, R26W, M61I, L68Q, M70V, A106T, D108N, A109T, N127S, D147Y, R152C, Q154H or Q154R, E155G or E155V or E155D, K161Q, Q163H, and/or T166P mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, D108X, N127X, D147X,
- R152X, and Q154X in TadA reference sequence or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, M61X, M70X, D108X, N127X, Q154X, E155X, and Q163X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, N127X, E155X, and T166X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, A106X, D108X, mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, R126X, L68X, D108X,
- N127X, D147X, and E155X in TadA reference sequence or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, A109X, N127X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, D108N, N127S, D147Y, R152C, and Q154H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, M61I, M70V, D108N, N127S, Q154R, E155G and Q163H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, N127S, E155V, and T166P in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, A106T, D108N, N127S, E155D, and K161Q in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, R126W,
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, A109T, N127S, and E155G in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of the or one or more corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a D108N, D108G, or D108V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some
- the adenosine deaminase comprises a A106V and D108N mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises R107C and D108N mutations in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and Q154H mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises a H8Y, R24W, D108N, N127S, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some
- the adenosine deaminase comprises a H8Y, D108N, and S 127S mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises a A106V, D108N, D147Y and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of a, S2X, H8X, I49X, L84X, H123X, N127X, I156X and/or K160X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one or more of S2A, H8Y, I49F, L84F, H123Y, N127S, I156F and/or K160S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises an L84X mutation adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an L84F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an H123X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an H123Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an I157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an I157F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84X, A106X, D108X, H123X, D147X, E155X, and I156X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2X, I49X, A106X, D108X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, A106X, D108X, N127X, and K160X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84F, A106V, D108N, EP23U, D147Y, E155V, and I156F in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2A, I49F, A 106V, D108N, D147Y, and E155V in TadA reference sequence.
- the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of F18Y, A106T, D108N, N127S, and K160S in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one or more of E25M, E25D, E25A, E25R, E25V, E25S, E25Y, R26G, R26N, R26Q, R26C, R26L, R26K, R107P, R07K, R107A, R107N, R107W, R107H, R107S, A142N, A142D, A142G, A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises one or more of the mutations described herein corresponding to TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises an E25X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an E25M, E25D, E25A, E25R, E25V, E25S, or E25Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an R26X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises R26G, R26N, R26Q, R26C, R26L, or R26K mutation in TadA reference sequence, or a
- the adenosine deaminase comprises an R107X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an R107P, R07K, R107A, R107N, R107W, R107H, or R107S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an A142N, A142D, A142G, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an A143X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises one or more of a H36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S 146X, Q154X, K157X, and/or K161X mutation in TADA REFERENCE SEQUENCE, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises one or more of H36L, N37T, N37S, P48T, P48L, I49V, R51H, R51L, M70L, N72S, D77G, E134G, S 146R, S 146C, Q154H, K157N, and/or K161T mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
- the adenosine deaminase comprises an H36X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an H36L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an N37X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an N37T, or N37S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an P48T, or P48L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an R51X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an R51H, or R51L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an S146X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises an S 146R, or S 146C mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an K157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a K157N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a P48S, P48T, or P48A mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a A142N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an W23X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a W23R, or W23L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase comprises an R152X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
- the adenosine deaminase comprises a R152P, or R52H mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
- the adenosine deaminase may comprise the mutations H36L, R51L, L84F, A106Y, D108N, H123Y, S 146C, D147Y, E155Y, I156F, and K157N.
- the adenosine deaminase comprises the following combination of mutations relative to TadA reference sequence, where each mutation of a combination is separated by a and each combination of mutations is between parentheses: (A106V_D108N),
- a fusion protein of the invention comprises a cytidine deaminase.
- the cytidine deaminases provided herein are capable of deaminating cytosine or 5-methylcytosine to uracil or thymine.
- the cytosine deaminases provided herein are capable of deaminating cytosine in DNA.
- the cytidine deaminase may be derived from any suitable organism.
- the cytidine deaminase is a naturally-occurring cytidine deaminase that includes one or more mutations corresponding to any of the mutations provided herein.
- the cytidine deaminase is from a prokaryote. In some embodiments, the cytidine deaminase is from a bacterium. In some embodiments, the cytidine deaminase is from a mammal (e.g., human).
- the cytidine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the cytidine deaminase amino acid sequences set forth herein.
- cytidine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein). The disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
- the cytidine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
- the cytidine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
- a fusion protein of the invention comprises a nucleic acid editing domain.
- the nucleic acid editing domain can catalyze a C to U base change.
- the nucleic acid editing domain is a deaminase domain.
- the deaminase is a cytidine deaminase or an adenosine deaminase.
- the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase.
- APOBEC apolipoprotein B mRNA-editing complex
- the deaminase is an APOBECl deaminase.
- the deaminase is an APOBEC2 deaminase.
- the deaminase is an APOBEC1
- the deaminase is an APOBEC3 A deaminase. In some embodiments, the deaminase is an APOBEC3B deaminase. In some embodiments, the deaminase is an APOBEC3C deaminase. In some embodiments, the deaminase is an APOBEC3D deaminase. In some embodiments, the deaminase is an APOBEC3E deaminase. In some embodiments, the deaminase is an APOBEC3F deaminase.
- the deaminase is an APOBEC3G deaminase. In some embodiments, the deaminase is an APOBEC3H deaminase. In some embodiments, the deaminase is an APOBEC4 deaminase.
- the deaminase is an activation-induced deaminase (AID).
- the deaminase is a vertebrate deaminase.
- the deaminase is an invertebrate deaminase.
- the deaminase is a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse deaminase.
- the deaminase is a human deaminase.
- the deaminase is a rat deaminase, e.g., rAPOBECl .
- the deaminase is a Petromyzon marinus cytidine deaminase 1 (pmCDAl). In some embodiments, the deminase is a human APOBEC3G. In some embodiments, the deaminase is a fragment of the human APOBEC3G. In some embodiments, the deaminase is a human APOBEC3G variant comprising a D316R D317R mutation. In some embodiments, the deaminase is a fragment of the human APOBEC3G and comprising mutations corresponding to the D316R D317R mutations.
- the nucleic acid editing domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), or at least 99.5% identical to the deaminase domain of any deaminase described herein.
- the fusion proteins provided herein comprise one or more features that improve the base editing activity of the fusion proteins.
- any of the fusion proteins provided herein may comprise a Cas9 domain that has reduced nuclease activity.
- any of the fusion proteins provided herein may have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
- a nucleic acid programmable DNA binding protein is a Cas9 domain.
- the Cas9 domain may be a nuclease active Cas9 domain, a nuclease inactive Cas9 domain, or a Cas9 nickase.
- the Cas9 domain is a nuclease active domain.
- the Cas9 domain may be a Cas9 domain that cuts both strands of a duplexed nucleic acid (e.g., both strands of a duplexed DNA molecule).
- the Cas9 domain comprises any one of the amino acid sequences as set forth herein. In some embodiments the Cas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
- the Cas9 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more or more mutations compared to any one of the amino acid sequences set forth herein.
- the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
- the Cas9 domain is a nuclease-inactive Cas9 domain (dCas9).
- the dCas9 domain may bind to a duplexed nucleic acid molecule (e.g., via a gRNA molecule) without cleaving either strand of the duplexed nucleic acid molecule.
- the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
- the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
- a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
- LGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD see, e.g.,
- nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
- Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g ., Prashant el al. , CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
- the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the dCas9 domains provided herein.
- the Cas9 domain comprises an amino acid sequences that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more or more mutations compared to any one of the amino acid sequences set forth herein.
- the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
- the Cas9 domain is a Cas9 nickase.
- the Cas9 nickase may be a Cas9 protein that is capable of cleaving only one strand of a duplexed nucleic acid molecule (e.g, a duplexed DNA molecule).
- the Cas9 nickase cleaves the target strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is base paired to (complementary to) a gRNA (e.g., an sgRNA) that is bound to the Cas9.
- a gRNA e.g., an sgRNA
- a Cas9 nickase comprises a D10A mutation and has a histidine at position 840.
- the Cas9 nickase cleaves the non-target, non-base-edited strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is not base paired to a gRNA (e.g, an sgRNA) that is bound to the Cas9.
- a Cas9 nickase comprises an H840A mutation and has an aspartic acid residue at position 10, or a corresponding mutation.
- the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 nickases provided herein. Additional suitable Cas9 nickases will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
- Cas9 proteins such as Cas9 from S. pyogenes (spCas9), require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the“N” in“NGG” is adenosine (A), thymidine (T), or cytosine (C), and the G is guanosine.
- the base editing fusion proteins provided herein may need to be placed at a precise location, for example a region comprising a target base that is upstream of the PAM.
- any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence.
- Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan.
- Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P , et al. ,“Engineered CRISPR-Cas9 nucleases with altered PAM
- the Cas9 domain is a Cas9 domain from Staphylococcus aureus (SaCas9).
- the SaCas9 domain is a nuclease active SaCas9, a nuclease inactive SaCas9 (SaCas9d), or a SaCas9 nickase (SaCas9n).
- the SaCas9 comprises a N579A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
- the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM. In some embodiments, the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a NNGRRT PAM sequence. In some embodiments, the
- the SaCas9 domain comprises one or more of a E781X, a N967X, and a R1014X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
- the SaCas9 domain comprises one or more of a E781K, a N967K, and a R1014H mutation, or one or more corresponding mutation in any of the amino acid sequences provided herein.
- the SaCas9 domain comprises a E781K, a N967K, or a R1014H mutation, or corresponding mutations in any of the amino acid sequences provided herein.
- Residue N579 above which is underlined and in bold, may be mutated ( e.g to a A579) to yield a SaCas9 nickase.
- Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
- KYGT PNDTTTET A OK MfNF.MOK R NR QTNF.R TFF.TTR TTGKEN AK YT TF.K TK
- Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
- Residues K781, K967, and H1014 above which can be mutated from E781, N967, and R1014 to yield a SaKKH Cas9 are underlined and in italics.
- the Cas9 domain is a Cas9 domain from Streptococcus pyogenes (SpCas9).
- the SpCas9 domain is a nuclease active SpCas9, a nuclease inactive SpCas9 (SpCas9d), or a SpCas9 nickase (SpCas9n).
- the SpCas9 comprises a D9X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid except for D.
- the SpCas9 comprises a D9A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
- the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
- the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having an NGG, a NGA, or a NGCG PAM sequence.
- the SpCas9 domain comprises one or more of a D1134X, a R1334X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
- the SpCas9 domain comprises one or more of a D1134E, R1334Q, and T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
- the SpCas9 domain comprises a D1134E, a R1334Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein. In some embodiments, the SpCas9 domain comprises one or more of a D1134X, a R1334X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid. In some embodiments, the SpCas9 domain comprises one or more of a D1134V, a R1334Q, and a T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
- the SpCas9 domain comprises a D1134V, a R1334Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
- the SpCas9 domain comprises one or more of a D1134X, a G1217X, a R1334X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
- the SpCas9 domain comprises one or more of a D1134V, a G1217R, a R1334Q, and a T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
- the SpCas9 domain comprises a D1134V, a G1217R, a R1334Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
- the Cas9 domains of any of the fusion proteins provided herein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cas9 polypeptide described herein.
- the Cas9 domains of any of the fusion proteins provided herein comprises the amino acid sequence of any Cas9 polypeptide described herein.
- the Cas9 domains of any of the fusion proteins provided herein consists of the amino acid sequence of any Cas9 polypeptide described herein.
- Residues El 134, Q1334, and R1336 above, which can be mutated from D1134, R1334, and T1336 to yield a SpEQR Cas9, are underlined and in bold.
- NRGKSDNVP SEEVVKKMKNYWRQLLNAKLIT QRKFDNLTKAERGGLSELDKAGFIK RQLVETRQITKHVAQILDSRMNTKYDE DKLIREVKVITLKSKLVSDFRKDFQFYKV REINNYHHAHD
- a YLN A VV GT ALIKK YPKLESEF VY GD YK V YD YRKMIAK SEQEIGK ATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSM PQVNIVKKTEVQTGGFSKESILPKRN SDKLIARKKDWDPKKY GGF VSPTVAY S VLVV AK VEKGK SKKLK S VKELLGITIMERS SFEKNPIDFLE AKGYKEVKKDLIIKLPKYSLFE LENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQ
- Residues VI 134, Q1334, and R1336 above which can be mutated from D1 134, R1334, and T1336 to yield a SpVQR Cas9, are underlined and in bold.
- Residues VI 134, R1217, Q1334, and R1336 above, which can be mutated from D1134, G1217, R1334, and T1336 to yield a SpVRER Cas9, are underlined and in bold.
- the Cas9 nuclease has two functional endonuclease domains: RuvC and HNH.
- Cas9 undergoes a conformational change upon target binding that positions the nuclease domains to cleave opposite strands of the target DNA.
- the end result of Cas9-mediated DNA cleavage is a double-strand break (DSB) within the target DNA ( ⁇ 3-4 nucleotides upstream of the PAM sequence).
- the resulting DSB is then repaired by one of two general repair pathways: (1) the efficient but error-prone non-homologous end joining (NHEJ) pathway; or (2) the less efficient but high-fidelity homology directed repair (HDR) pathway.
- NHEJ efficient but error-prone non-homologous end joining
- HDR homology directed repair
- The“efficiency” of non-homologous end joining (NHEJ) and/or homology directed repair (HDR) can be calculated by any convenient method. For example, in some cases, efficiency can be expressed in terms of percentage of successful FIDR.
- a surveyor nuclease assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage.
- a surveyor nuclease enzyme can be used that directly cleaves DNA containing a newly integrated restriction sequence as the result of successful HDR. More cleaved substrate indicates a greater percent HDR (a greater efficiency of HDR).
- a fraction (percentage) of HDR can be calculated using the following equation [(cleavage products)/(substrate plus cleavage products)] ( e.g ., (b+c)/(a+b+c), where“a” is the band intensity of DNA substrate and“b” and“c” are the cleavage products).
- efficiency can be expressed in terms of percentage of successful NHEJ.
- a T7 endonuclease I assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage NHEJ.
- a fraction (percentage) of NHEJ can be calculated using the following equation: (l-(l-(b+c)/(a+b+c)) 1/2 )x l00, where“a” is the band intensity of DNA substrate and“b” and“c” are the cleavage products (Ran et. al, 2013 Sep. 12; 154(6): 1380-9; and Ran et al, Nat Protoc. 2013 Nov.; 8(11): 2281-2308).
- the NHEJ repair pathway is the most active repair mechanism, and it frequently causes small nucleotide insertions or deletions (indels) at the DSB site.
- NHEJ-mediated DSB repair has important practical implications, because a population of cells expressing Cas9 and a gRNA or a guide polynucleotide can result in a diverse array of mutations. In most cases, NHEJ gives rise to small indels in the target DNA that result in amino acid deletions, insertions, or frameshift mutations leading to premature stop codons within the open reading frame (ORF) of the targeted gene. The ideal end result is a loss-of- function mutation within the targeted gene.
- HDR homology directed repair
- a DNA repair template containing the desired sequence can be delivered into the cell type of interest with the gRNA(s) and Cas9 or Cas9 nickase.
- the repair template can contain the desired edit as well as additional homologous sequence immediately upstream and downstream of the target (termed left & right homology arms). The length of each homology arm can be dependent on the size of the change being introduced, with larger insertions requiring longer homology arms.
- the repair template can be a single-stranded oligonucleotide, double-stranded oligonucleotide, or a double-stranded DNA plasmid.
- the efficiency of HDR is generally low ( ⁇ 10% of modified alleles) even in cells that express Cas9, gRNA and an exogenous repair template.
- the efficiency of HDR can be enhanced by synchronizing the cells, since HDR takes place during the S and G2 phases of the cell cycle. Chemically or genetically inhibiting genes involved in NHEJ can also increase HDR frequency.
- Cas9 is a modified Cas9.
- a given gRNA targeting sequence can have additional sites throughout the genome where partial homology exists. These sites are called off-targets and need to be considered when designing a gRNA.
- CRISPR specificity can also be increased through modifications to Cas9.
- Cas9 generates double-strand breaks (DSBs) through the combined activity of two nuclease domains, RuvC and HNH.
- Cas9 nickase, a D10A mutant of SpCas9 retains one nuclease domain and generates a DNA nick rather than a DSB.
- the nickase system can also be combined with HDR-mediated gene editing for specific gene edits.
- Cas9 is a variant Cas9 protein.
- a variant Cas9 polypeptide has an amino acid sequence that is different by one amino acid (e.g ., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild type Cas9 protein.
- the variant Cas9 polypeptide has an amino acid change (e.g, deletion, insertion, or substitution) that reduces the nuclease activity of the Cas9 polypeptide.
- the variant Cas9 polypeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nuclease activity of the corresponding wild-type Cas9 protein.
- the variant Cas9 protein has no substantial nuclease activity.
- a subject Cas9 protein is a variant Cas9 protein that has no substantial nuclease activity, it can be referred to as“dCas9.”
- a variant Cas9 protein has reduced nuclease activity.
- a variant Cas9 protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the endonuclease activity of a wild-type Cas9 protein, e.g., a wild-type Cas9 protein.
- a variant Cas9 protein can cleave the complementary strand of a guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence.
- the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the RuvC domain.
- a variant Cas9 protein has a D10A (aspartate to alanine at amino acid position 10) and can therefore cleave the complementary strand of a double stranded guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence (thus resulting in a single strand break (SSB) instead of a double strand break (DSB) when the variant Cas9 protein cleaves a double stranded target nucleic acid) (see, for example, Jinek et al., Science. 2012 Aug. 17;
- a variant Cas9 protein can cleave the non-complementary strand of a double stranded guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence.
- the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the HNH domain
- the variant Cas9 protein has an H840A (histidine to alanine at amino acid position 840) mutation and can therefore cleave the non-complementary strand of the guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence (thus resulting in a SSB instead of a DSB when the variant Cas9 protein cleaves a double stranded guide target sequence).
- Such a Cas9 protein has a reduced ability to cleave a guide target sequence (e.g., a single stranded guide target sequence) but retains the ability to bind a guide target sequence (e.g., a single stranded guide target sequence).
- a variant Cas9 protein has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
- the variant Cas9 protein harbors both the D10A and the H840A mutations such that the polypeptide has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
- Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
- the variant Cas9 protein harbors W476A and W 1126A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
- a Cas9 protein has a reduced ability to cleave a target DNA (e.g, a single stranded target DNA) but retains the ability to bind a target DNA (e.g, a single stranded target DNA).
- the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127 A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
- a Cas9 protein has a reduced ability to cleave a target DNA (e.g, a single stranded target DNA) but retains the ability to bind a target DNA (e.g, a single stranded target DNA).
- the variant Cas9 protein harbors H840A, W476A, and W 1126 A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
- a Cas9 protein has a reduced ability to cleave a target DNA (e.g, a single stranded target DNA) but retains the ability to bind a target DNA (e.g. , a single stranded target DNA).
- the variant Cas9 protein harbors H840A, D10A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
- Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
- the variant Cas9 has restored catalytic His residue at position 840 in the Cas9 HNH domain (A840H).
- the variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125 A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
- a Cas9 protein has a reduced ability to cleave a target DNA (e.g, a single stranded target DNA) but retains the ability to bind a target DNA (e.g, a single stranded target DNA).
- the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A,
- a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g. , a single stranded target DNA).
- a target DNA e.g., a single stranded target DNA
- the variant Cas9 protein harbors W476A and W 1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A,
- the variant Cas9 protein does not bind efficiently to a PAM sequence.
- the method does not require a PAM sequence.
- the method can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
- Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
- residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered ( i.e ., substituted). Also, mutations other than alanine substitutions are suitable.
- a variant Cas9 protein that has reduced catalytic activity e.g., when a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g, D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A), the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
- the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
- the variant Cas protein can be spCas9, spCas9-VRQR, spCas9- VRER, xCas9 (sp), saCas9, saCas9-KKH, spCas9-MQKSER, spCas9-LRKIQK, or spCas9- LRVSQL
- Cas9 can include RNA-guided endonucleases from the Cpfl family that display cleavage activity in mammalian cells.
- CRISPR from Prevotella and Francisella 1 (CRISPR/Cpfl) is a DNA-editing technology analogous to the CRISPR/Cas9 system.
- Cpfl is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
- Cpfl genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
- Cpfl is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpfl- mediated DNA cleavage is a double-strand break with a short 3' overhang. Cpfl’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing. Like the Cas9 variants and orthologues described above, Cpfl can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT -rich genomes that lack the NGG PAM sites favored by SpCas9.
- the Cpfl locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc finger-like domain.
- the Cpfl protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9. Furthermore, Cpfl does not have a HNH endonuclease domain, and the N-terminal of Cpfl does not have the alpha-helical recognition lobe of Cas9.
- Cpfl CRISPR-Cas domain architecture shows that Cpfl is functionally unique, being classified as Class 2, type V CRISPR system.
- the Cpfl loci encode Casl, Cas2 and Cas4 proteins more similar to types I and III than from type II systems.
- Cpfl does’t need the trans-activating CRISPR RNA (tracrRNA), therefore, only CRISPR (crRNA) is required.
- Cpfl is not only smaller than Cas9, but also it has a smaller sgRNA molecule (proximately half as many nucleotides as Cas9).
- the Cpfl -crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5’-YTN-3’ in contrast to the G-rich PAM targeted by Cas9. After identification of PAM, Cpfl introduces a sticky-end- like DNA double- stranded break of 4 or 5 nucleotides overhang.
- Fusion proteins comprising two napDNAbp, a Deaminase Domain
- Some aspects of the disclosure provide fusion proteins comprising a napDNAbp domain having nickase activity (e g., nCas domain) and a catalytically inactive napDNAbp (e.g., dCas domain) and a nucleobase editor (e.g., adenosine deaminase domain, cytidine deaminase domain), where at least the napDNAbp domains are joined by a linker.
- the Cas domains may be any of the Cas domains or Cas proteins (e.g., dCas9 and nCas9) provided herein.
- any of the Cas domains, DNA binding protein domains, or Cas proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, and Casl2i.
- Cas9 e.g., dCas9 and nCas9
- Cas9 e.g., dCas9 and nCas9
- Cas9 e.g., dCas9 and nCas9
- Cas9 e.g., dCas9 and nCas9
- Cas9 e.g., dCas9 and nCas9
- Casl2a/Cpfl Casl2a/C
- the fusion protein comprises the structure, where the deaminase is adenosine deaminase or cytidine deaminase:
- the used in the general architecture above indicates the presence of an optional linker.
- the deaminase and a napDNAbp e.g., Cas domain
- the deaminase and a napDNAbp are not joined by a linker sequence, but are directly fused.
- a linker is present between the deaminase domain and the napDNAbp.
- the deaminase or other nucleobase editor is directly fused to dCas and a linker joins dCas and nCas9.
- the deaminase and the napDNAbps are fused via any of the linkers provided herein.
- the deaminase and the napDNAbp are fused via any of the linkers provided below in the section entitled“Linkers”.
- the dCas domain and the deaminase are immediately adjacent and the nCas domain is joined to these domains (either 5’ or 3’) via a linker.
- the disclosure provides fusion proteins comprising a heterologous polypeptide fused to a nucleic acid programmable nucleic acid binding protein, for example, a napDNAbp.
- a heterologous polypeptide can be a polypeptide that is not found in the native or wild-type napDNAbp polypeptide sequence.
- the heterologous polypeptide can be fused to the napDNAbp at a C-terminal end of the napDNAbp, an N-terminal end of the napDNAbp, or inserted at an internal location of the napDNAbp. In some embodiments, the heterologous polypeptide is inserted at an internal location of the napDNAbp.
- the heterologous polypeptide is a deaminase or a functional fragment thereof.
- a fusion protein can comprise a deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide.
- the deaminase in a fusion protein can be a cytidine deaminase.
- the deaminase in a fusion protein can be an adenosine deaminase.
- the deaminase can be a circular permutant deaminase.
- the deaminase can be a circular permutant adenosine deaminase or a circular permutant cytidine deaminase.
- the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 116 as numbered in the TadA reference sequence.
- the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 136 as numbered in the TadA reference sequence.
- the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 65 as numbered in the TadA reference sequence.
- the fusion protein can comprise more than one deaminase.
- the fusion protein can comprise, for example, 1, 2, 3, 4, 5 or more deaminases.
- the fusion protein comprises one deaminase.
- the fusion protein comprises two deaminases.
- the two or more deaminases in a fusion protein can be an adenosine deaminase, cytidine deaminase, or a combination thereof.
- the two or more deaminases can be homodimers.
- the two or more deaminases can be heterodimers.
- the two or more deaminases can be inserted in tandem in the napDNAbp. In some embodiments, the two or more deaminases may not be in tandem in the napDNAbp.
- the napDNAbp in the fusion protein is a Cas9 polypeptide or a fragment thereof.
- the Cas9 polypeptide can be a variant Cas9 polypeptide.
- the Cas9 polypeptide is a Cas9 nickase (nCas9) polypeptide or a fragment thereof.
- the Cas9 polypeptide is a nuclease dead Cas9 (dCas9) polypeptide or a fragment thereof.
- the Cas9 polypeptide in a fusion protein can be a full- length Cas9 polypeptide. In some cases, the Cas9 polypeptide in a fusion protein may not be a full length Cas9 polypeptide.
- the Cas9 polypeptide can be truncated, for example, at a N- terminal or C-terminal end relative to a naturally-occurring Cas9 protein.
- the Cas9 polypeptide can be a circularly permuted Cas9 protein.
- the Cas9 polypeptide can be a fragment, a portion, or a domain of a Cas9 polypeptide, that is still capable of binding the target polynucleotide and a guide nucleic acid sequence.
- the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (StlCas9), or fragments or variants thereof.
- SpCas9 Streptococcus pyogenes Cas9
- SaCas9 Staphylococcus aureus Cas9
- StlCas9 Streptococcus thermophilus 1 Cas9
- the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Cas9 polypeptide.
- the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the Cas9 amino acid sequence set forth in SEQ ID NO: 1.
- the heterologous polypeptide (e g., deaminase) can be inserted in the napDNAbp (e.g., Cas9) at a suitable location, for example, such that the napDNAbp retains its ability to bind the target polynucleotide and a guide nucleic acid.
- a deaminase can be inserted into a napDNAbp without compromising function of the deaminase (e.g., base editing activity) or the napDNAbp (e.g., ability to bind to target nucleic acid and guide nucleic acid).
- a deaminase can be inserted in the napDNAbp at, for example, a disordered region or a region comprising a high temperature factor or B-factor as shown by crystallographic studies.
- Regions of a protein that are less ordered, disordered, or unstructured, for example solvent exposed regions and loops, can be used for insertion without compromising structure or function.
- a deaminase can be inserted in the napDNAbp in a flexible loop region or a solvent-exposed region. In some embodiments, the deaminase is inserted in a flexible loop of the Cas9 polypeptide.
- the insertion location of a deaminase is determined by B- factor analysis of the crystal structure of Cas9 polypeptide.
- the deaminase is inserted in regions of the Cas9 polypeptide comprising higher than average B- factors (e.g., higher B factors compared to the total protein or the protein domain comprising the disordered region).
- B-factor or temperature factor can indicate the fluctuation of atoms from their average position (for example, as a result of temperature-dependent atomic vibrations or static disorder in a crystal lattice).
- a high B-factor (e.g., higher than average B- factor) for backbone atoms can be indicative of a region with relatively high local mobility.
- Such a region can be used for inserting a deaminase without compromising structure or function.
- a deaminase can be inserted at a location with a residue having a Ca atom with a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, or greater than 200% more than the average B-factor for the total protein.
- a deaminase can be inserted at a location with a residue having a Ca atom with a B- factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
- Cas9 polypeptide positions comprising a higher than average B-factor can include, for example, residues 768, 792, 1052, 1015, 1022, 1026, 1029, 1067, 1040, 1054, 1068, 1246, 1247, and 1248 as numbered in SEQ ID No: l.
- Cas9 polypeptide regions comprising a higher than average B-factor can include, for example, residues 792-872, 792-906, and 2-791 as numbered in SEQ ID No: l.
- a heterologous polypeptide e.g., deaminase
- the heterologous polypeptide is inserted between amino acid positions 768- 769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029-1030, 1040-1041, 1052- 1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the heterologous polypeptide is inserted between amino acid positions 769-770, 792-793, 793-794, 1016-1017, 1023-1024, 1027-1028, 1030-1031, 1041-1042, 1053-1054, 1055-1056, 1068-1069, 1069- 1070, 1248-1249, or 1249-1250 as numbered in SEQ ID NO: 1 or corresponding amino acid positions thereof.
- the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 791, 792, 1015, 1016, 1022, 1023, 1026, 1029, 1040, 1052, 1054, 1067, 1068, 1069, 1246, 1247, and 1248 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide. It should be understood that the reference to SEQ ID NO: 1 with respect to insertion positions is for illustrative purpose.
- the insertions as discussed herein are not limited to the Cas9 polypeptide sequence of SEQ ID NO: 1, but include insertion at corresponding locations in variant Cas9 polypeptides, for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
- nCas9 Cas9 nickase
- dCas9 nuclease dead Cas9
- Cas9 variant lacking a nuclease domain for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
- a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the heterologous polypeptide is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1029-1030, 1040-1041,
- the heterologous polypeptide is inserted between amino acid positions 769-770, 793-794, 1023-1024, 1027-1028, 1030-1031, 1041-1042,
- the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a heterologous polypeptide e.g., deaminase
- a heterologous polypeptide e.g., deaminase
- deaminase can be inserted in the napDNAbp at an amino acid residue selected from the group consisting of: 1002, 1003, 1025, 1052-1056, 1242-1247, 1061-1077, 943-947, 686-691, 569-578, 530-539, and 1060-1077 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase can be inserted at the N-terminus or the C-terminus of the residue or replace the residue. In some embodiments, the deaminase is inserted at the C-terminus of the residue.
- an ABE e.g., TadA
- an ABE is inserted at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- an ABE e.g., TadA
- the ABE is inserted at the N-terminus of an amino acid selected from the group consisting of:
- the ABE is inserted at the C-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a CBE (e.g., APOBECl) is inserted at an amino acid residue selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of an amino acid selected from the group consisting of:
- the ABE is inserted to replace an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040,
- the deaminase is inserted at amino acid residue 768 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 768 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 768 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 768 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 791 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 791 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 791 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 791 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 792 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 792 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 792 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 792 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1016 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1016 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1016 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1016 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1022 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1022 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1022 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1022 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1023 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1023 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1023 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1023 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1026 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1026 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1026 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1026 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1029 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1029 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1029 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1029 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1040 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 140 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1040 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1040 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1052 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1052 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1052 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1052 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1054 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1054 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1054 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1054 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1067 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1067 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1067 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1067 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1068 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1068 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1068 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1068 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1069 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1069 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1069 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1069 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the deaminase is inserted at amino acid residue 1248 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the N-terminus of amino acid 1248 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted at the C-terminus of amino acid 1248 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the ABE is inserted to replace amino acid 1248 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a heterologous polypeptide e.g., deaminase
- the flexible loop portions can be selected from the group consisting of 530-537, 569-570, 686-691, 943-947, 1002-1025, 1052-1077, 1232-1247, or 1298-1300 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the flexible loop portions can be selected from the group consisting of: 1- 529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, or 1248-1297 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a heterologous polypeptide (e.g., deaminase) can be inserted into a Cas9 polypeptide region corresponding to amino acid residues: 1017-1069, 1242-1247, 1052-1056, 1060-1077, 1002 - 1003, 943-947, 530-537, 568-579, 686-691,1242-1247, 1298 - 1300, 1066-1077, 1052-1056, or 1060-1077 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a heterologous polypeptide (e.g., deaminase) can be inserted in place of a deleted region of a Cas9 polypeptide.
- the deleted region can correspond to an N-terminal or C- terminal portion of the Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 792-872 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 792-906 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 2-791 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region correspond to residues 1017-1069 as numbered in SEQ ID NO: 1, or corresponding amino acid residues thereof.
- a heterologous polypeptide (e.g., deaminase) can be inserted within a structural or functional domain of a Cas9 polypeptide.
- a heterologous polypeptide (e.g., deaminase) can be inserted between two structural or functional domains of a Cas9 polypeptide.
- a heterologous polypeptide (e.g., deaminase) can be inserted in place of a structural or functional domain of a Cas9 polypeptide, for example, after deleting the domain from the Cas9 polypeptide.
- the structural or functional domains of a Cas9 polypeptide can include, for example, RuvC I, RuvC II, RuvC III, Reel, Rec2, PI, or HNH.
- the Cas9 polypeptide lacks one or more domains selected from the group consisting of: RuvC I, RuvC II, RuvC III, Reel, Rec2, PI, or HNH domain. In some embodiments, the Cas9 polypeptide lacks a nuclease domain. In some embodiments, the Cas9 polypeptide lacks a HNH domain. In some embodiments, the Cas9 polypeptide lacks a portion of the HNH domain such that the Cas9 polypeptide has reduced or abolished HNH activity.
- the Cas9 polypeptide comprises a deletion of the nuclease domain and the deaminase is inserted to replace the nuclease domain.
- the HNH domain is deleted and the deaminase is inserted in its place.
- one or more of the RuvC domains is deleted and the deaminase is inserted in its place.
- a fusion protein comprising a heterologous polypeptide can be flanked by a N- terminal and a C-terminal fragment of a napDNAbp.
- the fusion protein comprises a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide.
- the N terminal fragment or the C terminal fragment can bind the target polynucleotide sequence.
- the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of a flexible loop of a Cas9 polypeptide.
- the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of an alpha-helix structure of the Cas9 polypeptide.
- the N- terminal fragment or the C-terminal fragment can comprise a DNA binding domain.
- the N-terminal fragment or the C-terminal fragment can comprise a RuvC domain.
- the N-terminal fragment or the C- terminal fragment can comprise a HNH domain. In some embodiments, neither of the N- terminal fragment and the C-terminal fragment comprises a HNH domain.
- the C-terminus of the N terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
- the N-terminus of the C terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
- the insertion location of different deaminases can be different in order to have proximity between the target nucleobase and an amino acid in the C-terminus of the N terminal Cas9 fragment or the N-terminus of the C terminal Cas9 fragment.
- the insertion position of an ABE can be at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- a suitable insertion position of a CBE can be an amino acid residue selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the insertion of the ABE can be inserted to the N terminus or the C terminus of any one of the above listed amino acid residues. In some embodiemnts, the insertion of the ABE can be inserted to replace any one of the above listed amino acid residues.
- the N-terminal Cas9 fragment of a fusion protein (i.e. the N-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the N-terminus of a Cas9 polypeptide.
- the N-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
- the N-terminal Cas9 fragment of a fusion protein can comprise a sequence
- amino acid residues 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in SEQ ID NO: l, or a
- the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1-56, 1-95, 1-200, 1- 300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in SEQ ID NO: 1, or a corresponding amino acid residue in another Cas9 polypeptide.
- the C-terminal Cas9 fragment of a fusion protein (i.e. the C-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the C-terminus of a Cas9 polypeptide.
- the C-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Crystallography & Structural Chemistry (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202080026678.0A CN114040977B (zh) | 2019-01-31 | 2020-01-31 | 非靶脱氨反应减低的核碱基编辑器和用于定性核碱基编辑器的测定 |
| US17/427,410 US12612618B2 (en) | 2019-01-31 | 2020-01-31 | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| EP20748889.1A EP3918078A4 (en) | 2019-01-31 | 2020-01-31 | NUCLEOBASE EDITORS WITH REDUCED NON-TARGET DEAMINATION AND NUCLEOBASE EDITOR CHARACTERIZATION TESTS |
| JP2021544294A JP7646552B2 (ja) | 2019-01-31 | 2020-01-31 | 低減された非標的脱アミノ化を有する核酸塩基エディターおよび核酸塩基エディターの特徴づけのためのアッセイ |
| KR1020217026724A KR20210121113A (ko) | 2019-01-31 | 2020-01-31 | 비-표적 탈아미노화가 감소된 핵염기 편집기 및 핵염기 편집기를 특성규명하기 위한 분석 |
| CA3127493A CA3127493A1 (en) | 2019-01-31 | 2020-01-31 | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| AU2020215730A AU2020215730A1 (en) | 2019-01-31 | 2020-01-31 | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| JP2025034660A JP2025102784A (ja) | 2019-01-31 | 2025-03-05 | 低減された非標的脱アミノ化を有する核酸塩基エディターおよび核酸塩基エディターの特徴づけのためのアッセイ |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962799702P | 2019-01-31 | 2019-01-31 | |
| US62/799,702 | 2019-01-31 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020160514A1 true WO2020160514A1 (en) | 2020-08-06 |
Family
ID=71842366
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/016285 Ceased WO2020160514A1 (en) | 2019-01-31 | 2020-01-31 | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US12612618B2 (https=) |
| EP (1) | EP3918078A4 (https=) |
| JP (2) | JP7646552B2 (https=) |
| KR (1) | KR20210121113A (https=) |
| CN (1) | CN114040977B (https=) |
| AU (1) | AU2020215730A1 (https=) |
| CA (1) | CA3127493A1 (https=) |
| WO (1) | WO2020160514A1 (https=) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112195164A (zh) * | 2020-12-07 | 2021-01-08 | 中国科学院动物研究所 | 工程化的Cas效应蛋白及其使用方法 |
| WO2021222318A1 (en) | 2020-04-28 | 2021-11-04 | The Broad Institute, Inc. | Targeted base editing of the ush2a gene |
| JPWO2022050413A1 (https=) * | 2020-09-04 | 2022-03-10 | ||
| WO2022120520A1 (en) * | 2020-12-07 | 2022-06-16 | Institute Of Zoology, Chinese Academy Of Sciences | Engineered cas effector proteins and methods of use thereof |
| WO2022204574A1 (en) * | 2021-03-26 | 2022-09-29 | Beam Therapeutics Inc. | Adenosine deaminase variants and uses thereof |
| WO2023283092A1 (en) * | 2021-07-06 | 2023-01-12 | Prime Medicine, Inc. | Compositions and methods for efficient genome editing |
| JP2024514649A (ja) * | 2021-04-16 | 2024-04-02 | ビーム セラピューティクス インク. | 肝細胞の遺伝子修飾 |
| US12024728B2 (en) | 2021-09-08 | 2024-07-02 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US12157898B2 (en) | 2020-03-04 | 2024-12-03 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12454694B2 (en) | 2018-09-07 | 2025-10-28 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| US12576151B2 (en) | 2020-09-25 | 2026-03-17 | Beam Therapeutics Inc. | Fratricide resistant modified immune cells and methods of using the same |
| US12594301B2 (en) | 2019-09-27 | 2026-04-07 | Beam Therapeutics Inc. | Compositions and methods for treatment of liquid cancers |
| US12600971B2 (en) | 2019-02-13 | 2026-04-14 | Beam Therapeutics Inc. | Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence |
| US12612618B2 (en) | 2019-01-31 | 2026-04-28 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2015330699B2 (en) | 2014-10-10 | 2021-12-02 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| CN114634923B (zh) * | 2022-04-07 | 2024-02-23 | 尧唐(上海)生物科技有限公司 | 腺苷脱氨酶、碱基编辑器融合蛋白、碱基编辑器系统及用途 |
| US20250361530A1 (en) * | 2022-05-14 | 2025-11-27 | The Regents Of The University Of California | Genome editing systems for multiplexing point mutation introduction in living cells |
| WO2025119306A1 (zh) * | 2023-12-06 | 2025-06-12 | 北京齐禾生科生物科技有限公司 | 优化工程化t细胞的碱基编辑系统及其应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160304846A1 (en) * | 2013-12-12 | 2016-10-20 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US20180179503A1 (en) * | 2016-12-23 | 2018-06-28 | President And Fellows Of Harvard College | Editing of ccr5 receptor gene to protect against hiv infection |
| WO2018176009A1 (en) * | 2017-03-23 | 2018-09-27 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
| US20180298421A1 (en) * | 2014-12-20 | 2018-10-18 | Identifygenomics, Llc | Compositions and methods for targeted depletion, enrichment, and partitioning of nucleic acids using crispr/cas system proteins |
Family Cites Families (140)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9600384D0 (en) | 1996-01-09 | 1996-03-13 | Nyfotek As | Dna glycosylases |
| US6886207B1 (en) | 1999-06-14 | 2005-05-03 | The Procter & Gamble Company | Toothbrush |
| EP1235914A2 (en) | 1999-11-24 | 2002-09-04 | Joseph Rosenecker | Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells |
| US20040003420A1 (en) | 2000-11-10 | 2004-01-01 | Ralf Kuhn | Modified recombinase |
| US20050222030A1 (en) | 2001-02-21 | 2005-10-06 | Anthony Allison | Modified annexin proteins and methods for preventing thrombosis |
| WO2002068676A2 (en) | 2001-02-27 | 2002-09-06 | University Of Rochester | METHODS AND COMPOSITIONS FOR MODIFYING APOLIPOPROTEIN B mRNA EDITING |
| AU2002330714A1 (en) | 2001-05-30 | 2003-01-02 | Biomedical Center | In silico screening for phenotype-associated expressed sequences |
| US7300829B2 (en) | 2003-06-02 | 2007-11-27 | Applied Materials, Inc. | Low temperature process for TFT fabrication |
| WO2010132092A2 (en) | 2009-05-12 | 2010-11-18 | The Scripps Research Institute | Cytidine deaminase fusions and related methods |
| US20110104787A1 (en) | 2009-11-05 | 2011-05-05 | President And Fellows Of Harvard College | Fusion Peptides That Bind to and Modify Target Nucleic Acid Sequences |
| EP2513296A4 (en) | 2009-12-18 | 2013-05-22 | Univ Leland Stanford Junior | USE OF CYTIDINE DAMINASE ASSOCIATED ACTIVITIES TO PROMOTE DEMETHYLATION AND CELL REPROGRAMMEIRING |
| KR102096534B1 (ko) | 2011-09-28 | 2020-04-03 | 에라 바이오테크, 에스.에이. | 분할된 인테인 및 그의 이용 |
| CN103088008B (zh) | 2011-10-31 | 2014-08-20 | 中国科学院微生物研究所 | 胞苷脱氨酶及其编码基因和它们的应用 |
| US20150017136A1 (en) | 2013-07-15 | 2015-01-15 | Cellectis | Methods for engineering allogeneic and highly active t cell for immunotherapy |
| AU2013266968B2 (en) | 2012-05-25 | 2017-06-29 | Emmanuelle CHARPENTIER | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| WO2013188037A2 (en) | 2012-06-11 | 2013-12-19 | Agilent Technologies, Inc | Method of adaptor-dimer subtraction using a crispr cas6 protein |
| EP3431497B1 (en) | 2012-06-27 | 2022-07-27 | The Trustees of Princeton University | Split inteins, conjugates and uses thereof |
| PL3360964T3 (pl) | 2012-12-06 | 2020-03-31 | Sigma-Aldrich Co. Llc | Modyfikacja i regulacja genomu oparta na crispr |
| WO2014093655A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US20140273230A1 (en) | 2013-03-15 | 2014-09-18 | Sigma-Aldrich Co., Llc | Crispr-based genome modification and regulation |
| FI2997141T3 (fi) | 2013-05-13 | 2022-12-15 | CD19-spesifinen kimeerinen antigeenireseptori ja sen käyttöjä | |
| WO2014186686A2 (en) | 2013-05-17 | 2014-11-20 | Two Blades Foundation | Targeted mutagenesis and genome engineering in plants using rna-guided cas nucleases |
| US9267135B2 (en) | 2013-06-04 | 2016-02-23 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| EP3666892A1 (en) | 2013-07-10 | 2020-06-17 | President and Fellows of Harvard College | Orthogonal cas9 proteins for rna-guided gene regulation and editing |
| WO2015021426A1 (en) | 2013-08-09 | 2015-02-12 | Sage Labs, Inc. | A crispr/cas system-based novel fusion protein and its application in genome editing |
| US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| EP3835419A1 (en) | 2013-12-12 | 2021-06-16 | The Regents of The University of California | Methods and compositions for modifying a single stranded target nucleic acid |
| JP6793547B2 (ja) * | 2013-12-12 | 2020-12-02 | ザ・ブロード・インスティテュート・インコーポレイテッド | 最適化機能CRISPR−Cas系による配列操作のための系、方法および組成物 |
| ES2918501T3 (es) | 2013-12-19 | 2022-07-18 | Novartis Ag | Receptores de antígenos quiméricos de mesotelina humana y usos de los mismos |
| WO2015092024A2 (en) | 2013-12-20 | 2015-06-25 | Cellectis | Method of engineering multi-input signal sensitive t cell for immunotherapy |
| EP3115457B1 (en) | 2014-03-05 | 2019-10-02 | National University Corporation Kobe University | Genomic sequence modification method for specifically converting nucleic acid bases of targeted dna sequence, and molecular complex for use in same |
| US20170335281A1 (en) | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
| KR20170032406A (ko) | 2014-07-15 | 2017-03-22 | 주노 쎄러퓨티크스 인코퍼레이티드 | 입양 세포 치료를 위한 조작된 세포 |
| US10544201B2 (en) | 2014-07-31 | 2020-01-28 | Cellectis | ROR1 specific multi-chain chimeric antigen receptor |
| EP3186375A4 (en) | 2014-08-28 | 2019-03-13 | North Carolina State University | Novel CAS9 PROTEINS AND CHARACTERISTICS FOR DNA TARGETING AND GENOME EDITING |
| BR112017007765B1 (pt) | 2014-10-14 | 2023-10-03 | Halozyme, Inc | Composições de adenosina deaminase-2 (ada2), variantes do mesmo e métodos de usar o mesmo |
| WO2016061368A1 (en) | 2014-10-15 | 2016-04-21 | The Children's Hospital Of Philadelphia | Compositions and methods for treating b-lymphoid malignancies |
| US10258697B2 (en) | 2014-10-29 | 2019-04-16 | Massachusetts Eye And Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| PT3216867T (pt) | 2014-11-04 | 2020-07-16 | Univ Kobe Nat Univ Corp | Método para modificar a sequência de genoma para introduzir mutação específica a sequência de adn alvo por reação de remoção de bases, e complexo molecular nele utilizado |
| MA40921A (fr) | 2014-11-05 | 2017-09-12 | Abbvie Stemcentrx Llc | Récepteurs antigéniques chimériques anti-cldn et procédés d'utilisation |
| WO2016075612A1 (en) | 2014-11-12 | 2016-05-19 | Rinat Neuroscience Corp. | Inhibitory chimeric antigen receptors |
| HRP20191873T1 (hr) | 2014-12-12 | 2020-01-24 | Bluebird Bio, Inc. | Kimerni antigenski receptori |
| EP3250689B1 (en) * | 2015-01-28 | 2020-11-04 | The Regents of The University of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| MA41613A (fr) | 2015-02-23 | 2018-01-02 | Abbvie Stemcentrx Llc | Récepteurs antigéniques chimériques anti-dll3 et procédés d'utilisation desdits récepteurs |
| JP2018522249A (ja) | 2015-04-24 | 2018-08-09 | エディタス・メディシン、インコーポレイテッド | Cas9分子/ガイドrna分子複合体の評価 |
| US20180291372A1 (en) | 2015-05-14 | 2018-10-11 | Massachusetts Institute Of Technology | Self-targeting genome editing system |
| WO2016196388A1 (en) | 2015-05-29 | 2016-12-08 | Juno Therapeutics, Inc. | Composition and methods for regulating inhibitory interactions in genetically engineered cells |
| EP3331582A4 (en) | 2015-05-29 | 2019-08-07 | Agenovir Corporation | METHODS AND COMPOSITIONS FOR THE TREATMENT OF TRANSPLANTATION CELLS |
| WO2016196655A1 (en) * | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
| TWI906646B (zh) * | 2015-06-18 | 2025-12-01 | 美商博得學院股份有限公司 | 降低脫靶效應的crispr酶突變 |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| JP7044373B2 (ja) | 2015-07-15 | 2022-03-30 | ラトガース,ザ ステート ユニバーシティ オブ ニュージャージー | ヌクレアーゼ非依存的な標的化遺伝子編集プラットフォームおよびその用途 |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| AU2016323985B2 (en) | 2015-09-17 | 2022-12-15 | Novartis Ag | CAR T cell therapies with enhanced efficacy |
| US11008555B2 (en) * | 2015-09-17 | 2021-05-18 | The Regents Of The University Of California | Variant Cas9 polypeptides comprising internal insertions |
| IL310721B2 (en) | 2015-10-23 | 2025-11-01 | Harvard College | Nucleobase editors and uses thereof |
| BR112018008442A2 (pt) | 2015-11-05 | 2018-11-06 | Juno Therapeutics Inc | receptores quiméricos contendo domínios induto-res de traf e composições e métodos relacionados |
| US11020429B2 (en) | 2015-11-05 | 2021-06-01 | Juno Therapeutics, Inc. | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy |
| PT3408292T (pt) | 2016-01-29 | 2023-07-19 | Univ Princeton | Inteínas divididas com excecional atividade de splicing |
| EP3443002A4 (en) | 2016-04-14 | 2019-12-04 | Bluebird Bio, Inc. | SYSTEMS FOR RECOVERED CHIMERIC ANTIGEN RECEPTORS |
| KR102546839B1 (ko) | 2016-08-03 | 2023-06-23 | 워싱턴 유니버시티 | 키메라 항원 수용체를 이용한 t 세포 악성종양의 치료를 위한 car-t 세포의 유전자 편집 |
| CN110214183A (zh) | 2016-08-03 | 2019-09-06 | 哈佛大学的校长及成员们 | 腺苷核碱基编辑器及其用途 |
| WO2018031683A1 (en) | 2016-08-09 | 2018-02-15 | President And Fellows Of Harvard College | Programmable cas9-recombinase fusion proteins and uses thereof |
| KR102622411B1 (ko) | 2016-10-14 | 2024-01-10 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 핵염기 에디터의 aav 전달 |
| SG10201913505WA (en) * | 2016-10-17 | 2020-02-27 | Univ Nanyang Tech | Truncated crispr-cas proteins for dna targeting |
| WO2018085690A1 (en) | 2016-11-04 | 2018-05-11 | Bluebird Bio, Inc. | Anti-bcma car t cell compositions |
| EP3538561A4 (en) | 2016-11-11 | 2020-10-21 | The Regents of The University of California | RNA-GUIDED VARIANT POLYPEPTIDES AND THEIR METHODS OF USE |
| US11192929B2 (en) * | 2016-12-08 | 2021-12-07 | Regents Of The University Of Minnesota | Site-specific DNA base editing using modified APOBEC enzymes |
| SG10202106058WA (en) | 2016-12-08 | 2021-07-29 | Intellia Therapeutics Inc | Modified guide rnas |
| KR20230125856A (ko) | 2016-12-23 | 2023-08-29 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | Pcsk9의 유전자 편집 |
| EP3565608A4 (en) | 2017-01-05 | 2020-12-16 | Rutgers, The State University of New Jersey | TARGETED GENE EDITING PLATFORM INDEPENDENT OF BICATENARY DNA BREAKAGE AND ITS USES |
| WO2018152197A1 (en) | 2017-02-15 | 2018-08-23 | Massachusetts Institute Of Technology | Dna writers, molecular recorders and uses thereof |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11591589B2 (en) | 2017-04-21 | 2023-02-28 | The General Hospital Corporation | Variants of Cpf1 (Cas12a) with altered PAM specificity |
| WO2018213726A1 (en) | 2017-05-18 | 2018-11-22 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| EP3630849A4 (en) | 2017-05-25 | 2021-01-13 | The General Hospital Corporation | BIPARTITE BASIC EDITOR (BBE) AND TYPE II-C-CAS9 ZINC FINGER EDITOR ARCHITECTURES |
| KR102761791B1 (ko) | 2017-06-26 | 2025-02-05 | 더 브로드 인스티튜트, 인코퍼레이티드 | 표적화된 핵산 편집을 위한 crispr/cas-아데닌 데아미나아제 기반 조성물, 시스템 및 방법 |
| WO2019005886A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-CYTIDINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED EDITING OF NUCLEIC ACIDS |
| US10392616B2 (en) | 2017-06-30 | 2019-08-27 | Arbor Biotechnologies, Inc. | CRISPR RNA targeting enzymes and systems and uses thereof |
| CN111801345A (zh) | 2017-07-28 | 2020-10-20 | 哈佛大学的校长及成员们 | 使用噬菌体辅助连续进化(pace)的进化碱基编辑器的方法和组合物 |
| CA3073448A1 (en) | 2017-08-23 | 2019-02-28 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| EP3676376B1 (en) | 2017-08-30 | 2025-01-15 | President and Fellows of Harvard College | High efficiency base editors comprising gam |
| CN109957569B (zh) | 2017-12-22 | 2022-10-25 | 苏州齐禾生科生物科技有限公司 | 基于cpf1蛋白的碱基编辑系统和方法 |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| CA3108281A1 (en) | 2018-08-03 | 2020-02-06 | Beam Therapeutics Inc. | Multi-effector nucleobase editors and methods of using same to modify a nucleic acid target sequence |
| EP3841203A4 (en) | 2018-08-23 | 2022-11-02 | The Broad Institute Inc. | CAS9 VARIANTS WITH NON-CANONICAL PAM SPECIFICITIES AND THEIR USES |
| EP3847254A4 (en) | 2018-09-07 | 2022-08-10 | Beam Therapeutics Inc. | COMPOSITIONS AND METHODS FOR DELIVERING A NUCLEOBASE EDITING SYSTEM |
| EP3887521A1 (en) | 2018-11-29 | 2021-10-06 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| AU2020215730A1 (en) | 2019-01-31 | 2021-07-29 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| WO2020160517A1 (en) | 2019-01-31 | 2020-08-06 | Beam Therapeutics Inc. | Nucleobase editors having reduced off-target deamination and methods of using same to modify a nucleobase target sequence |
| US11946040B2 (en) | 2019-02-04 | 2024-04-02 | The General Hospital Corporation | Adenine DNA base editor variants with reduced off-target RNA editing |
| CN120174005A (zh) | 2019-02-13 | 2025-06-20 | 比姆医疗股份有限公司 | 具有用于修饰靶标序列中核碱基的腺苷脱氨酶碱基编辑器的经修饰的免疫细胞 |
| US20220098593A1 (en) | 2019-02-13 | 2022-03-31 | Beam Therapeutics Inc. | Splice acceptor site disruption of a disease-associated gene using adenosine deaminase base editors, including for the treatment of genetic disease |
| WO2020168088A1 (en) | 2019-02-13 | 2020-08-20 | Beam Therapeutics Inc. | Compositions and methods for treating glycogen storage disease type 1a |
| CA3128755C (en) | 2019-02-13 | 2024-06-04 | Beam Therapeutics Inc. | Compositions and methods for treating hemoglobinopathies |
| US20230140953A1 (en) | 2019-02-13 | 2023-05-11 | Beam Therapeutics Inc. | Methods of editing a disease-associated gene using adenosine deaminase base editors, including for the treatment of genetic disease |
| JP7693552B2 (ja) | 2019-02-13 | 2025-06-17 | ビーム セラピューティクス インク. | アデノシンデアミナーゼ塩基エディターおよびそれを用いて標的配列中の核酸塩基を改変する方法 |
| KR20210126680A (ko) | 2019-02-13 | 2021-10-20 | 빔 테라퓨틱스, 인크. | 알파-1 항트립신 결핍증을 치료하기 위한 조성물 및 방법 |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| KR102258713B1 (ko) | 2019-07-31 | 2021-05-31 | 한양대학교 산학협력단 | 사이토신 염기교정용 조성물 및 이의 용도 |
| AU2020344547A1 (en) | 2019-09-09 | 2022-03-24 | Beam Therapeutics Inc. | Novel nucleobase editors and methods of using same |
| AU2020466994A1 (en) | 2019-09-17 | 2022-04-21 | Rutgers, The State University Of New Jersey | Highly efficient DNA base editors mediated by RNA-aptamer recruitment for targeted genome modification and uses thereof |
| EP4051788A4 (en) | 2019-10-30 | 2023-12-06 | Pairwise Plants Services, Inc. | TYPE V CRISPR CAS BASE EDITORS AND METHODS OF USE THEREOF |
| US20230086199A1 (en) | 2019-11-26 | 2023-03-23 | The Broad Institute, Inc. | Systems and methods for evaluating cas9-independent off-target editing of nucleic acids |
| EP4100032B1 (en) | 2020-02-05 | 2025-10-15 | The Broad Institute, Inc. | Gene editing methods for treating spinal muscular atrophy |
| EP4100519A2 (en) | 2020-02-05 | 2022-12-14 | The Broad Institute, Inc. | Adenine base editors and uses thereof |
| JP2023517890A (ja) | 2020-03-04 | 2023-04-27 | スージョウ チー バイオデザイン バイオテクノロジー カンパニー リミテッド | 改善されたシトシン塩基編集システム |
| JP2023518395A (ja) | 2020-03-19 | 2023-05-01 | インテリア セラピューティクス,インコーポレイテッド | 指向性ゲノム編集のための方法及び組成物 |
| EP4132951A4 (en) | 2020-04-09 | 2025-06-11 | Verve Therapeutics, Inc. | CHEMICALLY MODIFIED GENE EDITING GUIDE RNAS WITH CAS12B |
| WO2022008935A1 (en) | 2020-07-10 | 2022-01-13 | Horizon Discovery Limited | Method for producing genetically modified cells |
| US20240247242A1 (en) | 2020-07-15 | 2024-07-25 | LifeEDIT Therapeutics, Inc. | Uracil stabilizing proteins and active fragments and variants thereof and methods of use |
| JP2023540797A (ja) | 2020-09-11 | 2023-09-26 | メタゲノミ,インコーポレイテッド | 塩基編集酵素 |
| MX2023002848A (es) | 2020-09-11 | 2023-03-22 | Lifeedit Therapeutics Inc | Enzimas modificadoras del acido desoxirribonucleico (adn) y fragmentos activos y sus variantes y metodos de uso. |
| IT202000028688A1 (it) | 2020-11-27 | 2022-05-27 | Consiglio Nazionale Ricerche | Varianti della citidina deaminasi per l’editazione di basi |
| CA3207144A1 (en) | 2021-01-05 | 2022-07-14 | Horizon Discovery Limited | Method for producing genetically modified cells |
| JP2024502348A (ja) | 2021-01-05 | 2024-01-18 | ホライズン・ディスカバリー・リミテッド | Tracr不含 V型Casシステム用のガイドRNAデザインおよび複合体 |
| WO2022150372A1 (en) | 2021-01-05 | 2022-07-14 | Horizon Discovery Ltd. | Guide rna designs and complexes for type v cas systems |
| CA3208612A1 (en) | 2021-02-19 | 2022-08-25 | Beam Therapeutics Inc. | Recombinant rabies viruses for gene therapy |
| EP4313118A4 (en) | 2021-03-26 | 2025-06-18 | Beam Therapeutics Inc. | ADENOSINE DEAMINASE VARIANTS AND THEIR USES |
| US20240327859A1 (en) | 2021-07-02 | 2024-10-03 | University Of Maryland, College Park | Cytidine deaminases and methods of genome editing using the same |
| CA3225808A1 (en) | 2021-07-16 | 2023-01-19 | David R. Liu | Context-specific adenine base editors and uses thereof |
| US20240352439A1 (en) | 2021-09-03 | 2024-10-24 | The University Of Chicago | Polypeptides and methods for modifying nucleic acids |
| IL311607A (en) | 2021-09-22 | 2024-05-01 | Verve Therapeutics Inc | PCSK9 or ANGPTL3 gene editing and preparations and methods for using them to treat the disease |
| US20230105319A1 (en) | 2021-09-24 | 2023-04-06 | Crispr Therapeutics Ag | PRODRUG INCORPORATED sgRNA SYNTHESIS |
| WO2023125814A1 (zh) | 2021-12-29 | 2023-07-06 | 华东师范大学 | 腺嘌呤脱氨酶及其应用 |
| CN119013310A (zh) | 2022-02-17 | 2024-11-22 | 正序(上海)生物科技有限公司 | 具有改善的编辑精确度的突变的胞嘧啶脱氨酶 |
| CN114634923B (zh) | 2022-04-07 | 2024-02-23 | 尧唐(上海)生物科技有限公司 | 腺苷脱氨酶、碱基编辑器融合蛋白、碱基编辑器系统及用途 |
| EP4532704A2 (en) | 2022-05-26 | 2025-04-09 | UCB Biopharma SRL | Novel nucleic acid-editing proteins |
| EP4540378A1 (en) | 2022-06-20 | 2025-04-23 | CRISPR Therapeutics AG | Base editing proteins and uses thereof |
| AU2023288909A1 (en) | 2022-06-23 | 2025-01-09 | Basf Agricultural Solutions Us Llc | Diversifying base editing |
| WO2024040083A1 (en) | 2022-08-16 | 2024-02-22 | The Broad Institute, Inc. | Evolved cytosine deaminases and methods of editing dna using same |
| KR20250075667A (ko) | 2022-09-23 | 2025-05-28 | 기초과학연구원 | 신규한 아데닌 탈아미노효소 변이체 및 이를 사용한 염기 교정 방법 |
| EP4594486A2 (en) | 2022-09-26 | 2025-08-06 | Beam Therapeutics Inc. | Synthetic polypeptides and uses thereof |
| WO2024179426A2 (en) | 2023-02-28 | 2024-09-06 | Accuredit Therapeutics (Suzhou) Co., Ltd. | Deaminases for use in base editing |
| EP4688814A1 (en) | 2023-04-27 | 2026-02-11 | University of Massachusetts | Cas-embedded cytidine deaminase ribonucleoprotein complexes having improved base editing specificity and efficiency |
| CN121079412A (zh) | 2023-04-28 | 2025-12-05 | 比姆医疗股份有限公司 | 经修饰的指导rna |
| AU2024303631A1 (en) | 2023-06-15 | 2025-12-11 | Beam Therapeutics Inc. | Methods and compositions for treating alpha-1 antitrypsin deficiency |
| CN117965505A (zh) | 2023-06-28 | 2024-05-03 | 微光基因(苏州)有限公司 | 工程化的腺苷脱氨酶及碱基编辑器 |
-
2020
- 2020-01-31 AU AU2020215730A patent/AU2020215730A1/en active Pending
- 2020-01-31 EP EP20748889.1A patent/EP3918078A4/en active Pending
- 2020-01-31 CA CA3127493A patent/CA3127493A1/en active Pending
- 2020-01-31 CN CN202080026678.0A patent/CN114040977B/zh active Active
- 2020-01-31 JP JP2021544294A patent/JP7646552B2/ja active Active
- 2020-01-31 US US17/427,410 patent/US12612618B2/en active Active
- 2020-01-31 KR KR1020217026724A patent/KR20210121113A/ko active Pending
- 2020-01-31 WO PCT/US2020/016285 patent/WO2020160514A1/en not_active Ceased
-
2025
- 2025-03-05 JP JP2025034660A patent/JP2025102784A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160304846A1 (en) * | 2013-12-12 | 2016-10-20 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US20180298421A1 (en) * | 2014-12-20 | 2018-10-18 | Identifygenomics, Llc | Compositions and methods for targeted depletion, enrichment, and partitioning of nucleic acids using crispr/cas system proteins |
| US20180179503A1 (en) * | 2016-12-23 | 2018-06-28 | President And Fellows Of Harvard College | Editing of ccr5 receptor gene to protect against hiv infection |
| WO2018176009A1 (en) * | 2017-03-23 | 2018-09-27 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable dna binding proteins |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3918078A4 * |
Cited By (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US12454694B2 (en) | 2018-09-07 | 2025-10-28 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| US12612618B2 (en) | 2019-01-31 | 2026-04-28 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| US12600971B2 (en) | 2019-02-13 | 2026-04-14 | Beam Therapeutics Inc. | Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence |
| US12594301B2 (en) | 2019-09-27 | 2026-04-07 | Beam Therapeutics Inc. | Compositions and methods for treatment of liquid cancers |
| US12454706B2 (en) | 2020-03-04 | 2025-10-28 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12157898B2 (en) | 2020-03-04 | 2024-12-03 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| WO2021222318A1 (en) | 2020-04-28 | 2021-11-04 | The Broad Institute, Inc. | Targeted base editing of the ush2a gene |
| JPWO2022050413A1 (https=) * | 2020-09-04 | 2022-03-10 | ||
| EP4209589A4 (en) * | 2020-09-04 | 2024-09-25 | National University Corporation Kobe University | Miniaturized cytidine deaminase-containing complex for modifying double-stranded dna |
| US12576151B2 (en) | 2020-09-25 | 2026-03-17 | Beam Therapeutics Inc. | Fratricide resistant modified immune cells and methods of using the same |
| WO2022120520A1 (en) * | 2020-12-07 | 2022-06-16 | Institute Of Zoology, Chinese Academy Of Sciences | Engineered cas effector proteins and methods of use thereof |
| CN112195164A (zh) * | 2020-12-07 | 2021-01-08 | 中国科学院动物研究所 | 工程化的Cas效应蛋白及其使用方法 |
| CN112195164B (zh) * | 2020-12-07 | 2021-04-23 | 中国科学院动物研究所 | 工程化的Cas效应蛋白及其使用方法 |
| EP4313118A4 (en) * | 2021-03-26 | 2025-06-18 | Beam Therapeutics Inc. | ADENOSINE DEAMINASE VARIANTS AND THEIR USES |
| WO2022204574A1 (en) * | 2021-03-26 | 2022-09-29 | Beam Therapeutics Inc. | Adenosine deaminase variants and uses thereof |
| JP2024514649A (ja) * | 2021-04-16 | 2024-04-02 | ビーム セラピューティクス インク. | 肝細胞の遺伝子修飾 |
| WO2023283092A1 (en) * | 2021-07-06 | 2023-01-12 | Prime Medicine, Inc. | Compositions and methods for efficient genome editing |
| US12123034B2 (en) | 2021-09-08 | 2024-10-22 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12037617B2 (en) | 2021-09-08 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12031162B2 (en) | 2021-09-08 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12024728B2 (en) | 2021-09-08 | 2024-07-02 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
Also Published As
| Publication number | Publication date |
|---|---|
| CN114040977A (zh) | 2022-02-11 |
| US20220098572A1 (en) | 2022-03-31 |
| EP3918078A1 (en) | 2021-12-08 |
| JP2025102784A (ja) | 2025-07-08 |
| CN114040977B (zh) | 2024-09-03 |
| US12612618B2 (en) | 2026-04-28 |
| EP3918078A4 (en) | 2022-12-14 |
| KR20210121113A (ko) | 2021-10-07 |
| JP2022519507A (ja) | 2022-03-24 |
| JP7646552B2 (ja) | 2025-03-17 |
| AU2020215730A1 (en) | 2021-07-29 |
| CA3127493A1 (en) | 2020-08-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12612618B2 (en) | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors | |
| AU2023229577B2 (en) | Compositions and methods for treating hemoglobinopathies | |
| AU2019336245B2 (en) | Compositions and methods for delivering a nucleobase editing system | |
| CN114026237B (zh) | 用于治疗1a型糖原贮积病的组成物和方法 | |
| US20220387622A1 (en) | Methods of editing a single nucleotide polymorphism using programmable base editor systems | |
| US20230101597A1 (en) | Compositions and methods for treating alpha-1 antitrypsin deficiency | |
| CA3108281A1 (en) | Multi-effector nucleobase editors and methods of using same to modify a nucleic acid target sequence | |
| CA3100019A1 (en) | Methods of substituting pathogenic amino acids using programmable base editor systems |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20748889 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3127493 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021544294 Country of ref document: JP Kind code of ref document: A Ref document number: 2020215730 Country of ref document: AU Date of ref document: 20200131 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20217026724 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020748889 Country of ref document: EP Effective date: 20210831 |