WO2020047299A1 - Multi-chain chimeric polypeptides and uses thereof - Google Patents

Multi-chain chimeric polypeptides and uses thereof Download PDF

Info

Publication number
WO2020047299A1
WO2020047299A1 PCT/US2019/048881 US2019048881W WO2020047299A1 WO 2020047299 A1 WO2020047299 A1 WO 2020047299A1 US 2019048881 W US2019048881 W US 2019048881W WO 2020047299 A1 WO2020047299 A1 WO 2020047299A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acids
cell
chimeric polypeptide
domain
receptor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/048881
Other languages
English (en)
French (fr)
Inventor
Hing Wong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
HCW Biologics Inc
Original Assignee
HCW Biologics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP25208349.8A priority Critical patent/EP4659757A3/en
Priority to CN201980070927.3A priority patent/CN112996805A/zh
Priority to NZ772550A priority patent/NZ772550B2/en
Priority to SG11202101779RA priority patent/SG11202101779RA/en
Priority to AU2019328290A priority patent/AU2019328290B2/en
Priority to IL280918A priority patent/IL280918B2/en
Priority to KR1020257035341A priority patent/KR20250160211A/ko
Priority to JP2021535496A priority patent/JP7397874B2/ja
Priority to EP19766444.4A priority patent/EP3844181B1/en
Application filed by HCW Biologics Inc filed Critical HCW Biologics Inc
Priority to CA3108949A priority patent/CA3108949A1/en
Priority to KR1020217009434A priority patent/KR102877278B1/ko
Publication of WO2020047299A1 publication Critical patent/WO2020047299A1/en
Anticipated expiration legal-status Critical
Priority to JP2023203880A priority patent/JP7735373B2/ja
Priority to AU2024287134A priority patent/AU2024287134A1/en
Priority to JP2025141061A priority patent/JP2025172844A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5418IL-7
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/745Blood coagulation or fibrinolysis factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/36Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/32Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present disclosure relates to the field of biotechnology, and more specifically, to antigen-binding molecules.
  • Tissue factor a 263 amino acid integral membrane glycoprotein with a molecular weight of ⁇ 46 kDa and the trigger protein of the extrinsic blood coagulation pathway, is the primary initiator of coagulation in vivo.
  • Tissue factor normally not in contact with circulating blood, initiates the coagulation cascade upon exposure to the circulating coagulation serine protease factors.
  • Vascular damage exposes sub-endothelial cells expressing tissue factor, resulting in the formation of a calcium-dependent, high- affinity complex with pre-existing plasma factor Vila (FVIIa). Binding of the serine protease FVIIa to tissue factor promotes rapid cleavage of FX to FXa and FIX to FIXa.
  • the proteolytic activity of the resulting FXa and an active membrane surface then inefficiently converts a small amount of prothrombin to thrombin.
  • the thrombin generated by FXa initiates platelet activation and activates minute amounts of the pro- cofactors factor V (FV) and factor VIII (FVIII) to become active cofactors, factor Va (FVa) and factor Villa (FVIIIa).
  • FV pro- cofactors factor V
  • FVIII factor VIII
  • FXa complexes with FVa to form the pro-thrombinase complex on the activated platelet surface which results in rapid cleavage of prothrombin to thrombin.
  • tissue factor-FVIIa complex can activate FVIII, which would provide additional levels of FVIIIa during the initiation phase.
  • the extrinsic pathway is paramount in initiating coagulation via the activation of limited amounts of thrombin, whereas the intrinsic pathway maintains coagulation by dramatic amplification of the initial signal.
  • the present invention is based on the discovery that soluble tissue factor can be used as a scaffold for chimeric polypeptides including an antigen-binding domain.
  • multi-chain chimeric polypeptides that include: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a soluble tissue factor domain; and (iii) a first domain of a pair of affinity domains; and (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • compositions that include any of the multi-chain chimeric polypeptides described herein, nucleic acids that encode any of the multi-chain chimeric polypeptides described herein, and cells that include any of the nucleic acids that encode any of the multi-chain chimeric polypeptides described herein. Also provided herein are methods of stimulating an immune cell and methods of treating a subject in need thereof that include the use of any of the multi-chain chimeric polypeptides described herein. Also provided herein are methods of producing any of the multi-chain chimeric polypeptides described herein.
  • a multi-chain chimeric polypeptide comprising: (a) a first chimeric polypeptide comprising:
  • first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
  • the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further comprises a linker sequence between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments, the first target-binding domain and the second target-binding domain comprise the same amino acid sequence. In some embodiments, the first target-binding domain and the second target-binding domain bind specifically to different antigens. In some embodiments, one or both of the first target-binding domain and the second target-binding domain is an antigen-binding domain. In some
  • the first target-binding domain and the second target-binding domain are each antigen-binding domains.
  • the antigen-binding domain comprises a scFv or a single domain antibody.
  • one or both of the first target-binding domain and the second target-binding domain bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, IGF- 1R, MUC4AC, MUC5AC, Trop-2, CMET, EGFR, HER1, HER2, HER3, PSMA, CEA, B7H3, EPCAM, BCMA, P-
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, a soluble cytokine protein, or a ligand protein.
  • the soluble interleukin, soluble cytokine, or ligand protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL- 12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, and FLT3L.
  • the first target-binding domain and the second target-binding domain is a soluble interleukin, a cytokine receptor, or a soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF ⁇ RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF ⁇ RIII a soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII,
  • the first chimeric polypeptide further comprises one or more additional target-binding domain(s), where at least one of the one or more additional antigen-binding domain(s) is positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further comprises a linker sequence between the soluble tissue factor domain and the at least one of the one or more additional antigen-binding domain(s), and/or a linker sequence between the at least one of the one or more additional antigen-binding domain(s) and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further comprises one or more additional target-binding domains at the N-terminal and/or C-terminal end of the first chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains in the first chimeric polypeptide. In some embodiments, the first chimeric polypeptide further comprises a linker sequence between the at least one of the one or more additional target-binding domains and the first domain of the pair of affinity domains. In some embodiments, the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence between the at least one of the one or more additional target-binding domains and the first target-binding domain.
  • at least one of the one or more additional target-binding domains is disposed at the N- and/or C-terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains is positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence disposed between the at least one additional target-binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target- binding domains disposed at the C-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence disposed between the at least one additional target-binding domain and the first target- binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one of the one or more additional target- binding domains positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains directly abuts the soluble tissue factor domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further comprises a linker sequence disposed (i) between the soluble tissue factor domain and the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains, and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains.
  • the second chimeric polypeptide further comprises one or more additional target-binding domains at the N-terminal end or the C-terminal end of the second chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains in the second chimeric polypeptide. In some embodiments, the second chimeric polypeptide further comprises a linker sequence between at least one of the one or more additional target-binding domains and the second domain of the pair of affinity domains in the second chimeric polypeptide.
  • the second chimeric polypeptide further comprises a linker sequence between at least one of the one or more additional target-binding domains and the second target-binding domain in the second chimeric polypeptide.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains comprise the same amino acid sequence. In some embodiments, the first target-binding domain, the second target- binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each comprise the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain.
  • antigen-binding domain comprises a scFv.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, IGF-1R, MUC4AC, MUC5AC, Trop-2, CMET, EGFR, HER1, HER2, HER3, PS
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, a soluble cytokine protein, or a ligand protein.
  • the soluble interleukin, soluble cytokine, or ligand protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-l 7, IL-18, IL-21, PDGF-DD, SCF, and FLT3L.
  • one or more of the first target binding domain, the second target-binding domain, and the one or more additional target- binding domains is a soluble interleukin or cytokine receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF ⁇ RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble
  • the first chimeric polypeptide further comprises a peptide tag at the N-terminal end or the C-terminal end of the first chimeric polypeptide.
  • the second chimeric polypeptide further comprises a peptide tag at the N-terminal end or the C-terminal end of the second chimeric polypeptide.
  • the soluble tissue factor domain is a soluble human tissue factor domain.
  • the soluble human tissue factor domain comprises a sequence that is at least 80% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain comprises a sequence that is at least 90% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 95% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain does not comprise one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalan
  • the soluble human tissue factor domain does not comprise any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some embodiments, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the multi-chain chimeric polypeptide does not stimulate blood coagulation in a mammal. In some embodiments of any of the single-chain chimeric polypeptides provided herein, the human soluble tissue factor domain does not initiate blood coagulation. In some embodiments of any of the single-chain chimeric polypeptides provided herein, the soluble tissue factor domain comprises or consists of a soluble wildtype human tissue factor.
  • the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) and a soluble IL-15.
  • the soluble IL15 has a D8N or D8A amino acid substitution.
  • the human ILl5Ra is a mature full-length ILl5Ra.
  • the pair of affinity domains is selected from the group consisting of: barnase and barnstar, a PKA and an AKAP, adapter/docking tag modules based on mutated RNase I fragments, and SNARE modules based on interactions of the proteins syntaxin, synaptotagmin, synaptobrevin, and SNAP25.
  • the first chimeric polypeptide and/or the second chimeric polypeptide further comprises a signal sequence at its N- terminal end.
  • the multi-chain chimeric polypeptide comprises a composition.
  • the composition is a pharmaceutical composition.
  • the composition comprises at least one dose of the multi-chain chimeric polypeptide.
  • a kit comprises at least one dose of the composition.
  • provided herein is a method of stimulating an immune cell, the method comprising: contacting an immune cell with an effective amount of any of the multi-chain chimeric polypeptides or compositions described above.
  • the method comprises contacting the immune cell in vitro. In some embodiments, the method comprises obtaining the immune cell from a subject. In some embodiments, the method comprises obtaining the immune cell from the subject prior to the contacting step. In some embodiments, the method comprises contacting the immune cell in vivo.
  • the method comprises selecting the immune cell from the group consisting of: an immature thymocyte, a peripheral blood lymphocyte, a naive T cell, a pluripotent Th cell precursor, a lymphoid progenitor cell, a Treg cell, a memory T cell, a Thl7 cell, a Th22 cell, a Th9 cell, a Th2 cell, a Thl cell, a Th3 cell, gd T cell, an ab T cell, a tumor-infiltrating T cell, a CD8 + T cell, a CD4 + T cell, a natural killer T cell, a mast cell, a macrophage, a neutrophil, a dendritic cell, a basophil, an eosinophil, and a natural killer cell.
  • the immune cell from the group consisting of: an immature thymocyte, a peripheral blood lymphocyte, a naive T cell, a pluripotent Th cell precursor, a lymphoid
  • the method comprises genetically modifying the immune cell to express a chimeric antigen receptor or a recombinant T-cell receptor. In some embodiments, the method comprises introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a
  • the method comprises administering the immune cell to a subject in need thereof.
  • the method comprises identifying or diagnosing the subject as having an age-related disease or condition.
  • the age-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’
  • the method comprises identifying or diagnosing the subject as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • a method of inducing or increasing proliferation of an immune cell comprising: contacting an immune cell with an effective amount of any of the multi-chain chimeric polypeptides or compositions described above.
  • the method comprises contacting the immune cell in vitro.
  • the method comprises obtaining the immune cell from a subject.
  • the method comprises obtaining the immune cell from the subject prior to the contacting step. In some embodiments, the method comprises contacting the immune cell in vivo. In some embodiments, the method comprises selecting the immune cell from the group consisting of: an immature thymocyte, a peripheral blood
  • lymphocyte a naive T cell, a pluripotent Th cell precursor, a lymphoid progenitor cell, a Treg cell, a memory T cell, a Thl7 cell, a Th22 cell, a Th9 cell, a Th2 cell, a Thl cell, a Th3 cell, gd T cell, an ab T cell, a tumor-infiltrating T cell, a CD8 + T cell, a CD4 + T cell, a natural killer T cell, a mast cell, a macrophage, a neutrophil, a dendritic cell, a basophil, an eosinophil, and a natural killer cell.
  • the method comprises modifying the immune cell to express a chimeric antigen receptor or a recombinant T-cell receptor. In some embodiments, the method further comprises introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor after the contacting step. In some embodiments, the method further comprises administering the immune cell to a subject in need thereof. In some embodiments, the method comprises identifying or diagnosing the subject as having an age-related disease or condition.
  • the age-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease
  • the method comprises identifying or diagnosing the subject as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and
  • the method comprises diagnosing or identifying the subject as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • Also provided herein is a method of inducing differentiation of an immune cell into a memory or memory-like immune cell comprising: contacting an immune cell with an effective amount of any of the multi-chain chimeric polypeptides or compositions discussed above.
  • the method comprises contacting the immune cell in vitro.
  • the method comprises obtaining the immune cell from a subject.
  • the method further comprises obtaining the immune cell from the subject prior to the contacting step.
  • the method comprises contacting the immune cell in vivo.
  • the immune cell is selected from the group consisting of: an immature thymocyte, a peripheral blood lymphocyte, a naive T cell, a pluripotent Th cell precursor, a lymphoid progenitor cell, a Treg cell, a Thl7 cell, a Th22 cell, a Th9 cell, a Th2 cell, a Thl cell, a Th3 cell, gd T cell, an ab T cell, a tumor-infiltrating T cell, a CD8+ T cell, a CD4+ T cell, a natural killer T cell, a mast cell, a macrophage, a neutrophil, a dendritic cell, a basophil, an eosinophil, and a natural killer cell.
  • an immature thymocyte a peripheral blood lymphocyte, a naive T cell, a pluripotent Th cell precursor, a lymphoid progenitor cell, a Treg cell, a Thl7 cell,
  • the immune cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor.
  • the method further comprises introducing into the immune cell a nucleic acid encoding a chimeric antigen- receptor or a recombinant T-cell receptor after the contacting step.
  • the method further comprises administering the immune cell to a subject in need thereof.
  • the method comprises identifying or diagnosing the subject as having an age-related disease or condition.
  • the age- related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular de
  • the method comprises identifying or diagnosing the subject as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorec
  • the method comprises diagnosing or identifying the subject as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • Also provided herein is a method of killing a cancer cell, an infected cell, or a senescent cell in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any of the multi-chain chimeric
  • the method comprises identifying or diagnosing the subject as having a cancer. In some embodiments, the method comprises identifying or diagnosing the subject as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorectal cancer, prostate
  • the method comprises identifying or diagnosing the subject as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis
  • the method comprises administering to the subject a therapeutically effective amount of any of the multi-chain chimeric polypeptides or compositions discussed above.
  • the method comprises identifying or diagnosing the subject as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS),
  • CLL chronic lymphocytic le
  • the method comprises identifying or diagnosing the subject as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • a nucleic acid encoding any of the multi-chain chimeric polypeptides discussed above.
  • Some embodiments comprise vector containing any of the nucleic acids discussed above.
  • the vector is an expression vector.
  • Some embodiments comprise a cell containing any of the nucleic acids discussed above.
  • Also provided herein is a method of producing a multi-chain chimeric
  • the method comprising: culturing the cell discussed above in a culture medium under conditions sufficient to result in the production of the multi-chain chimeric polypeptide; and recovering the multi-chain chimeric polypeptide from the cell and/or the culture medium.
  • the method comprises producing a multi-chain chimeric polypeptide by the methods discussed above.
  • the mutant soluble human tissue factor domain comprises a sequence that is at least 80% identical to SEQ ID NO: 3. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 90% identical to SEQ ID NO: 3. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 95% identical to SEQ ID NO: 3. In some embodiments, the multi-chain chimeric polypeptide of claim 140, wherein the soluble human tissue factor domain comprises a sequence that is 100% identical to SEQ ID NO: 3. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 80% identical to SEQ ID NO: 4. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 90% identical to SEQ ID NO: 4. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 95% identical to SEQ ID NO:4. In some embodiments, the soluble human tissue factor domain comprises a sequence that is 100% identical to SEQ ID NO: 4.
  • a chimeric polypeptide refers to a polypeptide that includes amino acid sequences (e.g., domains) originally derived from two different sources (e.g., two different naturally-occurring proteins, e.g., from the same or different species).
  • a chimeric polypeptide can include domains from at least two different naturally occurring human proteins.
  • a chimeric polypeptide can include a domain that is a synthetic sequence (e.g., an scFv) and a domain that is derived from a naturally-occurring protein (e.g., a naturally-occurring human protein).
  • a chimeric polypeptide can include at least two different domains that are synthetic sequences (e.g., two different scFvs).
  • an“antigen-binding domain” is one or more protein domain(s) (e.g., formed from amino acids from a single polypeptide or formed from amino acids from two or more polypeptides (e.g., the same or different polypeptides) that is capable of specifically binding to one or more different antigen(s).
  • an antigen-binding domain can bind to an antigen or epitope with specificity and affinity similar to that of naturally-occurring antibodies.
  • the antigen-binding domain can be an antibody or a fragment thereof.
  • an antigen-binding domain can include an alternative scaffold. Non-limiting examples of antigen-binding domains are described herein. Additional examples of antigen-binding domains are known in the art.
  • A“soluble tissue factor domain” refers to a polypeptide having at least 70% identity (e.g., at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 99% identity, or 100% identical) to a segment of a wildtype mammalian tissue factor protein (e.g., a wildtype human tissue factor protein) that lacks the transmembrane domain and the intracellular domain.
  • soluble tissue factor domains are described herein.
  • soluble interleukin protein is used herein to refer to a mature and secreted interleukin protein or a biologically active fragment thereof.
  • a soluble interleukin protein can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to a wildtype mature and secreted mammalian interleukin protein (e.g., a wildtype human interleukin protein) and retains its biological activity.
  • soluble interleukin proteins are described herein.
  • soluble cytokine protein is used herein to refer to a mature and secreted cytokine protein or a biologically active fragment thereof.
  • a soluble cytokine protein can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to a wildtype mature and secreted mammalian interleukin protein (e.g., a wildtype human interleukin protein) and retains its biological activity.
  • soluble cytokine proteins are described herein.
  • soluble interleukin receptor is used herein in the broadest sense to refer to a polypeptide that lacks a transmembrane domain (and optionally an intracellular domain) that is capable of binding one or more of its natural ligands (e.g., under physiological conditions, e.g., in phosphate buffered saline at room temperature).
  • a soluble interleukin receptor can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to an extracellular domain of wildtype interleukin receptor and retains its ability to specifically bind to one or more of its natural ligands, but lacks its transmembrane domain (and optionally, further lacks its intracellular domain).
  • soluble interleukin receptors are described herein.
  • soluble cytokine receptor is used herein in the broadest sense to refer to a polypeptide that lacks a transmembrane domain (and optionally an intracellular domain) that is capable of binding one or more of its natural ligands (e.g., under physiological conditions, e.g., in phosphate buffered saline at room temperature).
  • a soluble cytokine receptor can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to an extracellular domain of wildtype cytokine receptor and retains its ability to specifically bind to one or more of its natural ligands, but lacks its transmembrane domain (and optionally, further lacks its intracellular domain).
  • soluble cytokine receptors are described herein.
  • antibody is used herein in its broadest sense and includes certain types of immunoglobulin molecules that include one or more antigen-binding domains that specifically bind to an antigen or epitope.
  • An antibody specifically includes, e.g., intact antibodies (e.g., intact immunoglobulins), antibody fragments, and multi-specific antibodies.
  • an antigen-binding domain is an antigen-binding domain formed by a VH -VL dimer. Additional examples of an antibody are described herein. Additional examples of an antibody are known in the art.
  • affinity refers to the strength of the sum total of non-covalent interactions between an antigen-binding site and its binding partner (e.g., an antigen or epitope). Unless indicated otherwise, as used herein,“affinity” refers to intrinsic binding affinity, which reflects a 1 : 1 interaction between members of an antigen-binding domain and an antigen or epitope.
  • the affinity of a molecule X for its partner Y can be represented by the dissociation equilibrium constant (KD).
  • KD dissociation equilibrium constant
  • the kinetic components that contribute to the dissociation equilibrium constant are described in more detail below.
  • Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®).
  • a pair of affinity domains can be a pair of naturally-occurring proteins.
  • a pair of affinity domains can be a pair of synthetic proteins. Non limiting examples of pairs of affinity domains are described herein.
  • epitope means a portion of an antigen that specifically binds to an antigen-binding domain.
  • Epitopes can, e.g., consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non- conformational epitopes are distinguished in that the binding to the former but not the latter may be lost in the presence of denaturing solvents.
  • An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. Methods for identifying an epitope to which an antigen-binding domain binds are known in the art.
  • An“immune effector cell” refers to a cell of the immune system of a mammal that is capable, directly or indirectly, of recognizing and/or causing cytostasis or cell death of a pathogenic cell (e.g., a cancer cell) in the mammal.
  • a pathogenic cell e.g., a cancer cell
  • immune effector cells include macrophages, T-lymphocytes (e.g., cytotoxic T- lymphocytes and T-helper cells), natural killer cells, neutrophils, monocytes, and eosinophils. Additional examples of immune effector cells are known in the art.
  • treatment means to ameliorate at least one symptom of a disorder.
  • the disorder being treated is cancer and to ameliorate at least one symptom of cancer includes reducing aberrant proliferation, gene expression, signaling, translation, and/or secretion of factors.
  • the methods of treatment include administering a therapeutically effective amount of composition that reduces at least one symptom of a disorder to a subject who is in need of, or who has been determined to be in need of such treatment.
  • Figure 1 shows exemplary diagrams for a multi-chain chimeric polypeptide: (i) a first chimeric polypeptide including a first target-binding domain (A), a soluble tissue factor domain, a first domain of an affinity pair of domains (soluble interleukin IL-15), and an additional target-binding domain (B); and (ii) second chimeric polypeptide including a second domain of an affinity pair of domains (IL-15 receptor alpha sushi domain), a second target-binding domain (C), and an additional antigen-binding domain (D).
  • the top cartoon diagram depicts the association of the first and the second chimeric polypeptides through the pair of affinity domains.
  • the bottom schematic diagrams show the order of the domains in the first and second chimeric polypeptides.
  • Figure 2 shows exemplary diagrams for a multi-chain chimeric polypeptide: (i) a first chimeric polypeptide including a first target-binding domain (A), a soluble tissue factor domain including five amino acid substitutions in order to remove binding of the soluble tissue factor domain to FVIIa, a first domain of an affinity pair of domains (soluble interleukin IL-15 including a D8N or D8A amino acid substitution), and an additional target-binding domain (B); and (ii) second chimeric polypeptide including a second domain of an affinity pair of domains (IL-15 receptor alpha sushi domain), a second target-binding domain (C), and an additional antigen-binding domain (D).
  • A first target-binding domain
  • soluble tissue factor domain including five amino acid substitutions in order to remove binding of the soluble tissue factor domain to FVIIa
  • a first domain of an affinity pair of domains soluble interleukin IL-15 including a D8N or D8A amino acid substitution
  • B additional
  • the top cartoon diagram depicts the association of the first and the second chimeric polypeptides through the pair of affinity domains.
  • the bottom schematic diagrams show the order of the domains in the first and second chimeric polypeptides.
  • the soluble tissue factor domain can comprise or consists of a soluble wildtype human tissue factor domain (comprising or consisting of a contiguous sequence within wildtype human tissue factor).
  • Figure 3 shows a schematic diagram of an exemplary IL-l2/IL-l5RaSu DNA construct.
  • Figure 4 shows a schematic diagram of an exemplary IL-18/TF/IL-15 DNA construct.
  • Figure 5 shows a schematic diagram of the interaction between the exemplary IL- l2/IL-l5RaSu and IL-18/TF/IL-15 DNA constructs.
  • Figure 6 shows a schematic diagram of the interaction between the exemplary IL- l2/IL-l5RaSu and IL-18/TF/IL-15 fusion proteins resulting in IL-18/TF/IL-15TL-12/IL- l5RaSu complex (l8tl5-l2s).
  • Figure 7 shows a chromatograph of l8tl5-l2s purification elution from an anti-
  • Figure 8 shows an exemplary chromatographic profile of anti-TF Ab / SEC- purified 18tl 5-l2s protein following elution on an analytical size exclusion column, demonstrating separation of monomeric multiprotein l8tl5-l2s complexes from protein aggregates.
  • Figure 9 shows an example of a 4-12% SDS-PAGE of the 18tl 5-l2s complex following disulfide bond reduction.
  • Lane 1 SeeBlue Plus2 marker
  • Lane 2 an anti-tissue factor antibody affinity column-purified l8tl5-l2s (0.5 pg)
  • Lane 3 an anti-tissue factor antibody affinity column-purified 18tl 5-l2s (1 pg).
  • Figure 10 shows SDS PAGE analysis of deglycosylated and non-deglycosylated l8tl5-l2s.
  • Lane 1 an anti-tissue factor antibody affinity column-purified 18tl 5-l2s (0.5 pg), non-deglycosylated;
  • Lane 2 anti-TF Ab-purified l8tl5-l2s (1 pg), non- deglycosylated;
  • Lane 3 l8tl5-l2s (1 pg), deglycosylated, Lane 4: Markl2 unstained maker.
  • Figure 11 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-12 detection antibody (BAF 219).
  • Figure 12 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-15 detection antibody (BAM 247).
  • Figure 13 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-18 detection antibody (D045-6).
  • Figure 14 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor (143) capture antibody and an anti-human tissue factor detection antibody.
  • Figure 15 shows proliferation of IL- 15 -dependent 32 ⁇ b cells mediated by the l8tl5-l2s complex (open squares) and recombinant IL-15 (black squares).
  • Figure 16 shows biological activity of IL-18 within the l8tl5-l2s complex (open squares), where recombinant IL-18 (black squares) and recombinant IL-12 (black circles) serve as positive and negative controls, respectively.
  • Figure 17 shows biological activity of IL-12 within the l8tl5-l2s complex (open squares), where recombinant IL-12 (black circles) and recombinant IL-18 (open squares) serve as positive and negative controls, respectively.
  • Figures 18A and 18B show cell-surface expression of CD25 on NK cells induced by the l8tl5-l2s complex and cell-surface CD69 expression of NK cells induced by the l8tl5-l2s complex.
  • Figure 19 shows a flow cytometry graph of intracellular interferon gamma expression of NK cells induced by the l8tl5-l2s complex.
  • Figure 20 shows cytotoxicity of 18tl 5-l2s induced human NK cells against K562 cells.
  • Figure 21 shows a schematic diagram of an exemplary IL-l2/IL-l5RaSu/aCDl6 DNA construct.
  • Figure 22 shows a schematic diagram of an exemplary IL-18/TF/IL-15 DNA construct.
  • Figure 23 shows a schematic diagram of the interaction between the exemplary
  • Figure 24 shows a schematic diagram of an exemplary l8tl5-l2s/aCDl6 protein complex.
  • Figure 25 shows a sandwich ELISA for the l8tl5-l2sl6 complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-12 or IL-18 detection antibody.
  • Figure 26 shows a schematic diagram of an exemplary TGF RII/IL- 15RaSu DNA construct.
  • Figure 27 shows a schematic diagram of an exemplary IL-21/TF/IL-15 construct.
  • Figure 28 shows a schematic diagram of the interaction between the exemplary
  • Figure 29 shows a schematic diagram of the interaction between the exemplary TGF RII/IL- l 5RaSu and IL-21/TF/IL-15 fusion proteins, resulting in an IL-21/TF/IL- l5/TGF RII/IL-l5RaSu complex (2ltl5-TGFRs).
  • Figure 30 shows a chromatograph of 2ltl5-TGFRs purification elution from an anti-TF antibody affinity column.
  • Figure 31 shows an exemplary 2ltl5-TGFRs size exclusion chromatograph showing a main protein peak and a high molecular weight peak
  • Figure 32 shows an example of a 4-12% SDS-PAGE of the 2ltl5-TGFRs complex following disulfide bond reduction.
  • Lane 1 Markl2 unstained marker (numbers on the left side indicate molecular weights in kDa);
  • Lane 2 2ltl5-TGFRs (0.5 pg);
  • Lane 3 2ltl5-TGFRs (1 pg);
  • Lane 4 2ltl5-TGFRs, deglycosylated (1 pg), wherein the MW was the expected size of 53kDa and 39.08 kDa.
  • Figure 33 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-21 detection antibody (13-7218-81, BioLegend).
  • Figure 34 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-15 detection antibody (BAM 247, R&D Systems).
  • Figure 35 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human TGF RII detection antibody (BAF241, R&D Systems).
  • Figure 36 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor (143) capture antibody and an anti-human tissue factor detection antibody.
  • Figure 37 shows IL- 15 -dependent proliferation of 32 ⁇ b cells mediated by the
  • Figure 38 shows biological activity of the TGFpRII domain within the 2ltl 5- TGFRs complex (open squares). TGFpRII/Fc (black squares) served as a positive control.
  • Figure 39 A shows a flow cytometry graph of cell-surface CD25 expression of
  • NK cells induced by the 2ltl5-TGFRs complex NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 40 shows a flow cytometry graph of cell-surface CD69 expression of NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 41 shows a flow cytometry graph of intracellular interferon gamma expression of NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 42 shows cytotoxicity of 2ltl5-TGFRs-induced human NK cells against K562 cells.
  • Figure 43 shows a schematic diagram of an exemplary IL-7/IL-l5RaSu DNA construct.
  • Figure 44 shows a schematic diagram of an exemplary IL-21/TF/IL-15 DNA construct.
  • Figure 45 shows a schematic diagram of the interaction between the exemplary IL-7/IL-l5RaSu and IL-21/TF/IL-15 DNA constructs.
  • Figure 46 shows a schematic diagram of the interaction between the exemplary IL-7/IL-l5RaSu and IL-21/TF/IL-15 fusion proteins resulting in an IL-2l/TF/IL-l5:IL- 7/IL-l5RaSu complex (2ltl5-7s).
  • Figure 47 shows the expansion of primary natural killer (NK) cells by stimulation with 2ltl5-7s + anti-TF IgGl antibody.
  • Figure 48 shows activation of expanded primary NK cells, using CD25 MFI and CD69 MFI as markers of NK cell activation.
  • Figure 49 shows cytotoxic activity of expanded NK cells against K562 human tumor cells, wherein NK cells stimulated with 2ltl5-7s + anti-TF IgGl antibody demonstrate greater specific lysis of K562 cells than NK cells not stimulated with 2ltl 5- 7s + anti-TF IgGl antibody.
  • Figure 50 shows a schematic diagram of an exemplary IL-2l/IL-l5RaSu DNA construct.
  • Figure 51 shows a schematic diagram of an exemplary IL-7/TF/IL-15 DNA construct.
  • Figure 52 shows a schematic diagram of the interaction between the exemplary IL-2l/IL-l5RaSu and IL-7/TF/IL-15 DNA constructs.
  • Figure 53 shows a schematic diagram of the interaction between the exemplary IL-2l/IL-l5RaSu and IL-7/TF/IL-15 fusion proteins resulting in an IL-7/TF/IL-15TL- 2l/IL-l5RaSU complex (7tl5-2ls).
  • Figure 54 shows in diagrammatic form the activation and expansion of primary natural killer (NK) cells by stimulation with 2ltl5-TGFRs + anti-TF IgGl antibody.
  • Figure 55 shows size exclusion chromatography (SEC) profiles of anti-TF IgGl antibody, 7tl 5-21 s and the complex containing equal amounts of anti-TF IgGl antibody and 7tl5-2ls.
  • SEC size exclusion chromatography
  • Figure 56 shows the oxygen consumption rate (OCR) in pmoles/min for human NK cells isolated from blood (2 x 10 6 cells/mL) of two different donors.
  • FIG 57 shows the extracellular acidification rate (ECAR)
  • Figure 58 shows a schematic of the 7tl5-l6s2l construct.
  • Figure 59 shows an additional schematic of the 7tl5-l6s2l construct.
  • Figures 60A and 60B show binding of 7tl5-l6s2l to CHO cells expressing human CDl6b as compared to a control protein.
  • Figures 61A-61C are results from ELISA experiments using antibodies against IL-15, IL-21, and IL-7 in detecting 7tl 5- 16s21.
  • Figure 62 shows results of the 32 ⁇ b cell proliferation assay with 7tl5-l6s2l or recombinant IL- 15.
  • Figure 63 shows the chromatographic profile of 7tl5-l6s2l protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 64 shows the analytical SEC Profile of 7tl5-l6s2l.
  • Figure 65 shows a schematic of the TGFRtl5-l6s2l construct.
  • Figure 66 shows an additional schematic of the TGFRtl5-l6s2l construct.
  • Figures 67A and 67B show binding affinity of TGFRtl5-l6S2l and 7tl 5-21 s with CHO cells expressing human CDl6b.
  • Figure 67A shows binding affinity of TGFRtl5- 16S21 with CHO cells expressing human CDl6b.
  • Figure 67B shows binding affinity of 7tl 5-21 s with CHO cells expressing human CDl6b.
  • Figure 68 shows results of TGF l inhibition by TGFRtl5-l6s2l and TGFR-Fc.
  • Figure 69 shows results of 32 ⁇ b cell proliferation assay with TGFRtl5-l6s2l or recombinant IL- 15.
  • Figures 70A-70C show results of detecting IL-15, IL-21, and TORbIHI in TGFRtl5-l6s2l with corresponding antibodies using ELISA.
  • Figure 71 shows the chromatographic profile of TGFRtl5-l6s2l protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 72 shows results of a reduced SDS-PAGE analysis of TGFRtl5-l6s2l.
  • Figure 73 shows a schematic of the 7tl5-7s construct.
  • Figure 74 shows an additional schematic of the 7tl5-7s construct.
  • Figure 75 shows the chromatographic profile of 7tl5-7s protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 76 shows detection of TF, IL-15 and IL-7 in 7tl5-7s using ELISA.
  • Figure 77 shows a schematic of the TGFRtl5-TGFRs construct.
  • Figure 78 shows an additional schematic of the TGFRtl5-TGFRs construct.
  • Figure 79 shows results of TGF l inhibition by TGFRtl5-TGFRs and TGFR-Fc.
  • Figure 80 shows results of 32 ⁇ b cell proliferation assay with TGFRtl5-TGFRs or recombinant IL-15
  • Figures 81 A and 81B show results of detecting IL-15 and TGF RII in TGFRtl 5-
  • Figure 82 is a line graph showing the chromatographic profile of TGFRtl 5- TGFRs protein containing cell culture supernatant following binding and elution on anti- TF antibody resin.
  • Figure 83 shows the analytical SEC profile of TGFRtl5-TGFRs.
  • Figure 84 shows TGFR.t.15-TGFRs before and after deglycosylation as analyzed by reduced SDS-PAGE.
  • Figures 85 A and 85B show spleen weight and the percentages of immune cell types in TGFRtl5-TGFRs-treated and control -treated mice.
  • Figure 85 A shows spleen weight in mice treated with TGFRtl 5-TGFRs as compared to PBS control.
  • Figure 85B shows the percentage of CD4 + T cells, CD8 + T cells, and NK cells in mice treated with TGFRtl 5-TGFRs as compared to PBS control.
  • Figure 86A and 86B show the spleen weight and immunostimulation over 92 hours in mice treated with TGFRtl 5-TGFRs.
  • Figure 86A shows spleen weight of mice treated with TGFRtl 5-TGFRs at 16, 24, 48, 72, and 92 hours after treatment.
  • Figure 86B shows the percentages of immune cells in mice treated with TGFRtl5-TGFRs at 16, 24, 48, 72, and 92 hours after treatment.
  • Figure 87A and 87B show Ki67 and Granzyme B expression in mice treated with TGFRtl5-TGFRs over time.
  • Figure 88 shows enhancement of cytotoxicity of splenocytes by TGFRtl5-TGFRs in C57BL/6 Mice.
  • Figure 89 shows changes in tumor size in response to PBS treatment
  • Figure 90 shows the cytotoxicity of NK cells isolated from mice treated with
  • Figure 91 shows a schematic of the 7tl5-2lsl37L (long version) construct.
  • Figure 92 shows an additional schematic of the 7tl5-2lsl37L (long version) construct.
  • Figure 93 is a line graph showing the chromatographic profile of 7tl5-2lsl37L
  • Figure 94 shows the analytical SEC profile of 7tl5-2lsl37L (long version).
  • Figure 95 shows binding of 7tl5-2lsl37L (short version) to CD137L (4.1BBL)
  • Figures 96A-96C show detection of IL15, IL21, and IL7 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 96A shows detection of IL15 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 96B shows detection of IL21 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 96C shows detection of IL7 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 97 shows results from a CTLL-2 cell proliferation assay.
  • Figure 98 shows the activity of 7tl5-lsl37L (short version) in promoting IL21R containing B9 cell proliferation.
  • Figure 99 shows a schematic of the 7tl5-TGFRs construct.
  • Figure 100 shows an additional schematic of the 7tl5-TGFRs construct.
  • Figure 101 shows results of TGF l inhibition by 7tl5-TGFRs and TGFR-Fc.
  • Figures 102A-102C show detection of IL-15, TGF RII, and IL-7 in 7tl5-TGFRs with ELISA.
  • Figure 103 shows results of a 32 ⁇ b cell proliferation assay with 7tl5-TGFRs or recombinant IL- 15.
  • Figure 104 is a line graph showing the chromatographic profile of 7tl5-TGFRs protein containing cell culture supernatant following binding and elution on anti-TF antibody affinity column.
  • Figure 105 shows 7tl5-TGFRs before and after deglycosylation as analyzed using reduced SDS-PAGE.
  • Figure 106 shows ELISA detection of IL-7, IL-15 and TGF RII in the 7tl 5-
  • Figures 107A and 107B show spleen weight and the percentages of immune cell types in 7tl5-TGFRs-treated and control-treated mice.
  • Figure 107A shows spleen weight in mice treated with 7tl5-TGFRs at various dosages, as compared to PBS control.
  • Figure 107B shows the percentage of CD4 + T cells, CD8 + T cells, and NK cells in mice treated with 7tl5-TGFRs at various dosages, as compared to PBS control.
  • Figures l08A and 108B show upregulation of CD44 expression of CD4 +
  • Figures 109A and 109B show upregulation of Ki67 expression and Granzyme B expression of CD8 + T cells and NK Cells by 7tl5-TGFRs in C57BL/6 mice.
  • Figure 110 shows enhancement of cytotoxicity of splenocytes by 7tl5-TGFRs in C57BL/6 mice.
  • Figure 111 shows a schematic of the TGFRtl5-2lsl37L construct.
  • Figure 112 shows an additional schematic of the TGFRtl5-2lsl37L construct.
  • Figure 113 is a line graph showing the chromatographic profile of
  • Figure 114 shows a schematic of the TGFRtl5-TGFRs2l construct.
  • Figure 115 shows an additional schematic of the TGFRtl5-TGFRs2l
  • Figure 116 is a line graph showing the chromatographic profile of TGFRtl5- TGFRs2l protein containing cell culture supernatant following binding and elution on anti-TF antibody affinity column.
  • Figure 117 shows TGFRtl5-TGFRs2l before and after deglycosylation as analyzed by reduced SDS-PAGE.
  • Figures 118A and 118B show detection of components of TGFRtl5-TGFRs2l using ELISA.
  • Figures 119A and 119B show the percentages and proliferation of CD4 + T cells, CD8 + T cells, and natural killer (NK) cells present in the spleen of control-treated and TGFRtl5-TGFRs2l -treated mice.
  • Figure 120 shows upregulation of Granzyme B expression of splenocytes in mice treated with TGFRtl5-TGFRs2l.
  • Figure 121 shows enhancement of cytotoxicity of splenocytes by TGFRtl5-TGFRs2l in C57BL/6 Mice.
  • Figure 122 shows a schematic of the TGFRtl5-TGFRsl6 construct.
  • Figure 123 shows an additional schematic of the TGFRtl5-TGFRsl6 construct.
  • Figure 124 shows a schematic of the TGFRtl5-TGFRsl37L construct.
  • Figure 125 shows an additional schematic of the TGFRtl5-TGFRsl37L construct.
  • Figure 126 shows changes in the surface phenotype of lymphocyte populations after stimulation with 18tl 5- l2s, 18tl 5-l2s 16, and 7tl 5-21 s.
  • Figure 127 shows an increase in phospho-STAT4 and phospho-STAT5 levels in NK cells after stimulation with l8tl5-l2s.
  • Figures 128A-128C show in vivo stimulation of Tregs, NK cells, and CD8 + T cells in ApoE /_ mice fed with a Western diet and treated with TGFRtl5-TGFRs.
  • Figures 129A-129C show immunostimulation in C57BL/6 mice following treatment with TGFRtl5-TGFRs.
  • Figures 130A and 130B show in vivo induction of proliferation of NK cells and CD8 + T cells in ApoE /_ mice fed with a Western diet and treated with TGFRtl5-TGFRs.
  • Figures 131 A and 131B show enhancement of cytotoxicity of NK cells following treatment of NK cells with TGFRtl5-TGFRs.
  • Figures 132A and 132B show enhancement of ADCC activity of NK cells following treatment of NK cells with TGFRtl5-TGFRs.
  • Figures 133A-133H show antitumor activity of TGFRtl5-TGFRs plus anti-TRPl antibody (TA99) in combination with chemotherapy in a melanoma mouse model.
  • Figures 134A-134C show amelioration of the Western diet-induced
  • Figure 135 shows cell surface staining summarizing the differentiation of NK cells into cytokine-induced memory like NK Cells (CIML-NK Cells) after stimulation with l8tl5-l2s and cultured in rhILl5.
  • Figure 136 shows upregulation shows upregulation of CD44hi memory T cells upon treatment with TGFRtl5-TGFRs.
  • Figure 137 shows a graph of Factor X (FX) activation following treatment with single-chain or multi-chain chimeric polypeptides.
  • Figure 138 shows clotting time for a buffer with varying concentrations of Innovin in a prothrombin time (PT) test.
  • Figure 139 shows clotting time for multi-chain chimeric polypeptides in a PT
  • Figure 140 shows clotting time of the multi-chain chimeric polypeptides in a PT assay when mixed with 32DB cells.
  • Figure 141 shows clotting time of multi-chain chimeric polypeptides in a PT assay when mixed with human PBMC.
  • Figure 142 shows binding of 7tl5-2lsl37L (long version) and 7tl5-2lsl37L (short version) to CD137 (4.1BB).
  • Figure 143A-143D show detection of IL7, IL21, IL15, and 4.1BBL in 7tl 5- 2lsl37L (long version) by the respective antibodies using ELISA.
  • Figure 144 shows IL-15 activity of 7tl5-2lsl37L (long version) and 7tl5- 2lsl37L (short version) as evaluated by a IL2Ra y-containing CTLL2 cell proliferation assay.
  • multi-chain chimeric polypeptides that include: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a soluble tissue factor domain; and (iii) a first domain of a pair of affinity domains; and (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • compositions that include any of the multi-chain chimeric polypeptides described herein, nucleic acids that encode any of the multi-chain chimeric polypeptides described herein, and cells that include any of the nucleic acids that encode any of the multi-chain chimeric polypeptides described herein. Also provided herein are methods of stimulating an immune cell and methods of treating a subject in need thereof that include the use of any of the multi-chain chimeric polypeptides described herein. Also provided herein are methods of producing any of the multi-chain chimeric polypeptides described herein.
  • the total length of first chimeric polypeptide and/or the second chimeric polypeptide can each independently be about 50 amino acids to about 3000 amino acids, about 50 amino acids to about 2500 amino acids, about 50 amino acids to about 2000 amino acids, about 50 amino acids to about 1500 amino acids, about 50 amino acids to about 1000 amino acids, about 50 amino acids to about 950 amino acids, about 50 amino acids to about 900 amino acids, about 50 amino acids to about 850 amino acids, about 50 amino acids to about 800 amino acids, about 50 amino acids to about 750 amino acids, about 50 amino acids to about 700 amino acids, about 50 amino acids to about 650 amino acids, about 50 amino acids to about 600 amino acids, about 50 amino acids to about 550 amino acids, about 50 amino acids to about 500 amino acids, about 50 amino acids to about 480 amino acids, about 50 amino acids to about 460 amino acids, about 50 amino acids to about 440 amino acids, about 50 amino acids to about 420 amino acids, about 50 amino acids to about 400
  • the first target-binding domain e.g., any of the first target-binding domains described herein
  • the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary first target-binding domains described herein) and the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
  • the first domain of the pair of affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the second domain of the pair of affinity domains e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein
  • the second target-binding domain e.g., any of the exemplary second target-binding domains described herein
  • the second chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) and the second target- binding domain (e.g., any of the exemplary second target-binding domains described herein) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • Non-limiting aspects of these chimeric polypeptides, nucleic acids, vectors, cells, and methods are described below, and can be used in any combination without limitation. Additional aspects of these chimeric polypeptides, nucleic acids, vectors, cells, and methods are known in the art.
  • Human tissue factor is a 263 amino-acid transmembrane protein containing three domains: (1) a 2l9-amino acid N-terminal extracellular domain (residues 1-219); (2) a 22-amino acid transmembrane domain (residues 220-242); and (3) a 21 -amino acid cytoplasmic C-terminal tail (residues 242-263) ((UniProtKB Identifier Number: P13726).
  • the cytoplasmic tail contains two phosphorylation sites at Ser253 and Ser258, and one S- palmitoylation site at Cys245. Deletion or mutation of the cytoplasmic domain was not found to affect tissue factor coagulation activity.
  • Tissue factor has one S-palmitoylation site in the intracellular domain of the protein at Cys245.
  • the Cys245 is located at the amino acid terminus of the intracellular domain and close to the membrane surface.
  • the tissue factor transmembrane domain is composed of a single-spanning a-helix.
  • the extracellular domain of tissue factor, composed of two fibronectin type III domains, is connected to the transmembrane domain through a six-amino acid linker.
  • Each tissue factor fibronectin type III module is composed of two overlapping b sheets with the top sheet domain containing three antiparallel b-strands and the bottom sheet containing four b-strands.
  • the b-strands are connected by b-loops between strand bA and bB, bE and b ⁇ , and bE and bE, all of which are conserved in conformation in the two modules.
  • a unique feature of tissue factor is a 17- amino acid b-hairpin between strand b ⁇ q and strand b ⁇ 1, which is not a common element of the fibronectin superfamily.
  • the N-terminal domain also contains a 12 amino acid loop between b6E and b70 that is not present in the C-terminal domain and is unique to tissue factor.
  • Such a fibronectin type III domain structure is a feature of the
  • immunoglobulin-like family of protein folds and is conserved among a wide variety of extracellular proteins.
  • the zymogen FVII is rapidly converted to FVIIa by limited proteolysis once it binds to tissue to form the active tissue factor-FVIIa complex.
  • the FVIIa which circulates as an enzyme at a concentration of approximately 0.1 nM (1% of plasma FVII), can also bind directly to tissue factor.
  • the allosteric interaction between tissue factor and FVIIa on the tissue factor-FVIIa complex greatly increases the enzymatic activity of FVIIa: an approximate 20- to lOO-fold increase in the rate of hydrolysis of small, chromogenic peptidyl substrates, and nearly a million-fold increase in the rate of activation of the natural macromolecular substrates FIX and FX.
  • tissue factor-FVIIa complex on phospholipid bilayer i.e., upon exposure of phosphatidyl-L-serine on membrane surfaces
  • FIX or FX activation increases the rate of FIX or FX activation, in a Ca 2+ -dependent manner, an additional 1, 000-fold.
  • the roughly million-fold overall increase in FX activation by tissue factor-FVIIa-phospholipid complex relative to free FVIIa is a critical regulatory point for the coagulation cascade.
  • FVII is a ⁇ 50 kDa, single-chain polypeptide consisting of 406 amino acid residues, with an N-terminal g-carboxyglutamate-rich (GLA) domain, two epidermal growth factor-like domains (EGF1 and EFG2), and a C-terminal serine protease domain.
  • GLA N-terminal g-carboxyglutamate-rich
  • EGF1 and EFG2 epidermal growth factor-like domains
  • C-terminal serine protease domain is activated to FVIIa by a specific proteolytic cleavage of the Ile- 154 -Arg 152 bond in the short linker region between the EGF2 and the protease domain. This cleavage results in the light and heavy chains being held together by a single disulfide bond of Cys 135 and Cys 262 .
  • FVIIa binds phospholipid membrane in a Ca 2+ -dependent manner through its N- terminal GLA-domain.
  • GLA domain Immediately C-terminal to the GLA domain is an aromatic stack and two EGF domains.
  • the aromatic stack connects the GLA to EGF1 domain which binds a single Ca 2+ ion. Occupancy of this Ca 2+ -binding site increases FVIIa amidolytic activity and tissue factor association.
  • the catalytic triad consist of His 193 , Asp 242 , and Ser 344 , and binding of a single Ca 2+ ion within the FVIIa protease domain is critical for its catalytic activity.
  • Proteolytic activation of FVII to FVIIa frees the newly formed amino terminus at Ile 153 to fold back and be inserted into the activation pocket forming a salt bridge with the carboxylate of Asp 343 to generate the oxyanion hole. Formation of this salt bridge is critical for FVIIa activity. However, oxyanion hole formation does not occur in free FVIIa upon proteolytic activation. As a result, FVIIa circulates in a zymogen-like state that is poorly recognized by plasma protease inhibitors, allowing it to circulate with a half-life of approximately 90 minutes.
  • Tissue factor-mediated positioning of the FVIIa active site above the membrane surface is important for FVIIa towards cognate substrates.
  • Free FVIIa adopts a stable, extended structure when bound to the membrane with its active site positioned ⁇ 80A above the membrane surface.
  • ETpon FVIIa binding to tissue factor the FVa active site is repositioned ⁇ 6A closer to the membrane. This modulation may aid in a proper alignment of the FVIIa catalytic triad with the target substrate cleavage site.
  • tissue factor supported full FVIIa proteolytic activity as long as the tissue factor extracellular domain was tethered in some way to the membrane surface.
  • raising the active site of FVIIa greater than 8qA above the membrane surface greatly reduced the ability of the tissue factor-FVIIa complex to activate FX but did not diminish tissue factor-FVIIa amidolytic activity.
  • Alanine scanning mutagenesis has been used to assess the role of specific amino acid side chains in the tissue factor extracellular domain for interaction with FVIIa (Gibbs et al., Biochemistry 33(47): 14003-14010, 1994; Schullek et al., J Biol Chem 269(30): 19399-19403, 1994).
  • Thr 60 is only partially solvent-exposed and may play a local structural role rather than making a significant contact with ligand.
  • the binding site extends onto the concave side of the intermodule angle involving Glu 24 and Gln 110 , and potentially the more distant residue Val 207 .
  • the binding region extends from Asp58 onto a convex surface area formed by Lys 48 , Lys 46 , Gln 37 , Asp 44 , and Trp 45 .
  • Trp 45 and Asp 44 do not interact independently with FVIIa, indicating that the mutational effect at the Trp 45 position may reflect a structural importance of this side chain for the local packing of the adjacent Asp 44 and Gln 37 side chain.
  • the interactive area further includes two surface- exposed aromatic residues, Phe 76 and Tyr 78 , which form part of the hydrophobic cluster in the N-module.
  • tissue factor-FVIIa The known physiologic substrates of tissue factor-FVIIa are FVII, FIX, and FX and certain proteinase-activated receptors. Mutational analysis has identified a number of residues that, when mutated, support full FVIIa amidolytic activity towards small peptidyl substrates but are deficient in their ability to support macromolecular substrate (i.e., FVII, FIX, and FX) activation (Ruf et al., J Biol Chem 267(31): 22206-22210, 1992; Ruf et al., J Biol Chem 267(9): 6375-6381, 1992; Huang et al., J Biol Chem 271(36): 21752-21757, 1996; Kirchhofer et al., Biochemistry 39(25): 7380-7387, 2000).
  • FVII, FIX, and FX macromolecular substrate activation
  • tissue factor loop region at residues 159-165, and residues in or adjacent to this flexible loop have been shown to be critical for the proteolytic activity of the tissue factor-FVIIa complex.
  • Lys 165 and Lys 166 have also been demonstrated to be important for substrate recognition and binding. Mutation of either of these residues to alanine results in a significant decrease in the tissue factor co-factor function. Lys 165 and Lys 166 face away from each other, with Lys 165 pointing towards FVIIa in most tissue factor-FVIIa structures, and Lys 166 pointing into the substrate binding exosite region in the crystal structure. Putative salt bridge formation between Lys 165 of and Gla 35 of FVIIa would support the notion that tissue factor interaction with the GLA domain of FVIIa modulates substrate recognition.
  • the soluble tissue factor domain can be a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain.
  • the soluble tissue factor domain can be a tissue factor mutant, wherein a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain, and has been further modified at selected amino acids.
  • the soluble tissue factor domain can be a soluble human tissue factor domain.
  • the soluble tissue factor domain can be a soluble mouse tissue factor domain.
  • the soluble tissue factor domain can be a soluble rat tissue factor domain.
  • a soluble tissue factor domain can include a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 1, 3, 4, 5, or 6.
  • a soluble tissue factor domain can include a sequence of SEQ ID NO: 1, 3, 4, 5, or 6, with one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its N-terminus and/or one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its C-terminus.
  • amino acids e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some examples of any of the multi-chain chimeric polypeptides described herein, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments of any of the multi-chain chimeric polypeptides described herein, the multi- chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
  • the soluble tissue factor domain can be a soluble human tissue factor domain. In some embodiments, the soluble tissue factor domain can be a soluble mouse tissue factor domain. In some embodiments, the soluble tissue factor domain can be a soluble rat tissue factor domain.
  • the soluble tissue factor domain does not include one or more (e.g., two, three, four, five, six, or seven) of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the mutant soluble tissue factor possesses the amino acid sequence
  • the soluble tissue factor domain can be encoded by a nucleic acid including a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 2
  • the soluble tissue factor domain can have a total length of about 20 amino acids to about 220 amino acids, about 20 amino acids to about 215 amino acids, about 20 amino acids to about 210 amino acids, about 20 amino acids to about 205 amino acids, about 20 amino acids to about 200 amino acids, about 20 amino acids to about 195 amino acids, about 20 amino acids to about 190 amino acids, about 20 amino acids to about 185 amino acids, about 20 amino acids to about 180 amino acids, about 20 amino acids to about 175 amino acids, about 20 amino acids to about 170 amino acids, about 20 amino acids to about 165 amino acids, about 20 amino acids to about 160 amino acids, about 20 amino acids to about 155 amino acids, about 20 amino acids to about 150 amino acids, about 20 amino acids to about 145 amino acids, about 20 amino acids to about 140 amino acids, about 20 amino acids to about 135 amino acids, about 20 amino acids to about 130 amino acids, about 20 amino acids to about 125 amino acids, about 20 amino acids to about 120 amino acids, about 20 amino acids to about 115 amino acids, about 20 amino acids to about
  • the linker sequence can be a flexible linker sequence.
  • linker sequences that can be used are described in Klein et ah, Protein Engineering, Design & Selection 27(l0):325-330, 2014; Priyanka et ah, Protein Sci. 22(2): 153-167, 2013.
  • the linker sequence is a synthetic linker sequence.
  • the first chimeric polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
  • the second chimeric polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
  • a linker sequence can have a total length of 1 amino acid to about 100 amino acids, 1 amino acid to about 90 amino acids, 1 amino acid to about 80 amino acids, 1 amino acid to about 70 amino acids, 1 amino acid to about 60 amino acids, 1 amino acid to about 50 amino acids, 1 amino acid to about 45 amino acids, 1 amino acid to about 40 amino acids, 1 amino acid to about 35 amino acids, 1 amino acid to about 30 amino acids, 1 amino acid to about 25 amino acids, 1 amino acid to about 24 amino acids, 1 amino acid to about 22 amino acids, 1 amino acid to about 20 amino acids,
  • 2 amino acids to about 22 amino acids about 2 amino acids to about 20 amino acids, about 2 amino acids to about 18 amino acids, about 2 amino acids to about 16 amino acids, about 2 amino acids to about 14 amino acids, about 2 amino acids to about 12 amino acids, about 2 amino acids to about 10 amino acids, about 2 amino acids to about 8 amino acids, about 2 amino acids to about 6 amino acids, about 2 amino acids to about 4 amino acids, about 4 amino acids to about 100 amino acids, about 4 amino acids to about 90 amino acids, about 4 amino acids to about 80 amino acids, about 4 amino acids to about 70 amino acids, about 4 amino acids to about 60 amino acids, about 4 amino acids to about 50 amino acids, about 4 amino acids to about 45 amino acids, about 4 amino acids to about 40 amino acids, about 4 amino acids to about 35 amino acids, about 4 amino acids to about 30 amino acids, about 4 amino acids to about 25 amino acids, about 4 amino acids to about 24 amino acids, about 4 amino acids to about 22 amino acids, about 4 amino acids to about 20 amino acids, about 4 amino acids to about 18 amino acids, about 4 amino acids to about
  • the linker is rich in glycine (Gly or G) residues. In some embodiments, the linker is rich in serine (Ser or S) residues. In some embodiments, the linker is rich in glycine and serine residues. In some embodiments, the linker has one or more glycine-serine residue pairs (GS), e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GS pairs. In some embodiments, the linker has one or more Gly-Gly-Gly-Ser (GGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGS sequences.
  • GS glycine-serine residue pairs
  • GGGS Gly-Gly-Gly-Ser
  • the linker has one or more Gly-Gly-Gly-Gly-Ser (GGGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGGS sequences. In some embodiments, the linker has one or more Gly-Gly-Ser-Gly (GGSG) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGSG sequences.
  • GGGGS Gly-Gly-Gly-Gly-Ser
  • the linker sequence can comprise or consist of
  • the linker sequence can be encoded by a nucleic acid comprising or consisting of:
  • the linker sequence can comprise or consist of:
  • the first target-binding domain, the second target-binding domain, and/or the additional one or more target-binding domains can be an antigen-binding domain (e.g., any of the exemplary antigen-binding domains described herein or known in the art), a soluble interleukin or cytokine protein (e.g., any of the exemplary soluble interleukin proteins or soluble cytokine proteins described herein), and a soluble interleukin or cytokine receptor (e.g., any of the exemplary soluble interleukin receptors or soluble cytokine receptors described herein).
  • an antigen-binding domain e.g., any of the exemplary antigen-binding domains described herein or known in the art
  • a soluble interleukin or cytokine protein e.g., any of the exemplary soluble interleukin proteins or soluble cytokine proteins described herein
  • a soluble interleukin or cytokine receptor
  • one or more of the first target-binding domain e.g., any of the exemplary first target binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary second target binding domains described herein or known in the art
  • the one or more additional target binding domains can each, independently, bind specifically to a target selected from the group of: bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3 (e.g., one or more of CD3a, CD3p, CD36, CD3e, and CD3y), CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD
  • the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can each independent have a total number of amino acids of about 5 amino acids to about 1000 amino acids, about 5 amino acids to about 950 amino acids, about 5 amino acids to about 900 amino acids, about 5 amino acids to about 850 amino acids, about 5 amino acids to about 800 amino acids, about 5 amino acids to about 750 amino acids, about 5 amino acids to about 700 amino acids, about 5 amino acids to about 650 amino acids, about 5 amino acids to about 600 amino acids, about 5 amino acids to about 550 amino acids, about 5 amino acids to about 500 amino acids, about 5 amino acids to about 450 amino acids, about 5 amino acids to about 400 amino acids, about 5 amino acids to about 350 amino acids, about 5 amino acids to about 300 amino acids, about 5 amino acids to about 280 amino acids, about 5 amino acids to about 260 amino acids, about 5 amino acids to about 240 amino acids, about
  • any of the target-binding domains described herein can bind to its target with a dissociation equilibrium constant (KD) of less than 1 x 10 7 M, less than 1 x 10 8 M, less than 1 x 10 9 M, less than 1 x lO 10 M, less than 1 x 10 11 M, less than 1 x 10 12 M, or less than 1 x 10 13 M.
  • KD dissociation equilibrium constant
  • the antigen-binding protein construct provided herein can bind to an identifying antigen with a KD of about 1 x 10 3 M to about 1 x 10 5 M, about 1 x 10 4 M to about 1 x 10 6 M, about 1 x 10 5 M to about 1 x 10 7 M, about 1 x 10 6 M to about 1 x 10 8 M, about 1 x 10 7 M to about 1 x 10 9 M, about 1 x 10 8 M to about 1 x 10 10 M, or about 1 x 10 9 M to about 1 x lO u M (inclusive).
  • any of the target-binding domains described herein can bind to its target with a KD of between about 1 pM to about 30 nM (e.g., about 1 pM to about 25 nM, about 1 pM to about 20 nM, about 1 pM to about 15 nM, about 1 pM to about 10 nM, about 1 pM to about 5 nM, about 1 pM to about 2 nM, about 1 pM to about 1 nM, about 1 pM to about 950 pM, about 1 pM to about 900 pM, about 1 pM to about 850 pM, about 1 pM to about
  • 800 pM about 1 pM to about 750 pM, about 1 pM to about 700 pM, about 1 pM to about 650 pM, about 1 pM to about 600 pM, about 1 pM to about 550 pM, about 1 pM to about
  • any of the target-binding domains described herein can bind to its target with a KD of between about 1 nM to about 10 nM (e.g., about 1 nM to about 9 nM, about 1 nM to about 8 nM, about 1 nM to about 7 nM, about 1 nM to about 6 nM, about 1 nM to about 5 nM, about 1 nM to about 4 nM, about 1 nM to about 3 nM, about 1 nM to about 2 nM, about 2 nM to about 10 nM, about 2 nM to about 9 nM, about 2 nM to about 8 nM, about 2 nM to about 7 nM, about 2 nM to about 6 nM, about 2 nM to about 5 nM, about 2 nM to about 4 nM, about 2 nM to about 3 nM, about 3 nM to about 10 nM, about 3 nM to about 10
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target-binding domain and the second target-binding domain bind specifically to different antigens.
  • one or both of the first target-binding domain and the second target-binding domain is an antigen-binding domain.
  • the first target-binding domain and the second target-binding domain are each antigen-binding domains.
  • the antigen-binding domain includes or is a scFv or a single domain antibody (e.g., a VHH or a VNAR domain).
  • an antigen-binding domain (e.g., any of the antigen-binding domains described herein) can bind specifically to any one of CDl6a (see, e.g., those described in U.S. Patent No. 9,035,026), CD28 (see, e.g., those described in U.S. Patent No. 7,723,482), CD3 (see, e.g., those described in U.S. Patent No. 9,226,962), CD33 (see, e.g., those described in U.S. Patent No. 8,759,494), CD20 (see, e.g., those described in WO 2014/026054), CD19 (see, e.g., those described in U.S.
  • Patent No. 9,701,758 CD22 (see, e.g., those described in WO 2003/104425), CD123 (see, e.g., those described in WO 2014/130635), IL-1R (see, e.g., those described in U.S. Patent No. 8,741,604), IL- 1 (see, e.g., those described in WO 2014/095808), VEGF (see, e.g., those described in U.S. Patent No. 9,090,684), IL-6R (see, e.g., those described in U.S. Patent No.
  • IL-10 see, e.g., those described in U.S. Patent Application Publication No. 2016/0340413
  • PDL-l see, e.g., those described in Drees et al., Protein Express. Purif 94:60-66, 2014
  • TIGIT see, e.g., those described in U.S. Patent Application Publication No. 2017/0198042
  • PD-l see, e.g., those described in U.S. Patent No.
  • TIM3 see, e.g., those described in U.S. Patent No. 8,552,156
  • CTLA4 see, e.g., those described in WO 2012/120125
  • MICA see, e.g., those described in WO
  • MICB see, e.g., those described in U.S. Patent No. 8,753,640
  • IL-6 see, e.g., those described in Gejima et al., Human Antibodies 11(4): 121-129, 2002
  • IL-8 see, e.g., those described in U.S. Patent No. 6,117,980
  • TNFa see, e.g., those described in Geng et al., Immunol. Res. 62(3):377-385, 2015
  • CD26a see, e.g., those described in WO 2017/189526
  • CD36 see, e.g., those described in U.S. Patent Application
  • ULBP2 see, e.g., those described in U.S. Patent No. 9,273,136
  • CD30 see, e.g., those described in Homach et al., Scand. J. Immunol.
  • CD200 see, e.g., those described in U.S. Patent No. 9,085,623
  • IGF-1R see, e.g., those described in U.S. Patent Application Publication No.
  • MUC4AC see, e.g., those described in WO 2012/170470
  • MUC5AC see, e.g., those described in WO 2012/170470
  • HER3 see, e.g., those described in U.S. Patent No. 9,505,843
  • PSMA see, e.g., those described in Parker et al., Protein Expr. Purif. 89(2): 136-145, 2013
  • CEA see, e.g., those described in WO 1995/015341
  • B7H3 see, e.g., those described in U.S. Patent No. 9,371,395)
  • EPCAM see, e.g., those described in WO 2014/159531
  • BCMA see, e.g., those described in Smith et al., Mol. Ther.
  • P-cadherin see, e.g., those described in U.S. Patent No. 7,452,537)
  • CEACAM5 see, e.g., those described in U.S. Patent No. 9,617,345
  • a ULl6-binding protein see, e.g., those described in WO 2017/083612
  • HLA-DR see, e.g., Pistillo et al., Exp. Clin. Immunogenet.
  • DLL4 see, e.g., those described in WO 2014/007513
  • TYR03 see, e.g., those described in WO 2016/166348
  • AXL see, e.g., those described in WO 2012/175692
  • MER see, e.g., those described in WO 2016/106221
  • CD122 see, e.g., those described in U.S. Patent Application
  • any of the antigen-binding domains present in any of the multi-chain chimeric polypeptides described herein are each independently selected from the group consisting of: a VHH domain, a VNAR domain, and a scFv.
  • any of the antigen-binding domains described herein is a BiTe, a (scFv)2, a nanobody, a nanobody - HSA, a DART, a TandAb, a scDiabody, a scDiabody-CFB, scFv-CH-CL-scFv, a
  • HSAbody HSAbody, scDiabody -HAS, or a tandem-scFv. Additional examples of antigen-binding domains that can be used in any of the multi-chain chimeric polypeptide are known in the art.
  • a VHH domain is a single monomeric variable antibody domain that can be found in camelids.
  • a VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish.
  • Non -limiting aspects of VHH domains and VNAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem. 15:2543-2557, 2016; De Genst et al., Dev. Comp. Immunol. 30: 187-198, 2006; De Meyer et al., Trends
  • each of the antigen-binding domains in the multi-chain chimeric polypeptides described herein are both VHH domains, or at least one antigen binding domain is a VHH domain. In some embodiments, each of the antigen-binding domains in the multi-chain chimeric polypeptides described herein are both VNAR domains, or at least one antigen-binding domain is a VNAR domain. In some
  • each of the antigen-binding domains in the multi-chain chimeric polypeptides described herein are both scFv domains, or at least one antigen-binding domain is a scFv domain.
  • two or more of polypeptides present in the multi-chain chimeric polypeptide can assemble (e.g., non-covalently assemble) to form any of the antigen-binding domains described herein, e.g., an antigen-binding fragment of an antibody (e.g., any of the antigen-binding fragments of an antibody described herein), a VHH-scAb, a VHH-Fab, a Dual scFab, a F(ab’)2, a diabody, a crossMab, a DAF (two-in- one), a DAF (four-in-one), a DutaMab, a DT-IgG, a knobs-in-holes common light chain, a knobs-in-holes assembly, a charge pair, a Fab-arm exchange, a SEEDbody, a LUZ-Y, a Fcab, a kl-body, an orthogonal Fab,
  • Non limiting examples of an antigen-binding fragment of an antibody include an Fv fragment, a Fab fragment, a F(ab')2 fragment, and a Fab' fragment.
  • an antigen-binding fragment of an antibody is an antigen-binding fragment of an IgG (e.g., an antigen-binding fragment of IgGl, IgG2, IgG3, or IgG4) (e.g., an antigen-binding fragment of a human or humanized IgQ e.g., human or humanized IgGl, IgG2, IgG3, or IgG4); an antigen-binding fragment of an IgA (e.g., an antigen-binding fragment of IgAl or IgA2) (e.g., an antigen-binding fragment of a human or humanized IgA, e.g., a human or humanized IgAl or IgA2); an antigen-binding fragment of an IgD (e.g., an antigen binding fragment of a human or humanized IgD); an antigen-binding fragment of an IgE (e.g., an antigen-binding fragment of a human or
  • An“Fv” fragment includes a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
  • A“Fab” fragment includes, the constant domain of the light chain and the first constant domain (CHI) of the heavy chain, in addition to the heavy and light chain variable domains of the Fv fragment.
  • A“F(ab')2” fragment includes two Fab fragments joined, near the hinge region, by disulfide bonds.
  • A“dual variable domain immunoglobulin” or“DVD-Ig” refers to multivalent and multispecific binding proteins as described, e.g., in DiGiammarino et al., Methods Mol. Biol. 899: 145-156, 2012; Jakob et al. , MABs 5:358-363, 2013; and U.S. Patent Nos.
  • any of the antigen-binding domains described herein can bind to an antigen selected from the group consisting of: a protein, a carbohydrate, a lipid, and a combination thereof.
  • one or both of the first target-binding domain and the second target-binding domain can be a soluble interleukin protein or soluble cytokine protein.
  • the soluble interleukin or soluble cytokine protein is selected from the group of: IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, and FLT3L.
  • Non-limiting examples of soluble MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, and ULBP6 are provided below.
  • Human Soluble MICA (SEQ ID NO: 20)
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, a soluble cytokine receptor or a ligand receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII) (see, e.g., those described in Yung et ak, Am. J Resp. Crit. Care Med.
  • a soluble NKp30 see, e.g., Costa et ak, Front. Immunol ., Vol. 9, Article 1150, May 29, 2018; doi: l0.3389/fimmu.20l8.0l 150
  • a soluble NKp44 see, e.g., those described in Costa et ak, Front. Immunol ., Vol. 9, Article 1150, May 29, 2018; doi: l0.3389/fimmu.20l8.0H50
  • a soluble NKp46 see, e.g., Mandelboim et ak,
  • a scMHCI see, e.g., those described in Washburn et ak, PLoS One 6(3):el8439, 2011
  • a scMHCII see, e.g., those described in Bishwajit et ak, Cellular Immunol. l70(l):25-33, 1996)
  • a scTCR see, e.g., those described in Weber et ak, Nature 356(6372):793-796, 1992
  • a soluble CD155 see, e.g., those described in Tahara-Hanaoka et ak, Int. Immunol. l6(4):533-538, 2004
  • a soluble CD28 see, e.g., Hebbar et ak, Clin. Exp. Immunol. 136:388-392, 2004).
  • the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domain(s) (e.g., any of the exemplary target- binding domains described herein or known in the art), where at least one of the one or more additional antigen-binding domain(s) is positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein).
  • additional target-binding domain(s) e.g., any of the exemplary target- binding domains described herein or known in the art
  • the first chimeric polypeptide can further include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the at least one of the one or more additional target- binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art), and/or a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences
  • the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains at the N-terminal and/or C-terminal end of the first chimeric polypeptide.
  • At least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • At least one of the one or more additional target-binding domains is disposed at the N- and/or C-terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) is positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein or known in the art
  • affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
  • the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the linker sequences described herein or known in the art
  • the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the C-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the first domains described herein or any of the exemplary pairs of affinity domains described herein), directly abuts the soluble tissue factor domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed (i) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein), and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains.
  • a linker sequence e.g.,
  • the second chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the N- terminal end and/or the C-terminal end of the second chimeric polypeptide.
  • additional target-binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • At least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target- binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the second domain of the pair of affinity domains (e.g., any of the second domains described herein of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • At least one of the one or more additional target-binding domains directly abuts the second target- binding domain (e.g., any of the target-binding domains described herein or known in the art) in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target-binding domains (e.g., any of the exemplary target binding domains described herein or known in the art) and the second target-binding domain (e.g., any of the exemplary target binding domains described herein or known in the art) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen.
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope.
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more (e.g., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain (e.g., a scFv or a single-domain antibody).
  • a multi-chain chimeric polypeptide includes: 1) a first chimeric polypeptide that includes a first domain of a pair of affinity domains, and 2) a second chimeric polypeptide that includes a second domain of a pair of affinity domains such that the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) and a soluble IL-15.
  • a sushi domain also known as a short consensus repeat or type 1 glycoprotein motif, is a common motif in protein-protein interaction.
  • Sushi domains have been identified on a number of protein- binding molecules, including complement components Clr, Cls, factor H, and C2m, as well as the nonimmunologic molecules factor XIII and P2-gly coprotein.
  • Atypical Sushi domain has approximately 60 amino acid residues and contains four cysteines
  • the first cysteine can form a disulfide bond with the third cysteine, and the second cysteine can form a disulfide bridge with the fourth cysteine.
  • the soluble IL15 has a D8N or D8A amino acid substitution.
  • one member of the pair of affinity domains is an alpha chain of human IL-15 receptor (ILl5Ra)
  • the human ILl5Ra is a mature full- length ILl5Ra.
  • the pair of affinity domains is barnase and barnstar.
  • the pair of affinity domains is a PKA and an AKAP.
  • the pair of affinity domains is an adapter/docking tag module based on mutated RNase I fragments (Rossi, Proc Natl Acad Sci USA. 103 : 6841-6846, 2006; Sharkey et ah, Cancer Res. 68:5282-5290, 2008; Rossi et ah, Trends Pharmacol Sci. 33:474-481, 2012) or SNARE modules based on interactions of the proteins syntaxin, synaptotagmin, synaptobrevin, and SNAP25 (Deyev et ah, Nat Biotechnol . 1486-1492, 2003).
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a dissociation equilibrium constant (KD) of less than 1 x 10 7 M, less than 1 x 10 8 M, less than 1 x 10 9 M, less than 1 x 10 10 M, less than 1 x 10 11 M, less than 1 x 10 12 M, or less than 1 x 10 13 M.
  • KD dissociation equilibrium constant
  • the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a KD of about 1 x 10 4 M to about 1 x 10 6 M, about 1 x 10 5 M to about 1 x 10 7 M, about 1 x 10 6 M to about 1 x 10 8 M, about 1 x 10 7 M to about 1 x 10 9 M, about 1 x 10 8 M to about 1 x 10 10 M, about 1 x 10 9 M to about 1 x 10 11 M, about 1 x 10 10 M to about 1 x 10 12 M, about 1 x 10 11 M to about 1 x 10 13 M, about 1 x 10 4 M to about 1 x 10 5 M, about 1 x 10 5 M to about 1 x 10 6 M, about 1 x 10 6 M to about 1 x 10 7 M, about 1 x 10 7 M to about 1 x 10 8 M, about 1 x 10 8 M to about 1 x 10 9 M, about 1 x 10 9 M to about 1
  • any of a variety of different methods known in the art can be used to determine the KD value of the binding of the first domain of the pair of affinity domains and the second domain of the pair of affinity domains (e.g., an electrophoretic mobility shift assay, a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.).
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains, the second domain of the pair of affinity domains, or both is about 10 to 100 amino acids in length.
  • a first domain of a pair of affinity domains, a second domain of a pair of affinity domains, or both can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to
  • amino acids in length about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about 10 to 50 amino acids in length, about 10 to 45 amino acids in length, about 10 to 40 amino acids in length, about 10 to 35 amino acids in length, about 10 to 30 amino acids in length, about 10 to 25 amino acids in length, about 10 to 20 amino acids in length, about 10 to 15 amino acids in length, about 20 to 30 amino acids in length, about 30 to 40 amino acids in length, about 40 to 50 amino acids in length, about 50 to 60 amino acids in length, about 60 to 70 amino acids in length, about 70 to 80 amino acids in length, about 80 to 90 amino acids in length, about 90 to 100 amino acids in length, about 20 to 90 amino acids in length, about 30 to 80 amino acids in length, about 40 to 70 amino acids in
  • a first domain of a pair of affinity domains, a second domain of a pair of affinity domains, or both is about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length.
  • any of the first and/or second domains of a pair of affinity domains disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the first and/or second domains of a pair of affinity domains remains intact.
  • a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) can include one or more additional amino acids at the N-terminus and/or the C-terminus, while still retaining the ability to bind to a soluble IL-15.
  • a soluble IL-15 can include one or more additional amino acids at the N-terminus and/or the C-terminus, while still retaining the ability to bind to a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra).
  • ILl5Ra human IL-15 receptor
  • a non-limiting example of a sushi domain from an alpha chain of IL-15 receptor alpha can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to
  • a sushi domain from an alpha chain of ILl5Ra can be encoded by a nucleic acid including
  • a soluble IL-15 can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to
  • a soluble IL-15 can be encoded by a nucleic acid including the sequence of
  • AACTGGGT GAACGT C ATC AGCGATTTAAAGAAGATCGAAGATTTAATTC AGTC CATGCATATCGACGCCACTTTATACACAGAATCCGACGTGCACCCCTCTTGTAA GGT GACCGCC AT GAAAT GTTTTTTACTGGAGCTGC AAGTTATCTCTTTAGAGAG
  • a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a signal sequence at its N-terminal end. In some embodiments, a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a signal sequence at its N-terminal end. In some embodiments, both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a signal sequence.
  • a signal sequence is an amino acid sequence that is present at the N-terminus of a number of endogenously produced proteins that directs the protein to the secretory pathway (e.g., the protein is directed to reside in certain intracellular organelles, to reside in the cell membrane, or to be secreted from the cell).
  • Signal sequences are heterogeneous and differ greatly in their primary amino acid sequences. However, signal sequences are typically 16 to 30 amino acids in length and include a hydrophilic, usually positively charged N-terminal region, a central hydrophobic domain, and a C-terminal region that contains the cleavage site for signal peptidase.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence encoded by the nucleic acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that is about 10 to 100 amino acids in length.
  • a signal sequence can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about 10 to to 100
  • any of the signal sequences disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the signal sequence remains intact.
  • a signal sequence having the amino acid sequence MKCLLYLAFLFLGVNC (SEQ ID NO: 35) can include one or more additional amino acids at the N-terminus or C-terminus, while still retaining the ability to direct a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both to the secretory pathway.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that directs the multi-chain chimeric polypeptide into the extracellular space.
  • Such embodiments are useful in producing multi-chain chimeric polypeptides that are relatively easy to be isolated and/or purified.
  • a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C- terminal end of the first chimeric polypeptide).
  • a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C-terminal end of the second chimeric polypeptide).
  • both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a peptide tag.
  • a first chimeric polypeptide of a multi- chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include two or more peptide tags.
  • Exemplary peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include, without limitation, AviTag
  • HHHHHHHH a his-tag (HHHHH (SEQ ID NO: 45); HHHHHH (SEQ ID NO: 46); HHHHHHH (SEQ ID NO: 47); HHHHHHHH (SEQ ID NO: 48); HHHHHHHHH (SEQ ID NO: 49); or HHHHHHHHHH (SEQ ID NO: 50)), a myc-tag (EQKLISEEDL; SEQ ID NO: 51), NE-tag (TKENPRSN QEES YDDNES ; SEQ ID NO: 52), S-tag, (KETA AAKFERQHMD S ; SEQ ID NO: 53), SBP-tag
  • tissue factor protein is a peptide tag.
  • Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used in any of a variety of applications related to the multi- chain chimeric polypeptide.
  • a peptide tag can be used in the purification of a multi-chain chimeric polypeptide.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
  • a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
  • both can include a myc tag
  • the multi-chain chimeric polypeptide that includes the myc-tagged first chimeric polypeptide, the myc-tagged second chimeric polypeptide, or both can be purified using an antibody that recognizes the myc tag(s).
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
  • a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
  • both can include a histidine tag
  • the multi-chain chimeric polypeptide that includes the histidine-tagged first chimeric polypeptide, the histidine-tagged second chimeric polypeptide, or both can be purified using a nickel or cobalt chelate.
  • a peptide tag is removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification. In some embodiments, a peptide tag is not removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification.
  • Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used, for example, in immunoprecipitation of the multi-chain chimeric polypeptide, imaging of the multi-chain chimeric polypeptide (e.g., via Western blotting, ELISA, flow cytometry, and/or immunocytochemistry), and/or solubilization of the multi-chain chimeric polypeptide.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a peptide tag that is about 10 to 100 amino acids in length.
  • a peptide tag can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to
  • 100 amino acids in length about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to
  • amino acids in length about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about 10 to 50 amino acids in length, about 10 to 45 amino acids in length, about 10 to 40 amino acids in length, about 10 to 35 amino acids in length, about 10 to 30 amino acids in length, about 10 to 25 amino acids in length, about 10 to 20 amino acids in length, about 10 to 15 amino acids in length, about 20 to 30 amino acids in length, about 30 to 40 amino acids in length, about 40 to 50 amino acids in length, about 50 to 60 amino acids in length, about 60 to 70 amino acids in length, about 70 to 80 amino acids in length, about 80 to 90 amino acids in length, about 90 to 100 amino acids in length, about 20 to 90 amino acids
  • Peptide tags included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be of any suitable length.
  • peptide tags can be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids in length.
  • the two or more peptide tags can be of the same or different lengths.
  • any of the peptide tags disclosed herein may include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at the N-terminus and/or C-terminus, so long as the function of the peptide tag remains intact.
  • a myc tag having the amino acid sequence EQKLISEEDL can include one or more additional amino acids (e.g., at the N-terminus and/or the C- terminus of the peptide tag), while still retaining the ability to be bound by an antibody (e.g., 9E10).
  • the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-18 or a receptor of IL-12.
  • the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
  • the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
  • one or both of the first target-binding domain and the second target-binding domain is an agonistic antigen-binding domain. In some embodiments of these multi-chain chimeric polypeptides, one or both of the first target-binding domain and the second target-binding domain is an agonistic antigen-binding domain. In some embodiments of these multi-chain chimeric polypeptides, one or both of the first target-binding domain and the second target-binding domain is an agonistic antigen-binding domain. In some embodiments of these multi-chain chimeric
  • the first target-binding domain and the second target-binding domain are each agonistic antigen-binding domains.
  • the antigen-binding domain includes a scFv or single-domain antibody.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble IL-15 or a soluble IL-18.
  • the first target-binding domain and the second target-binding domain are each independently a soluble IL-15 or a soluble IL-18.
  • the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-18 or a receptor of IL-12.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target binding domain binds specifically to a receptor for IL-12
  • the second target-binding domain binds specifically to a receptor for IL-18.
  • the first target-binding domain binds specifically to a receptor for IL-18
  • the second target-binding domain bind specifically to a receptor for IL-12.
  • the first target- binding domain includes a soluble IL-18 (e.g., a soluble human IL-18).
  • the soluble human IL-18 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-18 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the second target-binding domain includes a soluble IL-12 (e.g., a soluble human IL-12).
  • the soluble human IL-15 includes a sequence of soluble human IL-l2p (p40) and a sequence of soluble human IL- 12a (p35).
  • the soluble IL-15 human IL-15 further includes a linker sequence (e.g., any of the exemplary linker sequences described herein) between the sequence of soluble IL-l2p (p40) and the sequence of soluble human IL-l2a (p35).
  • the linker sequence comprises GGGGSGGGGSGGGGS (SEQ ID NO: 7).
  • the sequence of soluble human IL-12P (p40) comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the soluble human IL-l2p (p40) is encoded by a sequence that is at least 80% identical (e.g., at least
  • the soluble human IL-l2a (p35) includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-l2a (p35) is encoded by a sequence that is at least 80% identical (e.g., at least
  • the first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • ATACCTCC SEQ ID NO: 73.
  • the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIR (SEQ ID NO: 74).
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • AAGAC AAAGATCAAACTGTGCATTTTACTCCACGCCTTTAGGATCCGGGCCG
  • AACACCCTCTTTAAAGTGCATCCGG (SEQ ID NO: 75).
  • a second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • AAGAC AAAGATCAAACTGTGCATTTTACTCCACGCCTTTAGGATCCGGGCCG
  • the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-21 or to TGF-b.
  • the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
  • the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
  • the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble IL-21 (e.g., a soluble human IL-21 polypeptide) or a soluble TGF-b receptor (e.g., a soluble TGFRpRII receptor).
  • the first target-binding domain and the second target-binding domain are each
  • the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-21 or to TGF-b.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope.
  • the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target- binding domain binds specifically to a receptor for IL-21, and the second target-binding domain binds specifically to TGF-b. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain binds specifically to TGF-b, and the second target-binding domain bind specifically to a receptor for IL-21.
  • the first target- binding domain includes a soluble IL-21 (e.g., a soluble human IL-21).
  • the soluble human IL-21 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least
  • the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the second target-binding domain includes a soluble TGF-b receptor (e.g., a soluble TGFRpRII receptor (e.g., a soluble human TGFRpRII receptor)).
  • a soluble TGFRpRII receptor e.g., a soluble human TGFRpRII receptor
  • the soluble human TGFRpRII includes a first sequence of soluble human TGFRpRII and a second sequence of soluble human
  • the soluble human TGFRpRII includes a linker disposed between the first sequence of soluble human TGFRpRII and the second sequence of soluble human TGFRpRII.
  • the linker includes the sequence GGGGS GGGGS GGGGS (SEQ ID NO: 7).
  • the first sequence of soluble human TGFRpRII receptor comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the second sequence of soluble human TGFRpRII receptor comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICE KPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGET FFMC S C S SDECNDNIIF SEEYNT SNPD (SEQ ID NO: 81).
  • the first sequence of soluble human TGFRpRII receptor is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • ATCCCCCC ATGTGC AAAAGAGCGTGAAC AACGATATGATCGTGACCGACA ACAACGGCGCCGTGAAGTTTCCCCAGCTCTGCAAGTTCTGCGATGTCAGGTTC
  • the second sequence of soluble human TGFRpRII receptor is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the soluble human TGFRpRII receptor is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • TGFpRII receptor includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • ECVLNKATNVAHWTTPSLKCIR (SEQ ID NO: 90).
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-7 or a receptor of IL-21.
  • the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
  • the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
  • the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble IL-21 (e.g., a soluble human IL-21 polypeptide) or a soluble IL-7 (e.g., a soluble human IL-7 polypeptide).
  • the first target-binding domain and the second target-binding domain are each independently a soluble IL-21 or a soluble IL-7.
  • the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-21 or a receptor of IL-7.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target binding domain binds specifically to a receptor for IL-21
  • the second target-binding domain binds specifically to a receptor for IL-7.
  • the first target-binding domain binds specifically to a receptor for IL-7
  • the second target-binding domain binds specifically to a receptor for IL-21.
  • the first target binding domain includes a soluble IL-21 (e.g., a soluble human IL-21).
  • the soluble human IL-21 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the sequence of soluble human IL-7 comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-7 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • AAAC AAAC ACT AAT GAGTTTTT GATT GAT GTGGAT
  • a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • AAAAC AAAAC AA AC ACT AAT GAGTTTTT GATTGAT GT GGAT AAAG
  • the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGM FLFRA ARKLRQFLKMN S T GDFDLHLLK V SEGTTILLNCTGQ VKGRKP AALGE AQ PTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHITCPPPMSVEH ADIWVKS Y SLY SRERYICNSGFKRK AGT S SLTEC VLNK ATNVAF1WTTP SLKCIR (SEQ ID NO: 100)
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-7 or a receptor of IL-21.
  • the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
  • the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linkers described herein
  • the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
  • the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble IL-21 (e.g., a soluble human IL-21 polypeptide) or a soluble IL-7 (e.g., a soluble human IL-7 polypeptide).
  • the first target-binding domain and the second target-binding domain are each independently a soluble IL-21 or a soluble IL-7.
  • the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-21 or a receptor of IL-7.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target- binding domain binds specifically to a receptor for IL-21, and the second target-binding domain binds specifically to a receptor for IL-7. In some embodiments of these multi chain chimeric polypeptides, the first target-binding domain binds specifically to a receptor for IL-7, and the second target-binding domain binds specifically to a receptor for IL-21.
  • the soluble human IL-21 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the sequence of soluble human IL-7 comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • the soluble human IL-7 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least
  • the first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Psychiatry (AREA)
  • Hospice & Palliative Care (AREA)
  • Virology (AREA)
PCT/US2019/048881 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof Ceased WO2020047299A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
EP19766444.4A EP3844181B1 (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
NZ772550A NZ772550B2 (en) 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
SG11202101779RA SG11202101779RA (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
AU2019328290A AU2019328290B2 (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
IL280918A IL280918B2 (en) 2018-08-30 2019-08-29 Chimeric polypeptides with multiple chains and their uses
KR1020257035341A KR20250160211A (ko) 2018-08-30 2019-08-29 다중-사슬 키메라 폴리펩타이드 및 이의 용도
JP2021535496A JP7397874B2 (ja) 2018-08-30 2019-08-29 多鎖キメラポリペプチドおよびその使用
EP25208349.8A EP4659757A3 (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
CA3108949A CA3108949A1 (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof
CN201980070927.3A CN112996805A (zh) 2018-08-30 2019-08-29 多链嵌合多肽和其用途
KR1020217009434A KR102877278B1 (ko) 2018-08-30 2019-08-29 다중-사슬 키메라 폴리펩타이드 및 이의 용도
JP2023203880A JP7735373B2 (ja) 2018-08-30 2023-12-01 多鎖キメラポリペプチドおよびその使用
AU2024287134A AU2024287134A1 (en) 2018-08-30 2024-12-21 Multi-chain chimeric polypeptides and uses there
JP2025141061A JP2025172844A (ja) 2018-08-30 2025-08-27 多鎖キメラポリペプチドおよびその使用

Applications Claiming Priority (20)

Application Number Priority Date Filing Date Title
US201862724969P 2018-08-30 2018-08-30
US201862725010P 2018-08-30 2018-08-30
US201862725043P 2018-08-30 2018-08-30
US62/725,043 2018-08-30
US62/725,010 2018-08-30
US62/724,969 2018-08-30
US201862746832P 2018-10-17 2018-10-17
US62/746,832 2018-10-17
US201862749007P 2018-10-22 2018-10-22
US62/749,007 2018-10-22
US201862749506P 2018-10-23 2018-10-23
US62/749,506 2018-10-23
US201962816683P 2019-03-11 2019-03-11
US62/816,683 2019-03-11
US201962817241P 2019-03-12 2019-03-12
US201962817230P 2019-03-12 2019-03-12
US62/817,230 2019-03-12
US62/817,241 2019-03-12
US201962881088P 2019-07-31 2019-07-31
US62/881,088 2019-07-31

Publications (1)

Publication Number Publication Date
WO2020047299A1 true WO2020047299A1 (en) 2020-03-05

Family

ID=67928938

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/048881 Ceased WO2020047299A1 (en) 2018-08-30 2019-08-29 Multi-chain chimeric polypeptides and uses thereof

Country Status (11)

Country Link
US (8) US11518792B2 (https=)
EP (2) EP3844181B1 (https=)
JP (3) JP7397874B2 (https=)
KR (2) KR102877278B1 (https=)
CN (1) CN112996805A (https=)
AU (2) AU2019328290B2 (https=)
CA (1) CA3108949A1 (https=)
IL (1) IL280918B2 (https=)
SG (1) SG11202101779RA (https=)
TW (1) TWI851594B (https=)
WO (1) WO2020047299A1 (https=)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020257639A1 (en) * 2019-06-21 2020-12-24 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11672826B2 (en) 2018-08-30 2023-06-13 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2023178333A1 (en) 2022-03-18 2023-09-21 WUGEN, Inc. Improved chimeric receptor constructs for nk cells
WO2023183853A1 (en) 2022-03-22 2023-09-28 WUGEN, Inc. Hybrid promoters, vectors containing same and methods of use
US11866476B2 (en) 2018-09-27 2024-01-09 Xilio Development, Inc. Masked IL-2-Fc fusion polypeptides
JP2024510712A (ja) * 2021-02-13 2024-03-11 アカミス バイオ リミテッド Il-15をコードするアデノウイルス
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
JP2024529494A (ja) * 2021-07-30 2024-08-06 クレ バイオテクノロジ (シャンハイ) カンパニー リミテッド 抗原ターゲティング、抗cd16aおよび免疫エフェクター細胞活性化の三機能性融合タンパク質ならびにその応用
JP2024532760A (ja) * 2021-08-11 2024-09-10 エイチシーダブリュー バイオロジックス インコーポレイテッド 多重鎖キメラポリペプチド及び肝疾患の治療におけるその使用
US12115191B2 (en) 2020-02-11 2024-10-15 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
EP4294422A4 (en) * 2021-02-17 2025-04-02 Cura Therapeutics, Inc. ANTI-PATHOGEN INTERLEUKIN-TGF-BETA RECEPTOR FUSION POLYPEPTIDES
US12280120B2 (en) 2020-11-25 2025-04-22 Xilio Development, Inc. Tumor-specific cleavable linkers
WO2025096644A1 (en) * 2023-10-31 2025-05-08 Immunitybio, Inc. Multi-chain chimeric polypeptides and use thereof in the treatment of advanced solid tumors
US12398189B2 (en) 2020-02-11 2025-08-26 HCW Biologics, Inc. Methods of activating regulatory T cells
US12497462B2 (en) 2020-04-29 2025-12-16 Immunitybio, Inc. Anti-CD26 proteins and uses thereof
US12594323B2 (en) 2022-04-13 2026-04-07 Immunitybio, Inc. Methods of reducing neuroinflammation

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11629340B2 (en) 2017-03-03 2023-04-18 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
CN111315395A (zh) 2017-09-06 2020-06-19 耶鲁大学 白细胞介素-18变体和使用方法
US11518792B2 (en) 2018-08-30 2022-12-06 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
JP2023527869A (ja) * 2020-06-01 2023-06-30 エイチシーダブリュー バイオロジックス インコーポレイテッド 加齢関連障害の治療法
WO2021247003A1 (en) * 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
USD986799S1 (en) * 2020-09-11 2023-05-23 Wind Craft Aviation Inc. Aircraft
CN114042154B (zh) * 2021-12-14 2024-08-16 澳门大学 一种药物组合在制备抗肿瘤的联合治疗药物中的应用
US20250092140A1 (en) * 2022-01-14 2025-03-20 Shenghe (China) Biopharmaceutical Co., Ltd. Bispecific antibody binding to b7h3 and nkp30, and application thereof
JP2025508939A (ja) * 2022-03-02 2025-04-10 イミュニティーバイオ インコーポレイテッド 膵臓癌の治療方法
JP7610308B2 (ja) * 2022-06-29 2025-01-08 メスキュージェナシス株式会社 ペプチド及び該ペプチドを含む会合体又は組成物
AU2024336545A1 (en) * 2023-09-08 2026-04-16 Northwestern University Chimeric antigen receptors with card domains
CN117924505B (zh) * 2024-03-25 2024-09-13 青岛宝迈得生物科技有限公司 一种重组hdac2蛋白单克隆抗体及其应用
WO2026043906A1 (en) * 2024-08-19 2026-02-26 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US20260049118A1 (en) * 2024-08-19 2026-02-19 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
CN120289652B (zh) * 2025-04-16 2026-02-13 广东拓普灵生物医药科技有限公司 一种nk细胞的制备方法及其在肿瘤免疫治疗中的应用

Citations (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995015341A1 (en) 1993-12-03 1995-06-08 Cancer Research Campaign Technology Limited Antibody against carcinoembryonic antigen (cea)
US6117980A (en) 1997-02-21 2000-09-12 Genentech, Inc. Humanized anti-IL-8 monoclonal antibodies
WO2003104425A2 (en) 2002-06-07 2003-12-18 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Novel stable anti-cd22 antibodies
WO2006096828A2 (en) * 2005-03-09 2006-09-14 Lind Stuart E Chimeric proteins with phosphatidylserine binding domains
US7452537B2 (en) 2005-04-26 2008-11-18 Agouron Pharmaceuticals, Inc. P-cadherin antibodies
US7482436B2 (en) 2002-08-30 2009-01-27 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman interleukin-6 antibody and fragment of antibody
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US7723482B2 (en) 2000-12-26 2010-05-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) Anti-CD28 antibody
WO2012040323A2 (en) * 2010-09-21 2012-03-29 Altor Bioscien Corporation Multimeric il-15 soluble fusion molecules and methods of making and using same
US20120171197A1 (en) 2007-12-21 2012-07-05 Medimmune Limited Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173
WO2012120125A1 (en) 2011-03-09 2012-09-13 Antitope Ltd Humanised anti ctla-4 antibodies
WO2012170470A1 (en) 2011-06-06 2012-12-13 Board Of Regents Of The University Of Nebraska Compositions and methods for detection and treatment of cancer
EP2537933A1 (en) * 2011-06-24 2012-12-26 Institut National de la Santé et de la Recherche Médicale (INSERM) An IL-15 and IL-15Ralpha sushi domain based immunocytokines
WO2012175692A1 (en) 2011-06-22 2012-12-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-axl antibodies and uses thereof
WO2013068946A2 (en) 2011-11-11 2013-05-16 Rinat Neuroscience Corp. Antibodies specific for trop-2 and their uses
US8552156B2 (en) 2010-06-11 2013-10-08 Kyowa Hakko Kirin Co., Ltd Anti-TIM-3 antibody
US20130274446A1 (en) 2010-08-12 2013-10-17 Tohoku University Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof
US8586714B2 (en) 2009-09-01 2013-11-19 Abbvie, Inc. Dual variable domain immunoglobulins and uses thereof
WO2014007513A1 (en) 2012-07-02 2014-01-09 Hanwha Chemical Corporation Novel monoclonal antibody binding specifically to dll4 and use thereof
WO2014026054A2 (en) 2012-08-10 2014-02-13 University Of Southern California CD20 scFv-ELPs METHODS AND THERAPEUTICS
US8716450B2 (en) 2009-10-15 2014-05-06 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US8722855B2 (en) 2009-10-28 2014-05-13 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US8735546B2 (en) 2010-08-03 2014-05-27 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US8741604B2 (en) 2008-11-07 2014-06-03 Medimmune Limited Nucleic acid molecule encoding a specific IL-1R1 antibody
US8753640B2 (en) 2011-05-31 2014-06-17 University Of Washington Through Its Center For Commercialization MIC-binding antibodies and methods of use thereof
US8759494B2 (en) 2009-09-25 2014-06-24 Gemoab Monoclonals Gmbh Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses
WO2014095808A1 (en) 2012-12-17 2014-06-26 Delenex Therapeutics Ag Antibodies against il-1 beta
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
US8822645B2 (en) 2008-07-08 2014-09-02 Abbvie Inc. Prostaglandin E2 dual variable domain immunoglobulins and uses thereof
WO2014159531A1 (en) 2013-03-14 2014-10-02 The Board Of Regents Of The University Of Texas System Monoclonal antibodies targeting epcam for detection of prostate cancer lymph node metastases
US9035026B2 (en) 2005-05-26 2015-05-19 Affimed Gmbh Anti-CD16 binding molecules
US9085623B2 (en) 2010-02-11 2015-07-21 Alexion Pharmaceuticals, Inc. Therapeutic methods using anti-CD200 antibodies
US9090684B2 (en) 2008-06-25 2015-07-28 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting VEGF
US20150259429A1 (en) 2012-08-28 2015-09-17 Institut Curie Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection
US9226962B2 (en) 2002-09-10 2016-01-05 Affimed Gmbh Human CD3-specific antibody with immunosuppressive properties
US9238084B2 (en) 2003-06-16 2016-01-19 Immunomedics, Inc. Anti-mucin antibodies for early detection and treatment of pancreatic cancer
US9273136B2 (en) 2008-08-04 2016-03-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Fully human anti-human NKG2D monoclonal antibodies
US9371395B2 (en) 2011-04-25 2016-06-21 Daiichi Sankyo Company, Limited Anti B7-H3 antibody
WO2016106221A1 (en) 2014-12-22 2016-06-30 The Rockefeller University Anti-mertk agonistic antibodies and uses thereof
US9441034B2 (en) 2008-03-27 2016-09-13 Zymogenetics, Inc. Compositions and methods for inhibiting PDGFRβ and VEGF-A
WO2016154585A1 (en) 2015-03-26 2016-09-29 Charles Sentman Anti-mica antigen binding fragments, fusion molecules, cells which express and methods of using
WO2016166348A1 (en) 2015-04-17 2016-10-20 Elsalys Biotech Anti-tyro3 antibodies and uses thereof
US20160340413A1 (en) 2012-08-08 2016-11-24 Roche Glycart Ag Interleukin-10 fusion proteins and uses thereof
US9505843B2 (en) 2014-01-29 2016-11-29 Samsung Electronics Co., Ltd. Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same
US20160367664A1 (en) 2015-08-06 2016-12-22 Agency For Science, Technology And Research IL2Rbeta/Common Gamma Chain Antibodies
US20170051063A1 (en) 2011-04-19 2017-02-23 Merrimack Pharmaceuticals, Inc. Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
US9617345B2 (en) 2012-11-20 2017-04-11 Sanofi Anti-CEACAM5 antibodies and uses thereof
WO2017083612A1 (en) 2015-11-13 2017-05-18 Dana-Farber Cancer Institute, Inc. An nkg2d-ig fusion protein for cancer immunotherapy
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US20170198042A1 (en) 2014-08-19 2017-07-13 Merck Sharp & Dohme Corp. Anti-tigit antibodies
WO2017149538A1 (en) 2016-03-01 2017-09-08 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to human poliovirus receptor (pvr)
WO2017189526A1 (en) 2016-04-25 2017-11-02 Musc Foundation For Research Development Activated cd26-high immune cells and cd26-negative immune cells and uses thereof
WO2018075989A1 (en) * 2016-10-21 2018-04-26 Altor Bioscience Corporation Multimeric il-15-based molecules

Family Cites Families (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6749853B1 (en) 1992-03-05 2004-06-15 Board Of Regents, The University Of Texas System Combined methods and compositions for coagulation and tumor treatment
US5595756A (en) * 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
AU702250B2 (en) 1994-07-11 1999-02-18 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
US20060235209A9 (en) 1997-03-10 2006-10-19 Jin-An Jiao Use of anti-tissue factor antibodies for treating thromboses
US20030109680A1 (en) 2001-11-21 2003-06-12 Sunol Molecular Corporation Antibodies for inhibiting blood coagulation and methods of use thereof
JP2001206899A (ja) 1999-11-18 2001-07-31 Japan Tobacco Inc TGF−βII型受容体に対するヒトモノクローナル抗体及びその医薬用途
AU2270101A (en) 1999-12-20 2001-07-03 Merck & Co., Inc. Pharmaceutical kit
ATE333900T1 (de) 2000-02-24 2006-08-15 Philogen Spa Zusamensetzungen und verfahren zur behandlung von angiogenese in pathologischen schädigungen
AU2001259215A1 (en) 2000-04-28 2001-11-12 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
PT1355919E (pt) 2000-12-12 2011-03-02 Medimmune Llc Moléculas com semivida longa, composições que as contêm e suas utilizações
US20040204481A1 (en) 2001-04-12 2004-10-14 Pnina Fishman Activation of natural killer cells by adenosine A3 receptor agonists
US7371371B2 (en) 2001-08-13 2008-05-13 University Of Southern California Interleukin-2 mutants with reduced toxicity
TWI338009B (en) 2001-10-29 2011-03-01 Genentech Inc Antibodies for inhibiting blood coagulation and methods of use thereof
US9321832B2 (en) 2002-06-28 2016-04-26 Domantis Limited Ligand
EP2357009A1 (en) * 2002-07-15 2011-08-17 Board of Regents, The University of Texas System Duramycin peptide binding to anionic phospholipids and aminophospholipids conjugates and their use in treating viral infections
US7563869B2 (en) 2003-01-23 2009-07-21 Ono Pharmaceutical Co., Ltd. Substance specific to human PD-1
WO2004076488A1 (en) 2003-02-27 2004-09-10 Theravision Gmbh A molecule which binds cd80 and cd86
KR20060015482A (ko) 2003-03-21 2006-02-17 와이어쓰 인터루킨-21/인터루킨-21 수용체의 작용제를 이용한면역장애의 치료
JP4638876B2 (ja) 2003-05-23 2011-02-23 ワイス Gitrリガンド及びgitrリガンド関連分子及び抗体及びその使用
JP2005124568A (ja) 2003-10-01 2005-05-19 Junichi Masuyama 細胞活性化方法及びこれを用いる細胞製造方法並びに医薬組成物
NZ549040A (en) 2004-02-17 2009-07-31 Schering Corp Use for interleukin-33 (IL33) and the IL-33 receptor complex
ES2375481T3 (es) 2004-03-30 2012-03-01 Yissum Research Development Company Of The Hebrew University Of Jerusalem Anticuerpos biespecíficos para elegir como diana células que participan en reacciones de tipo alérgico, composiciones y usos de los mismos.
WO2006086469A2 (en) 2005-02-08 2006-08-17 Genzyme Corporation Antibodies to tgfbeta
AU2006224313B2 (en) 2005-03-17 2011-08-11 Ucl Biomedica Plc Method for actvating Natural Killer cells by tumor cell preparation in vitro
CN100509849C (zh) 2005-04-07 2009-07-08 苏州大学 可溶性人cd28分子检测试剂盒及其应用
CN101203241B (zh) 2005-04-19 2012-02-22 西雅图基因公司 人源化抗-cd70结合物和其应用
ATE459648T1 (de) 2005-05-11 2010-03-15 Philogen Spa Fusionsprotein von antikörper l19 gegen fibronectin ed-b und interleukin 12
EP1777294A1 (en) 2005-10-20 2007-04-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) IL-15Ralpha sushi domain as a selective and potent enhancer of IL-15 action through IL-15Rbeta/gamma, and hyperagonist (IL15Ralpha sushi -IL15) fusion proteins
AU2009333580B2 (en) 2008-12-09 2016-07-07 Genentech, Inc. Anti-PD-L1 antibodies and their use to enhance T-cell function
WO2011127324A2 (en) 2010-04-08 2011-10-13 JN Biosciences, LLC Antibodies to cd122
WO2012051147A1 (en) 2010-10-11 2012-04-19 Abbott Laboratories Processes for purification of proteins
CN102153653B (zh) 2010-12-30 2012-08-15 厦门大学 肿瘤血管靶向多肽与组织因子的融合蛋白及其制备方法
SG10201603962TA (en) 2011-05-25 2016-07-28 Innate Pharma Sa Anti-kir antibodies for the treatment of inflammatory disorders
SG195253A1 (en) 2011-06-03 2013-12-30 Xoma Technology Ltd Antibodies specific for tgf-beta
EP4372084A3 (en) 2012-01-26 2024-08-14 Tecan Genomics, Inc. Compositions and methods for targeted nucleic acid sequence enrichment and high efficiency library generation
US10259626B2 (en) 2012-03-08 2019-04-16 Selig Sealing Products, Inc. Container sealing member with protected security component and removal tab
AU2013302696B9 (en) 2012-08-14 2018-08-09 Ibc Pharmaceuticals, Inc. T-cell redirecting bispecific antibodies for treatment of disease
EP2948475A2 (en) 2013-01-23 2015-12-02 AbbVie Inc. Methods and compositions for modulating an immune response
JP2015030666A (ja) 2013-07-31 2015-02-16 学校法人順天堂 抗ヒトcd26モノクローナル抗体又はその抗原結合性断片
CN103709251B (zh) 2013-12-19 2016-04-13 江苏众红生物工程创药研究院有限公司 全人源抗cd26抗体及其应用
EP3099717B1 (en) 2014-01-31 2019-03-27 Novartis AG Antibody molecules to tim-3 and uses thereof
CA2937034A1 (en) 2014-02-03 2015-08-06 Riken Anti-tissue factor monoclonal antibody
FR3021970B1 (fr) 2014-06-06 2018-01-26 Universite Sciences Technologies Lille Anticorps dirige contre la galectine 9 et inhibiteur de l'activite suppressive des lymphocytes t regulateurs
MY193723A (en) 2014-08-29 2022-10-27 Hoffmann La Roche Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1
KR101778439B1 (ko) 2015-04-27 2017-09-14 울산대학교 산학협력단 자연살해세포 활성화제를 유효성분으로 함유하는 면역증강 및 항암활성증진용 조성물
US10723793B2 (en) 2015-06-12 2020-07-28 Ludwig Institute For Cancer Research, Ltd. TGF-β3 specific antibodies and methods and uses thereof
KR20180061226A (ko) 2015-09-11 2018-06-07 와이즈에이씨가부시키가이샤 항cd26 항체와 다른 항암제를 조합한 암 치료용 조성물
CA2994858C (en) 2015-09-25 2024-01-23 Genentech, Inc. Anti-tigit antibodies and methods of use
JP2019511911A (ja) 2016-02-17 2019-05-09 ノバルティス アーゲー Tgfベータ2抗体
ES3014658T3 (en) 2016-10-05 2025-04-23 Univ Central Florida Res Found Inc Methods and compositions related to nk cell and anti-pdl1 cancer therapies
MX2019007981A (es) 2017-01-03 2019-10-15 Bioatla Llc Terapeutica de proteinas para el tratamiento de celulas senescentes.
TW202506185A (zh) 2017-01-20 2025-02-16 法商賽諾菲公司 抗TGF-β抗體及其用途
CN110461357A (zh) 2017-02-28 2019-11-15 阿菲姆德股份有限公司 抗cd16a抗体与细胞因子的组合
CN117986384A (zh) 2017-03-06 2024-05-07 艾尔特生物科技公司 与il-12和il-18的基于il-15的融合物
EP3601538A4 (en) 2017-03-27 2021-03-10 Nantcell, Inc. ANK AND IL-12 COMPOSITIONS AND METHODS
EP3421607A1 (en) 2017-06-29 2019-01-02 Fundación Centro Nacional de Investigaciones Oncológicas Carlos III Identification and elimination of damaged and/or senescent cells
EP3676289B1 (en) 2017-08-28 2026-03-04 Altor BioScience, LLC Il-15-based fusions to il-7 and il-21
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
CA3109361A1 (en) 2018-08-30 2020-03-05 HCW Biologics, Inc. Single-chain and multi-chain chimeric polypeptides and uses thereof
US11518792B2 (en) 2018-08-30 2022-12-06 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CN120924491A (zh) 2019-06-21 2025-11-11 免疫生物公司 多链嵌合多肽和其用途
WO2021163299A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Chromatography resin and uses thereof
AU2021220870A1 (en) 2020-02-11 2022-08-04 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
CA3169243A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
CN115836087A (zh) 2020-04-29 2023-03-21 Hcw生物科技公司 抗cd26蛋白及其用途
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2023201311A1 (en) 2022-04-13 2023-10-19 HCW Biologics, Inc. Multi-chain chimeric polypeptide for use in the treatment of treating neuroinflammatory disorder

Patent Citations (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995015341A1 (en) 1993-12-03 1995-06-08 Cancer Research Campaign Technology Limited Antibody against carcinoembryonic antigen (cea)
US6117980A (en) 1997-02-21 2000-09-12 Genentech, Inc. Humanized anti-IL-8 monoclonal antibodies
US7723482B2 (en) 2000-12-26 2010-05-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) Anti-CD28 antibody
WO2003104425A2 (en) 2002-06-07 2003-12-18 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Novel stable anti-cd22 antibodies
US7482436B2 (en) 2002-08-30 2009-01-27 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman interleukin-6 antibody and fragment of antibody
US9226962B2 (en) 2002-09-10 2016-01-05 Affimed Gmbh Human CD3-specific antibody with immunosuppressive properties
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US9238084B2 (en) 2003-06-16 2016-01-19 Immunomedics, Inc. Anti-mucin antibodies for early detection and treatment of pancreatic cancer
WO2006096828A2 (en) * 2005-03-09 2006-09-14 Lind Stuart E Chimeric proteins with phosphatidylserine binding domains
US7452537B2 (en) 2005-04-26 2008-11-18 Agouron Pharmaceuticals, Inc. P-cadherin antibodies
US9035026B2 (en) 2005-05-26 2015-05-19 Affimed Gmbh Anti-CD16 binding molecules
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US8258268B2 (en) 2005-08-19 2012-09-04 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US20120171197A1 (en) 2007-12-21 2012-07-05 Medimmune Limited Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173
US9441034B2 (en) 2008-03-27 2016-09-13 Zymogenetics, Inc. Compositions and methods for inhibiting PDGFRβ and VEGF-A
US9090684B2 (en) 2008-06-25 2015-07-28 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting VEGF
US8822645B2 (en) 2008-07-08 2014-09-02 Abbvie Inc. Prostaglandin E2 dual variable domain immunoglobulins and uses thereof
US9273136B2 (en) 2008-08-04 2016-03-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Fully human anti-human NKG2D monoclonal antibodies
US8741604B2 (en) 2008-11-07 2014-06-03 Medimmune Limited Nucleic acid molecule encoding a specific IL-1R1 antibody
US8586714B2 (en) 2009-09-01 2013-11-19 Abbvie, Inc. Dual variable domain immunoglobulins and uses thereof
US8759494B2 (en) 2009-09-25 2014-06-24 Gemoab Monoclonals Gmbh Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses
US8716450B2 (en) 2009-10-15 2014-05-06 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US8722855B2 (en) 2009-10-28 2014-05-13 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US9085623B2 (en) 2010-02-11 2015-07-21 Alexion Pharmaceuticals, Inc. Therapeutic methods using anti-CD200 antibodies
US8552156B2 (en) 2010-06-11 2013-10-08 Kyowa Hakko Kirin Co., Ltd Anti-TIM-3 antibody
US8735546B2 (en) 2010-08-03 2014-05-27 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US20130274446A1 (en) 2010-08-12 2013-10-17 Tohoku University Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof
WO2012040323A2 (en) * 2010-09-21 2012-03-29 Altor Bioscien Corporation Multimeric il-15 soluble fusion molecules and methods of making and using same
WO2012120125A1 (en) 2011-03-09 2012-09-13 Antitope Ltd Humanised anti ctla-4 antibodies
US20170051063A1 (en) 2011-04-19 2017-02-23 Merrimack Pharmaceuticals, Inc. Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
US9371395B2 (en) 2011-04-25 2016-06-21 Daiichi Sankyo Company, Limited Anti B7-H3 antibody
US8753640B2 (en) 2011-05-31 2014-06-17 University Of Washington Through Its Center For Commercialization MIC-binding antibodies and methods of use thereof
WO2012170470A1 (en) 2011-06-06 2012-12-13 Board Of Regents Of The University Of Nebraska Compositions and methods for detection and treatment of cancer
WO2012175692A1 (en) 2011-06-22 2012-12-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-axl antibodies and uses thereof
EP2537933A1 (en) * 2011-06-24 2012-12-26 Institut National de la Santé et de la Recherche Médicale (INSERM) An IL-15 and IL-15Ralpha sushi domain based immunocytokines
WO2013068946A2 (en) 2011-11-11 2013-05-16 Rinat Neuroscience Corp. Antibodies specific for trop-2 and their uses
WO2014007513A1 (en) 2012-07-02 2014-01-09 Hanwha Chemical Corporation Novel monoclonal antibody binding specifically to dll4 and use thereof
US20160340413A1 (en) 2012-08-08 2016-11-24 Roche Glycart Ag Interleukin-10 fusion proteins and uses thereof
WO2014026054A2 (en) 2012-08-10 2014-02-13 University Of Southern California CD20 scFv-ELPs METHODS AND THERAPEUTICS
US20150259429A1 (en) 2012-08-28 2015-09-17 Institut Curie Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection
US9617345B2 (en) 2012-11-20 2017-04-11 Sanofi Anti-CEACAM5 antibodies and uses thereof
WO2014095808A1 (en) 2012-12-17 2014-06-26 Delenex Therapeutics Ag Antibodies against il-1 beta
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014159531A1 (en) 2013-03-14 2014-10-02 The Board Of Regents Of The University Of Texas System Monoclonal antibodies targeting epcam for detection of prostate cancer lymph node metastases
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US9505843B2 (en) 2014-01-29 2016-11-29 Samsung Electronics Co., Ltd. Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same
US20170198042A1 (en) 2014-08-19 2017-07-13 Merck Sharp & Dohme Corp. Anti-tigit antibodies
WO2016106221A1 (en) 2014-12-22 2016-06-30 The Rockefeller University Anti-mertk agonistic antibodies and uses thereof
WO2016154585A1 (en) 2015-03-26 2016-09-29 Charles Sentman Anti-mica antigen binding fragments, fusion molecules, cells which express and methods of using
WO2016166348A1 (en) 2015-04-17 2016-10-20 Elsalys Biotech Anti-tyro3 antibodies and uses thereof
US20160367664A1 (en) 2015-08-06 2016-12-22 Agency For Science, Technology And Research IL2Rbeta/Common Gamma Chain Antibodies
WO2017083612A1 (en) 2015-11-13 2017-05-18 Dana-Farber Cancer Institute, Inc. An nkg2d-ig fusion protein for cancer immunotherapy
WO2017149538A1 (en) 2016-03-01 2017-09-08 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to human poliovirus receptor (pvr)
WO2017189526A1 (en) 2016-04-25 2017-11-02 Musc Foundation For Research Development Activated cd26-high immune cells and cd26-negative immune cells and uses thereof
WO2018075989A1 (en) * 2016-10-21 2018-04-26 Altor Bioscience Corporation Multimeric il-15-based molecules

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
AKBARI ET AL., PROTEIN EXPR. PURIF., vol. 127, 15 August 2016 (2016-08-15)
BISHWAJIT ET AL., CELLULAR IMMUNOL., vol. 170, no. 1, 1996, pages 25 - 33
CAO ET AL., BIOTECHNOL. LETT., vol. 37, no. 7, 2015, pages 1347 - 1354
COSMAN ET AL., IMMUNITY, vol. 14, no. 2, 2001, pages 123 - 133
COSTA ET AL., FRONT. IMMUNOL., vol. 9, 29 May 2018 (2018-05-29)
CROMIE ET AL., CURR. TOP. MED. CHEM., vol. 15, 2016, pages 2543 - 2557
DE GENST ET AL., DEV. COMP. IMMUNOL., vol. 30, 2006, pages 187 - 198
DE MEYER ET AL., TRENDS BIOTECHNOL., vol. 32, 2014, pages 263 - 270
DEYEV ET AL., NAT BIOTECHNOL., 2003, pages 1486 - 1492
DIGIAMMARINO ET AL., METHODS MOL. BIOL., vol. 899, 2012, pages 145 - 156
DREES ET AL., PROTEIN EXPRESS. PURIF., vol. 94, 2014, pages 60 - 66
EDWARDRAJA ET AL., BIOTECHNOL. BIOENG., vol. 106, no. 3, 2010, pages 367 - 375
GARBER, NATURE REVIEWS DRUG DISCOVERY, vol. 13, 2014, pages 799 - 801
GEJIMA ET AL., HUMAN ANTIBODIES, vol. 11, no. 4, 2002, pages 121 - 129
GENG ET AL., IMMUNOL. RES., vol. 62, no. 3, 2015, pages 377 - 385
GIBBS ET AL., BIOCHEMISTRY, vol. 33, no. 47, 1994, pages 14003 - 14010
HEBBAR ET AL., CLIN. EXP. IMMUNOL., vol. 136, 2004, pages 388 - 392
HENG ET AL., PLACENTA, vol. 57, 2017, pages 320
HOMACH ET AL., SCAND. J. IMMUNOL., vol. 48, no. 5, 1998, pages 497 - 501
HUANG ET AL., JBIOL CHEM, vol. 271, no. 36, 1996, pages 21752 - 21757
JAKOB ET AL., MABS, vol. 5, 2013, pages 358 - 363
KIJANKA ET AL., NANOMEDICINE, vol. 10, 2015, pages 161 - 174
KIRCHHOFER ET AL., BIOCHEMISTRY, vol. 39, no. 25, 2000, pages 7380 - 7387
KLEIN ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 27, no. 10, 2014, pages 325 - 330
KOVALEVA ET AL., EXPERT. OPIN. BIOL. THER., vol. 14, 2014, pages 1527 - 1539
KRAH ET AL., IMMUNOPHARMACOL. IMMUNOTOXICOL., vol. 38, 2016, pages 21 - 28
MANDELBOIM ET AL., NATURE, vol. 409, 2001, pages 1055 - 1060
MUJIC-DELIC ET AL., TRENDS PHARMACOL. SCI., vol. 35, 2014, pages 247 - 255
MÜLLER DAFNE ED - ZHANG YONGXIANG: "Antibody fusions with immunomodulatory proteins for cancer therapy", PHARMACOLOGY AND THERAPEUTICS, vol. 154, 3 July 2015 (2015-07-03), pages 57 - 66, XP029268143, ISSN: 0163-7258, DOI: 10.1016/J.PHARMTHERA.2015.07.001 *
MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235
MUYLDERMANS, ANN. REV. BIOCHEM., vol. 82, 2013, pages 775 - 797
MUYLDERMANS, J. BIOTECHNOL., vol. 74, 2001, pages 277 - 302
PARKER ET AL., PROTEIN EXPR. PURIF., vol. 89, no. 2, 2013, pages 136 - 145
PISTILLO ET AL., EXP. CLIN. IMMUNOGENET., vol. 14, no. 2, 1997, pages 123 - 130
PRIYANKA ET AL., PROTEIN SCI., vol. 22, no. 2, 2013, pages 153 - 167
RAHBARIZADEH ET AL., IMMUNOL. INVEST., vol. 40, 2011, pages 299 - 338
RANGANATHAN, PAC. SYMP BIOCOMPUT., 2000, pages 155 - 67
ROSSI ET AL., TRENDS PHARMACOL SCI., vol. 33, 2012, pages 474 - 481
ROSSI, PROC NATL ACAD SCI USA., vol. 103, 2006, pages 6841 - 6846
RUF ET AL., JBIOL CHEM, vol. 267, no. 31, 1992, pages 22206 - 22210
SCHULLEK ET AL., JBIOL CHEM, vol. 269, no. 30, 1994, pages 19399 - 19403
SHARKEY ET AL., CANCER RES., vol. 68, 2008, pages 5282 - 5290
SMITH ET AL., MOL. THER., vol. 26, no. 6, 2018, pages 1447 - 1456
SPIESS ET AL., MOL. IMMUNOL., vol. 67, 2015, pages 95 - 106
TAHARA-HANAOKA ET AL., INT. IMMUNOL., vol. 16, no. 4, 2004, pages 533 - 538
VAN AUDENHOVE ET AL., EBIOMEDICINE, vol. 8, 2016, pages 40 - 48
VAN BOCKSTAELE ET AL., CURR. OPIN. INVESTIG. DRUGS, vol. 10, 2009, pages 1212 - 1224
WASHBURN ET AL., PLOS ONE, vol. 6, no. 3, 2011, pages e 1843 9
WEBER ET AL., NATURE, vol. 356, no. 6372, 1992, pages 793 - 796
WESOLOWSKI ET AL., MED. MICROBIOL. IMMUNOL., vol. 198, 2009, pages 157 - 174
YUNG ET AL., AM. J. RESP. CRIT. CARE MED., vol. 194, no. 9, 2016, pages 1140 - 1151

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11672826B2 (en) 2018-08-30 2023-06-13 HCW Biologics, Inc. Methods of treating aging-related disorders
US11730762B2 (en) 2018-08-30 2023-08-22 HCW Biologics, Inc. Methods for stimulating proliferation or differentiation of an immune cell with a multi-chain chimeric polypeptide
US12516112B2 (en) 2018-08-30 2026-01-06 Immunitybio, Inc. Single-chain chimeric polypeptides and uses thereof
US12018071B2 (en) 2018-08-30 2024-06-25 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11987619B2 (en) 2018-08-30 2024-05-21 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11866476B2 (en) 2018-09-27 2024-01-09 Xilio Development, Inc. Masked IL-2-Fc fusion polypeptides
WO2020257639A1 (en) * 2019-06-21 2020-12-24 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
AU2020294797B2 (en) * 2019-06-21 2025-12-18 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US12479899B2 (en) 2019-06-21 2025-11-25 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US11738052B2 (en) 2019-06-21 2023-08-29 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US12398189B2 (en) 2020-02-11 2025-08-26 HCW Biologics, Inc. Methods of activating regulatory T cells
AU2021219720B2 (en) * 2020-02-11 2025-10-02 Immunitybio, Inc. Chromatography resin and uses thereof
US12115191B2 (en) 2020-02-11 2024-10-15 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
US12497462B2 (en) 2020-04-29 2025-12-16 Immunitybio, Inc. Anti-CD26 proteins and uses thereof
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
US12280120B2 (en) 2020-11-25 2025-04-22 Xilio Development, Inc. Tumor-specific cleavable linkers
JP2024510712A (ja) * 2021-02-13 2024-03-11 アカミス バイオ リミテッド Il-15をコードするアデノウイルス
EP4294422A4 (en) * 2021-02-17 2025-04-02 Cura Therapeutics, Inc. ANTI-PATHOGEN INTERLEUKIN-TGF-BETA RECEPTOR FUSION POLYPEPTIDES
US12329803B2 (en) 2021-02-17 2025-06-17 Cura Therapeutics Inc. Method of reducing or treating fibrosis by administering an interleukin-2/TGF-beta receptor fusion polypeptide
JP2024529494A (ja) * 2021-07-30 2024-08-06 クレ バイオテクノロジ (シャンハイ) カンパニー リミテッド 抗原ターゲティング、抗cd16aおよび免疫エフェクター細胞活性化の三機能性融合タンパク質ならびにその応用
JP2024532760A (ja) * 2021-08-11 2024-09-10 エイチシーダブリュー バイオロジックス インコーポレイテッド 多重鎖キメラポリペプチド及び肝疾患の治療におけるその使用
WO2023178333A1 (en) 2022-03-18 2023-09-21 WUGEN, Inc. Improved chimeric receptor constructs for nk cells
WO2023183853A1 (en) 2022-03-22 2023-09-28 WUGEN, Inc. Hybrid promoters, vectors containing same and methods of use
US12594323B2 (en) 2022-04-13 2026-04-07 Immunitybio, Inc. Methods of reducing neuroinflammation
WO2025096644A1 (en) * 2023-10-31 2025-05-08 Immunitybio, Inc. Multi-chain chimeric polypeptides and use thereof in the treatment of advanced solid tumors

Also Published As

Publication number Publication date
US12398186B2 (en) 2025-08-26
EP4659757A3 (en) 2026-01-14
NZ772550A (en) 2025-08-29
US20230272027A1 (en) 2023-08-31
JP7735373B2 (ja) 2025-09-08
US20240132561A1 (en) 2024-04-25
KR20210070287A (ko) 2021-06-14
US20210070826A1 (en) 2021-03-11
SG11202101779RA (en) 2021-03-30
US20240124543A1 (en) 2024-04-18
IL280918B1 (en) 2025-06-01
JP2024026248A (ja) 2024-02-28
CA3108949A1 (en) 2020-03-05
KR20250160211A (ko) 2025-11-11
AU2019328290A1 (en) 2021-02-25
TW202122416A (zh) 2021-06-16
IL280918B2 (en) 2025-10-01
KR102877278B1 (ko) 2025-11-03
AU2019328290B2 (en) 2024-10-10
US11884712B2 (en) 2024-01-30
US20240124544A1 (en) 2024-04-18
CN112996805A (zh) 2021-06-18
EP3844181A1 (en) 2021-07-07
EP3844181B1 (en) 2025-11-12
JP7397874B2 (ja) 2023-12-13
US12509494B2 (en) 2025-12-30
JP2025172844A (ja) 2025-11-26
US11518792B2 (en) 2022-12-06
US20210070825A1 (en) 2021-03-11
AU2024287134A1 (en) 2025-01-23
US12269854B2 (en) 2025-04-08
JP2021534828A (ja) 2021-12-16
IL280918A (en) 2021-04-29
TW202442672A (zh) 2024-11-01
EP4659757A2 (en) 2025-12-10
TWI851594B (zh) 2024-08-11
US20200071374A1 (en) 2020-03-05
US20230128292A1 (en) 2023-04-27
EP3844181C0 (en) 2025-11-12

Similar Documents

Publication Publication Date Title
US12509494B2 (en) Multi-chain chimeric polypeptides and uses thereof
KR102926972B1 (ko) Pd-l1 및 cd137에 결합하는 항체 분자
JP2020512814A (ja) 免疫抱合体
JP2023525032A (ja) T細胞阻害タンパク質を伴うおよび伴わない、aprilおよびbaff阻害免疫調節タンパク質、ならびにその使用方法
EP3980443A1 (en) Multispecific proteins
EP3013859A1 (en) Bispecific molecules capable of specifically binding to both ctla-4 and cd40
EP4021937A1 (en) Chimeric antigen receptor system and uses thereof
TWI916895B (zh) 多鏈嵌合多肽及其用途
HK40003232A (en) Novel bispecific polypeptides against cd137

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19766444

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3108949

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019328290

Country of ref document: AU

Date of ref document: 20190829

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021535496

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20217009434

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019766444

Country of ref document: EP

Effective date: 20210330

WWG Wipo information: grant in national office

Ref document number: 2019766444

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 772550

Country of ref document: NZ