WO2019051127A1 - MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF - Google Patents
MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF Download PDFInfo
- Publication number
- WO2019051127A1 WO2019051127A1 PCT/US2018/049803 US2018049803W WO2019051127A1 WO 2019051127 A1 WO2019051127 A1 WO 2019051127A1 US 2018049803 W US2018049803 W US 2018049803W WO 2019051127 A1 WO2019051127 A1 WO 2019051127A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- cell
- mmp
- epitope
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/06—Sulfuric ester hydrolases (3.1.6)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/605—MHC molecules or ligands thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16133—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10133—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
Definitions
- This application contains a sequence listing submitted electronically via EFS-web, which serves as both the paper copy and the computer readable form (CRF) and consists of a file entitled "123640-8001WO00_seqlist.txt", which was created on September 3, 2018, which is 196,180 bytes in size, and which is herein incorporated by reference in its entirety.
- An adaptive immune response involves the engagement of the T-cell receptor (TCR), present on the surface of a T-cell, with a small peptide antigen non-covalently presented on the surface of an antigen presenting cell (APC) by a major histocompatibility complex (MHC; also referred to in humans as a human leukocyte antigen (HLA) complex).
- TCR T-cell receptor
- APC antigen presenting cell
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- TCR is specific for a given epitope; however, the costimulatory protein is not epitope specific and instead is generally expressed on all T-cells or on large T-cell subsets.
- T-cell modulatory multimeric polypeptides (a "T-Cell-MMP” or multiple "T-Cell-MMPs") that in one embodiment comprise a portion of a MHC receptor and at least one immunomodulatory polypeptide (also referred to herein as a "MOD polypeptide” or simply, a "MOD”).
- a "MOD polypeptide” or simply, a "MOD”
- Any one or more of the MODs present in the T-Cell-MMP may be wild-type or a variant that exhibits reduced binding affinity to its cellular (e.g., T-cell surface) binding partner/receptor (generally referred to as a "Co-MOD").
- the T-Cell-MMPs comprise at least one chemical conjugation site at which a molecule comprising a target epitope (e.g., a peptide or non-peptide such as a carbohydrate) may be covalently bound for presentation to a cell bearing a T-cell receptor.
- a target epitope e.g., a peptide or non-peptide such as a carbohydrate
- T-Cell-MMPs comprising a chemical conjugation site for linking an epitope are useful for rapidly preparing T-Cell-MMP-epitope conjugates that can modulate the activity of T-cells specific to the epitope presented and, accordingly, for modulating an immune response in an individual involving those T-cells.
- T-Cell-MMPs and their epitope conjugates may additionally comprise sites for the conjugation of bioactive substances (payloads) such as chemotherapeutic agents for co-delivery with a specific target epitope.
- payloads such as chemotherapeutic agents for co-delivery with a specific target epitope.
- T- Cell-MMP-epitope conjugates may be considered a means by which to deliver immunomodulatory peptides (e.g., IL-2, 4-1BBL, FasL, TGFfi, CD70, CD80, CD86, OX40L, ICOS-L, ICAM, JAG1 or fragments thereof, or altered (mutated) variants thereof) and/or pay loads (e.g., chemotherapeutics) to cells in an epitope specific manner.
- immunomodulatory peptides e.g., IL-2, 4-1BBL, FasL, TGFfi, CD70, CD80, CD86, OX40L,
- the T-Cell-MMPs may comprise modifications that assist in the stabilization of the T-Cell-MMP during intracellular trafficking and/or following secretion by cells expressing the multimeric polypeptide even in the absence of an associated epitope peptide.
- the T-Cell-MMPs may include modifications that link the carboxyl end of the MHC-I ai helix and the amino end of the MHC-I 012 1 helix. Such modifications include the insertion of cysteine residues that result in the formation of disulfide linkages linking the indicated regions of those helices.
- cysteine residues at amino acid 84 (Y84C substitution) and 139 (A139C substitution) of MHC-I, or the equivalent positions relative to the sequences forming the helices may form a disulfide linkage that helps stabilize the T-Cell-MMP. See, e.g., Z. Hein et al. (2014), Journal of Cell Science 127:2885-2897.
- FIG. 1 depicts preferential activation of an epitope-specific T-cell to an epitope non-specific T- cell by an embodiment of a T-Cell-MMP of the present disclosure bearing a epitope attached by chemical coupling (denoted by "CC") to a ⁇ -2 microglobulin ( ⁇ 2 ⁇ ) polypeptide sequence.
- CC chemical coupling
- FIGs. 2A-2G provide amino acid sequences of immunoglobulin Fc polypeptides (SEQ ID NOs. 1-12).
- FIGs. 3A, 3B and 3C provide amino acid sequences of human leukocyte antigen (HLA) Class I heavy chain polypeptides. Signal sequences, amino acids 1-24, are bolded and underlined.
- Fig. 3 A entry: 3A.1 is the HLA-A alpha chain (HLA-A*01 :01 :01 :01) (NCBI accession NP_001229687.1), SEQ ID NO: 134; entry 3A.2 is from HLA-A* 1101 SEQ ID NO: 135; entry 3A.3 is from HLA-A*2402 SEQ ID NO: 136 and entry 3A.4 is from HLA-A*3303 SEQ ID NO: 137.
- HLA human leukocyte antigen
- FIG. 3D shows an alignment of eleven mature MHC Class I heavy chain peptide sequences without their leader sequences and without transmembrane domain regions.
- the aligned sequences include huma HLA-A, SEQ ID NO: 140 (see also SEQ ID NO: 134); HLA-B, SEQ ID NO: 141(see SEQ ID NO: 138); HLA-C, SEQ ID NO: 142 (see SEQ ID NO: 139); HLA-A*0201, SEQ ID NO: 143; a mouse H2K protein sequence, SEQ ID NO: 144; three variants of HLA-A (var.2, var.
- HLA-A*1101 HLA-A11
- HLA-A24 HLA- A*2402
- HLA-A24 HLA-A24
- HLA-A*3303 HLA-A33
- SEQ ID NO: 150 HLA- A*0201
- HLA-A(var. 2) is the Y84A and A236C variant of HLA-A.
- the 9th through the 11th sequences are from HLA-A11 (HLA-A* 1101), HLA- A24 (HLA-A*2402); and HLA-A33 (HLA-A*3303), respectively, which are prevalent in certain Asian populations.
- Indicated in the alignment are the locations (84 and 139 of the mature proteins) where cysteine residues may be inserted in place of the amino acid at that position for the formation of a disulfide bond to stabilize the MHC - ⁇ 2 ⁇ complex in the absence of a bound epitope peptide.
- position 236 (of the mature polypeptide), which may be replaced by a cysteine residue that can form an intra-chain disulfide bond with ⁇ 2 ⁇ (e.g., at aa 12 of the mature polypeptide).
- An arrow appears above each of those locations and the residues are bolded.
- the boxes flanking residues 84, 139 and 236 show the groups of five amino acids on either side of those six sets of five residues, denoted aa cluster 1, aa cluster 2, aa cluster 3, aa cluster 4, aa cluster 5, and aa cluster 6 (shown in the figure as aac 1 through aac 6, respectively), that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine.
- FIG. 4 provides a multiple amino acid sequence alignment of ⁇ 2 ⁇ precursors (i.e. , including the leader sequence) from Homo sapiens (NP_004039.1 ; SEQ ID NO: 151), Pan troglodytes
- Underlined amino acids 1-20 are the signal peptide (sometime referred to as a leader sequence).
- FIG. 5 provides four T-Cell-MMP embodiments marked as A through D.
- the T- Cell-MMPs comprise: a first polypeptide having an N-terminus and C-terminus and which comprises a first major histocompatibility complex (MHC) polypeptide (MHC-1); and a second polypeptide having an N-terminus and C-terminus and a second MHC polypeptide (MHC-2), and optionally comprising an immunoglobulin (Fc) polypeptide or a non-Ig polypeptide scaffold.
- MHC major histocompatibility complex
- Fc immunoglobulin
- first and second polypeptides are shown linked by a disulfide bond; however, the T-Cell-MMPs do not require a disulfide linkage or any other covalent linkage between the first and second polypeptides.
- the T-Cell-MMPs may also comprise independently selected linker sequences indicated by the dashed line
- Cell-MMP comprise at least one chemical conjugation site.
- Some potential locations for the first polypeptide chemical conjugation sites (CC-1) and second polypeptide chemical conjugation sites (CC- 2) are shown by arrows.
- Locations for one or more MODs that are selected independently e.g., a sequence comprising one, two, three or more MODs connected in sequence with optional amino acid linkers between the MODs
- the MODs may contain variant MODs denoted by MOD* elsewhere in this disclosure.
- the MOD(s) are located at the C-terminus of the first polypeptide
- in B the MOD(s) are located at the N-terminus of the second polypeptide
- in C the MOD(s) are located at the C-terminus of the second polypeptide
- in D the MODs, which may be the same or different, are located at the C-terminus of the first polypeptide and at the N-terminus of the second polypeptide.
- FIG. 6 provides eight embodiments of T-Cell-MMP epitope conjugates, marked as A through H, that parallel the embodiments in Fig. 5.
- the first polypeptide has an N-terminus and C- terminus with the first MHC polypeptide given as comprising a ⁇ -2-microglobulin polypeptide ( ⁇ 2 ⁇ capable of interacting with the MHC Class I heavy chain (MHC-H) and presenting the epitope to a T- Cell receptor.
- the second polypeptide has an N-terminus and C-terminus, a MHC-H polypeptide, and optionally comprises an immunoglobulin (Fc) polypeptide or a non-Ig polypeptide scaffold.
- Fc immunoglobulin
- the optional disulfide bond joining the first and second polypeptide of the T-Cell-MMP epitope conjugates is shown connecting the ⁇ 2 ⁇ peptide sequence and MHC-H peptide sequence in A to D, and the independently selected optional linker sequences, indicated by the dashed line ( ), are not required.
- the complexes in A to D are repeated, however a disulfide bond joining the first and second polypeptide is shown joining the MHC-H peptide sequence to a linker sequence interposed between the epitope and ⁇ 2 ⁇ peptide sequence (e.g., a bond from a Cys residue at position 84 of a MHC-H chain sequence (see Fig. 3) to the interposed linker).
- the first polypeptide, the second polypeptide, or both the first and second polypeptides of the T-Cell-MMP may also comprise one or more chemical conjugation sites in addition to the site employed for the conjugation of the epitope. The potential locations for such CC-1 and CC-2 are shown by arrows.
- the one or more immunomodulatory polypeptides are as described in Fig. 5.
- FIG. 7 provides examples of two dimers formed from T-Cell-MMPs.
- the dimer labeled “A” is the result of dimerizing two of the T-Cell-MMPs labeled “A” in Fig. 6.
- the dimer labeled “B” is the result of dimerizing two of the T-Cell-MMPs labeled "B” in Fig. 6.
- the embodiment as shown includes one or more disulfide bonds between the polypeptides, each of which are optional. In addition, only a subset of CC-2 sites in the Fc region or the attached optional linker are shown.
- FIG. 8 shows a schematic of hydrazinyl indoles reacting with an aldehyde containing polypeptide adapted from U.S. Pat. No. 9,310,374.
- FIG. 9 shows in part A a map of a T-Cell-MMP with the first polypeptide having a sulfatase motif as the location for developing a chemical conjugation site (an fGly residue) through the action of an FGE enzyme.
- FIG. 9 shows a second polypeptide of a T-Cell-MMP having tandem IL-2 MODs attached to the amino end of a human MHC Class I HLA-A heavy chain polypeptide followed by a human IgGl Fc polypeptide.
- FIG. 10A to FIG. 10 D show a series of HLA A* 1101 heavy chain constructs having, from N- terminus to C-terminus, a human IL-2 signal sequence, shown in underline and bold.
- the signal (leader) sequence is followed by a MOD, which is indicated as a human IL-2 or an "optional peptide linker-immunomodulatory polypeptide -optional peptide linker.” Where the MOD is not specified, it may be any desired MOD.
- the remainder of the sequence is HLA A*l 101 H chain sequence with three cysteine substitutions (Y84C; A139C; A236C); a linker; and a hlgGl Fc with two amino acid substitutions (L234A; L235A).
- the asterisk indicates stop to the sequence.
- FIG. 11A to FIG. HE shows a series of constructs comprising a human ⁇ 2 ⁇ polypeptide sequence.
- the constructs comprise from N-terminus to C-terminus: the leader sequence
- MSRSVALAVLALLSLSGLEA (bolded and underlined), an optional linker and sulfatase site and another independently selected linker as described in Examples 1 and 2, (linker)o-4XlZlX2Z2X3Z3(linker)o-4, and a human ⁇ 2 ⁇ sequence with an R12C amino acid modification (IQRTPKIQVYSCHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHS DLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM).
- IQRTPKIQVYSCHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHS DLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM Following co- expression in a mammalian cell with a MHC Class I heavy chain containing polypeptide, such as the peptides in FIG.
- the sulfatase sequence is enzymatically modified to contain a formyl glycine residue.
- a T-Cell-MMP conjugate can then be prepared by reacting the formyl glycine of the T-Cell-MMP with an HBV peptide (e.g., as shown in FIGs. 11 A-l IE) that have been modified to bear a hydrazinyl group (e.g., a hydrazinyl indole group) at, for example, their carboxyl terminus.
- polynucleotide and “nucleic acid,” used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- peptide refers to a polymeric form of amino acids of any length which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- a polynucleotide or polypeptide has a certain percent "sequence identity" to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences. Sequence identity can be determined in a number of different ways.
- sequences can be aligned using various convenient methods and computer programs (e.g., BLAST, T-COFFEE, MUSCLE, MAFFT, etc.), available over the world wide web at sites including ncbi.nlm.nili.gov/BLAST, ebi.ac.uk/Tools/msa/tcoffee/, ebi.ac.uk/Tools/msa/muscle/, and mafft.cbrc.jp/alignment/software/. See, e.g., Altschul et al. (1990), J. Mol. Biol. 215:403-10. Unless stated otherwise, sequence alignments are prepared using BLAST.
- amino acid and “amino acids” are abbreviated as “aa” and “aas,” respectively.
- Naturally occurring amino acid or naturally occurring amino acids means: L (Leu, leucine), A (Ala, alanine), G (Gly, glycine), S (Ser, serine), V (Val, valine), F (Phe,
- selenocysteine and hydroxyproline are naturally occurring amino acids that are specifically referred to in any instance where they are intended to be encompassed.
- Non-natural amino acids are any amino acid other than the naturally occurring amino acids recited above, selenocysteine, and hydroxyproline.
- “Chemical conjugation” as used herein means formation of a covalent bond.
- “Chemical conjugation site” as used herein means a location in a polypeptide at which a covalent bond can be formed, including any contextual elements (e.g., surrounding amino acid sequences) that are required or assist in the formation of a covalent bond to the polypeptide. Accordingly, a site comprising a group of amino acids that direct enzymatic modification, and ultimately covalent bond formation at an amino acid within the group, may also be referred to a chemical conjugation site. In some instances, as will be clear from the context, the term chemical conjugation site may be used to refer to a location where covalent bond formation or chemical modification has already occurred.
- a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide containing side chains consists of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; a group of amino acids having acidic side chains consists of glutamate and aspartate; and a group of amino acids having sulfur containing side chains consists of cysteine and methionine.
- Exemplary conservative amino acid substitution groups are: valine-leucine -isoleucine, phenylalanine -tyrosine, lysine-arginine, alanine -valine-glycine, and asparagine-glutamine.
- immunological synapse or “immune synapse” as used herein generally refer to the natural interface between two interacting immune cells of an adaptive immune response including, e.g., the interface between an APC, or target T-cell, and an effector cell, e.g., a lymphocyte, an effector T- cell, a natural killer cell, or the like.
- An immunological synapse between an APC and a T-cell is generally initiated by the interaction of a T-cell antigen receptor and one or more MHC molecules, e.g., as described in Bromley et al., Ann Rev Immunol. 2001 ; 19:375-96; the disclosure of which is incorporated herein by reference in its entirety.
- T-cell includes all types of immune cells expressing CD3, including T-helper cells (CD4 + cells), cytotoxic T-cells (CD8 + cells), T-regulatory cells (Treg), and NK-T -cells.
- first major histocompatibility complex (MHC) polypeptide or “first MHC polypeptide”
- second MHC polypeptide MHC heavy chain
- MHC-H MHC Class I receptor elements
- a "MOD” also termed a co-immunomodulatory or co-stimulatory polypeptide
- APC e.g., a dendritic cell, a B cell, and the like
- Co-MOD also termed a cognate co- immunomodulatory polypeptide or a cognate co-stimulatory polypeptide
- MODs include, but are not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, Fas ligand (FasL), inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds the Toll ligand receptor, and a ligand that specifically binds with B7-H3.
- a MOD also encompasses, inter alia, an antibody (or an antigen binding portion thereof such as an Fab) that specifically binds with a Co MOD present on a T-cell, such as, but not limited to, CD27, CD28, 4-lBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83.
- an antibody or an antigen binding portion thereof such as an Fab
- a Co MOD present on a T-cell such as, but not limited to, CD27, CD28, 4-lBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83.
- An "immunomodulatory domain" ("MOD) of a T-Cell-MMP is a polypeptide of the T-Cell- MMP that acts as a MOD.
- Heterologous means a nucleotide or polypeptide that is not found in the native nucleic acid or protein, respectively.
- Recombinant means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, polymerase chain reaction (PCR) and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems.
- DNA sequences encoding polypeptides can be assembled from cDNA fragments, or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system.
- recombinant expression vector and "DNA construct” are used interchangeably herein to refer to a DNA molecule comprising a vector and at least one insert.
- Recombinant expression vectors are usually generated for the purpose of expressing and/or propagating the insert(s), or for the construction of other recombinant nucleotide sequences.
- the insert(s) may or may not be operably linked to a promoter sequence and may or may not be operably linked to DNA regulatory sequences.
- affinity refers to the equilibrium constant for the reversible binding of two agents (e.g., an antibody and an antigen) and is expressed as a dissociation constant (KD).
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40- fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1,000-fold greater, or more than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- nM nanomolar
- pM picomolar
- fM femtomolar
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen-binding fragments.
- Binding refers to a non- covalent interaction(s) between the molecules.
- Non-covalent binding refers to a direct association between two molecules, due to, for example, electrostatic, hydrophobic, ionic, and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- Non-covalent binding interactions are generally characterized by a dissociation constant (KD) of less than 10 6 M, less than 10 -7 M, less than 10 -8 M, less than 10 -9 M, less than 10 -10 M, less than 10 -11 M, or less than 10 12 M.
- KD dissociation constant
- Affinity refers to the strength of non-covalent binding, increased binding affinity being correlated with a lower KD.
- Specific binding generally refers to, e.g., binding between a ligand molecule and its binding site or "receptor” with an affinity of at least about 10 7 M or greater, (e.g., less than 5x 10 -7 M, less than 10 -8 M, less than 5 x 10 -8 M, less than 10 -9 M, less than 10 -10 M, less than 10 -11 M, or less than 10 12 M and greater affinity, or in a range fromlO 7 to 10 or from 10 to 10 12 ).
- Non-specific binding generally refers to the binding of a ligand to something other than its designated binding site or "receptor,” typically with an affinity of less than about 10 -7 M (e.g., binding with an affinity of less than about 10 6 M, less than about 10 -5 M, less than about 10 -4 M).
- specific binding can be in the range of from 1 ⁇ to 100 ⁇ , or from 100 ⁇ to 1 mM.
- Covalent binding as used herein means the formation of one or more covalent chemical bonds between two different molecules
- treatment means obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease or symptom in a mammal and includes: (a) preventing the disease or symptom from occurring in a subject which may be predisposed to acquiring the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease or symptom, i.e.
- the therapeutic agent may be administered before, during and/or after the onset of disease or injury.
- the treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
- the subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
- Mammals include, e.g., humans, non-human primates, rodents (e.g., rats; mice), lagomorphs (e.g., rabbits), ungulates (e.g., cows, sheep, pigs, horses, goats, and the like), etc.
- rodents e.g., rats; mice
- lagomorphs e.g., rabbits
- ungulates e.g., cows, sheep, pigs, horses, goats, and the like
- T-Cell Modulatory Multimeric Polypeptides T-Cell-MMPs
- Chemical Conjugation T-Cell-MMPs
- the present disclosure provides T-Cell-MMPs and their epitope conjugates that are useful for modulating the activity of a T-cell, and methods of their preparation and use in modulating an immune response in an individual.
- the T-Cell-MMPs may comprise one or more independently selected wild- type and/or variant MOD polypeptides that exhibit reduced binding affinity to their Co-MODs and chemical conjugation sites for coupling epitopes and payloads.
- T-Cell- MMPs that are heterodimeric, comprising two types of polypeptides (a first polypeptide and a second polypeptide), wherein at least one of those polypeptides comprises a chemical conjugation site for the attachment (e.g., covalent attachment) of payloads such as chemotherapeutic agents and/or materials (e.g., epitope peptides and null peptides) that can bind a TCR.
- payloads such as chemotherapeutic agents and/or materials (e.g., epitope peptides and null peptides) that can bind a TCR.
- T- Cell-MMPs which have been chemically conjugated to an epitope and/or a payload (e.g., a
- the T-cell can respond by undergoing activation including, for example, clonal expansion (e.g., when activating MODs such as IL-2, 4-1BBL and/or CD80 are incorporated into the T-Cell-MMP).
- the T-cell may undergo inhibition that down regulates T-cell activity (e.g., blocking autoimmune reactions) when MODs such as CD86 and/or PD-L1 are incorporated into the T-Cell-MMPs.
- MODs are not specific to any epitope, activation or inhibition of T-cells can be biased toward epitope-specific interactions by incorporating variant MODs having reduced affinity for their Co-MOD into the T-Cell-MMPs such that the binding of a T-Cell-MMP to a T-cell is strongly affected by, or even dominated by, the MHC-epitope-TCR interaction.
- a T-Cell-MMP-epitope conjugate functions as a surrogate APC, and mimics the adaptive immune response.
- the T-Cell-MMP-epitope conjugate does so by engaging a TCR present on the surface of a T-cell with a covalently bound epitope presented in the T- Cell-MMP-epitope conjugate complex. This engagement provides the T-Cell-MMP-epitope conjugate with the ability to achieve epitope-specific cell targeting.
- T-Cell- MMP-epitope conjugates also possess at least one MOD that engages a counterpart costimulatory protein (Co-MOD) on the T-cell. Both signals - epitope/MHC binding to a TCR and MOD binding to a Co-MOD - then drive both the desired T-cell specificity and either inhibition or activation/proliferation.
- Co-MOD costimulatory protein
- the T-Cell-MMPs having chemical conjugation sites find use as a platform into which different epitopes and/or payloads may be inserted to prepare materials for therapeutic, diagnostic and research applications.
- Such T-Cell-MMPs comprising a chemical conjugation site permit the rapid preparation of diagnostics and therapeutics as they permit the epitope containing material (e.g., a peptide) to be rapidly inserted into the T-Cell-MMP and tested for activation or inhibition of T-cells bearing TCRs specific to the epitope.
- a chemical conjugation site of such a T-Cell-MMP may be utilized to attach a payload such as a chemotherapeutic agent or enzyme to the T-Cell-MMP.
- a payload such as a chemotherapeutic agent or enzyme
- the resulting complex may be used in a fashion similar to an antibody to deliver the payload, particularly when the T-Cell-MMPs form multimers (e.g., dimers or higher order structures) due to the incorporation of an Fc scaffold.
- the MODs of T-Cell-MMP-payload conjugates will dictate the cells that will receive the payload by their binding specificity and the avidity of the complex for different cells.
- contacting the T-cells with at least one concentration of the T-Cell- MMP induces at least a twofold (e.g., at least a 2, 3, 4, 5, 10, 20, 30, 50, 75, or 100 fold) difference in the activation of T-cells (as measured by T-cell proliferation or ZAP-70 activity, see e.g., Wang, et al, Cold Spring Harbor perspectives in biology 2.5 (2010): a002279) having a TCR specific to the epitope, as compared to T-cells contacted with the same concentration of the T-Cell-MMP that do not have a TCR specific to the epitope.
- a twofold e.g., at least a 2, 3, 4, 5, 10, 20, 30, 50, 75, or 100 fold
- contacting the T-cells with at least one concentration of the T-Cell- MMP prevents activation of T-cells in an epitope specific manner as measured by T-cell proliferation).
- T-Cell-MMPs into which an epitope has been incorporated will depend on the relative contributions of the epitope and MODs to the binding. Where the MODs dominate the binding interactions the specificity of the T-Cell-MMP of T-cells specific to the epitope will be reduced relative to T-Cell-MMP complexes where the epitope dominates the binding interactions by
- the use of variant MODs with reduced affinity for their Co-MODs will favor epitope selective interactions of the T-Cell-MMP-epitope conjugates, and also facilitate selective delivery of any payload that may be conjugated to the T-Cell- MMP-epitope conjugate.
- the T-Cell-MMPs described as either lacking an epitope or containing a null peptide may be employed to deliver a payload to target cells bearing receptors for the MODs and/or variant MODs present in the T-Cell-MMPs.
- T-Cell-MMPs bearing MODs inhibitory to T-cell activation and/or proliferation that lack an epitope (or contain a null peptide) may be used as simulators of T-cells that contain one or more receptors for the MOD or variant MODs present in the T-Cell-MMP.
- Such stimulatory T-Cell-MMPs may be used to simultaneously deliver a payload (e.g., a chemically conjugated chemotherapeutic) to the T-cells to which it binds.
- T-Cell-MMPs bearing MODs inhibitory to T-cell activation and/or proliferation that lack an epitope (or that contain a null peptide) may be used as an immunosuppressant alone or in conjunction with other immunosuppressants such as cyclosporine to suppress immune reactions (e.g., prevent graft-v-host or host-v-graft rejection).
- Such inhibitory T-Cell-MMPs may be used to simultaneously deliver a payload (e.g., a chemically conjugated chemotherapeutic) to the T- cells to which it binds
- the present disclosure provides T-Cell-MMPs that are useful for modulating the activity of a T- cell and, accordingly, for modulating an immune response in an individual.
- the T-Cell-MMPs comprise a MOD that exhibits reduced binding affinity to a Co-MOD.
- T-Cell-MMP frameworks described herein comprise at least one chemical conjugation site on either the first polypeptide chain or the second polypeptide chain.
- the present disclosure provides a T-Cell-MMP comprising a heterodimer comprising: a) a first polypeptide comprising: a first MHC polypeptide; b) a second polypeptide comprising a second MHC polypeptide; c) at least one of first or second polypeptides comprises a chemical conjugation site, and d) at least one MOD, where the first and/or the second polypeptide comprises the at least one MOD (e.g., one, two, three, or more).
- the first or the second polypeptide comprises an Ig Fc polypeptide or a non-Ig scaffold.
- One or more of the MODs may be a variant MOD that exhibits reduced affinity to a Co-MOD compared to the affinity of a corresponding wild-type MOD for the Co-MOD.
- the disclosure also provides T-Cell- MMPs in which an epitope (e.g., a peptide bearing an epitope) is covalently bound (directly or indirectly) to the chemical conjugation site forming a T-Cell-MMP-epitope conjugate.
- the epitope (e.g., epitope peptide) present in a T-Cell-MMP epitope conjugate of the present disclosure may bind to a T-cell receptor (TCR) on a T-cell with an affinity of at least 100 ⁇ (e.g., at least 10 ⁇ , at least 1 ⁇ , at least 100 nM, at least 10 nM, or at least 1 nM).
- TCR T-cell receptor
- a T-Cell-MMP epitope conjugate may bind to a first T-cell with an affinity that is at least 25% higher than the affinity with which the T-Cell-MMP epitope conjugate binds to a second T-cell, where the first T-cell expresses on its surface the Co-MOD and a TCR that binds the epitope with an affinity of at least 100 ⁇ , and where the second T-cell expresses on its surface the Co-MOD but does not express on its surface a TCR that binds the epitope with an affinity of at least 100 ⁇ (e.g., at least 10 ⁇ , at least 1 ⁇ , at least 100 nM, at least 10 nM, or at least 1 nM).
- the present disclosure provides a heterodimeric T-Cell-MMP (which may form higher level multimers, dimers, trimers, etc. of the heterodimers) comprising:
- a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide and ii) an optional immunoglobulin (Ig) Fc polypeptide scaffold or a non-Ig polypeptide scaffold;
- each of the one or more MODs is an independently selected wild-type or variant MOD.
- T-Cell-MMP frameworks act as a platform on which epitopes (e.g., polypeptide epitopes) can be covalently attached through a linkage to one of the first or second chemical conjugation sites bound to at least one of the first and second MHC polypeptides forming a T-Cell-MMP-epitope conjugate.
- epitopes e.g., polypeptide epitopes
- TCR T-cell receptor
- chemotherapeutics can similarly be attached to a T-Cell-MMP by covalent attachment to one of the first or second chemical conjugation sites (e.g., a site not employed for attachment of an epitope).
- the T-Cell-MMPs may multimerize.
- the complexes may be in the form of dimers (see, e.g., Fig. 7), trimers, tetramers, or pentamers.
- Compositions comprising multimers of T- Cell-MMPs may also comprise monomers and, accordingly may comprise monomers, dimers, trimers, tetramers, pentamers, or combinations of any thereof (e.g., a mixture of monomers and dimers).
- the MODs are independently selected wild-type MODs or variant MODs presented in a T-Cell-MMP that optionally comprises an epitope.
- the MODs are one or more MODs or variant MODs capable of stimulating epitope-specific T-cell activation/proliferation (e.g., IL-2, 4-1BBL and/or CD80).
- the MODs are one or more MODs or variant MODs capable of inhibiting T-cell activation/proliferation (e.g., FAS-L and/or PD-L1).
- such activating or inhibitory MODs are capable of epitope-specific T-cell action, particularly where the MODs are variant MODs and the MHC-epitope-TCR interaction is sufficiently strong to dominate the interaction of the T-Cell-MMP with the T-cells.
- the T-Cell-MMPs described herein comprise at least one chemical conjugation site.
- the T-Cell-MMPs comprise more than one chemical conjugation site, there may be two or more conjugation sites on the first polypeptide (first polypeptide chemical conjugation sites), two or more conjugation sites on the second polypeptide (second polypeptide chemical conjugation sites), or at least one first polypeptide chemical conjugation site and at least one second polypeptide chemical conjugation site.
- first polypeptide chemical conjugation sites (indicated as CC-1) and second polypeptide chemical conjugation sites (indicated as CC-1) are shown in Figs. 5-7.
- the first polypeptide of the T-Cell-MMPs comprise: a first MHC polypeptide without a linker on its N-terminus and C-terminus; a first MHC polypeptide bearing a linker on its N- terminus; a first MHC polypeptide bearing a linker on its C-terminus, or a first MHC polypeptide bearing a linker on its N-terminus and C-terminus.
- At least one of the one or more first polypeptide chemical conjugation sites is: a) attached to (e.g., at the N-or C-terminus), or within, the sequence of the first MHC polypeptide when the first MHC polypeptide is without a linker on its N- and C-terminus; b) attached to, or within, the sequence of the first MHC polypeptide, where the first MHC polypeptide comprises a linker on its N- and C-terminus; c) attached to, or within, the sequence of a linker on the N- terminus of the first MHC polypeptide; and/or d) attached to, or within, the sequence of a linker on the C-terminus of the first MHC polypeptide.
- Additional first polypeptide chemical conjugation sites of a T-Cell-MMP may be present at (attached to or within) any location on the first polypeptide (e.g., more than one enzyme modification sequence serving as a site for chemical conjugation), including the first MHC polypeptide or in any linker attached to it.
- the first MHC polypeptide may comprise a ⁇ 2 ⁇ polypeptide sequence as described below.
- the second polypeptide of the T-Cell-MMPs comprise: a second MHC polypeptide without a linker on its N-terminus and C-terminus; a second MHC polypeptide bearing a linker on its N-terminus; a second MHC polypeptide bearing a linker on its C-terminus, or a second MHC polypeptide bearing a linker on its N-terminus and C-terminus.
- At least one of the one or more second polypeptide chemical conjugation sites is: a) attached to (e.g., at the N-or C-terminus), or within, the sequence of the second MHC polypeptide when the second MHC polypeptide is without a linker on its N- and C-terminus; b) attached to, or within, the sequence of the second MHC polypeptide where the second MHC polypeptide comprises a linker on its N- and C-terminus; c) attached to, or within, the sequence of the linker on the N-terminus of the second MHC polypeptide; and/or d) attached to, or within, the sequence of the linker on the C-terminus of the second MHC polypeptide.
- the second polypeptide when the second polypeptide contains an immunoglobulin (Fc) polypeptide aa sequence or a non-Ig polypeptide scaffold, along with an additional linker attached thereto, the second polypeptide chemical conjugation sites may be attached to or within the second MHC polypeptide, the immunoglobulin polypeptide, the polypeptide scaffold, or the attached linker. Additional second polypeptide chemical conjugation sites of a T-Cell-MMP may be present at (attached to or within) any location on the second polypeptide (e.g., more than one enzyme modification sequence serving as a site for chemical conjugation), including the second MHC polypeptide or in any linker attached to it.
- the second MHC polypeptide may comprise a MHC heavy chain (MHC-H) polypeptide sequence as described below.
- the first and second MHC polypeptides may be selected to be Class I MHC polypeptides, with the first MHC polypeptide comprising a ⁇ 2 ⁇ polypeptide sequence and the second polypeptide comprising a MHC heavy chain sequence, wherein there is at least one chemical conjugation site on the first or second polypeptide.
- at least one of the one or more first chemical conjugation sites in the T-Cell-MMP may be attached to (including at the N- or C- terminus) or within either the ⁇ 2 ⁇ polypeptide or the linker attached to its N-terminus or C-terminus.
- at least one of the one or more second polypeptide chemical conjugation sites in the T-Cell-MMP may be attached to (including at the N- or C-terminus) or within: the MHC-H
- both the first and second polypeptides comprise at least one chemical conjugation site.
- the sequence may have at least 85% amino acid sequence identity (e.g., at least 90%, 95%, 98% or 99% identity, or even 100% identity) to one of the amino acid sequences set forth in FIG. 4.
- the ⁇ 2 ⁇ polypeptide may comprise an amino acid sequence having at least 20, 30, 40, 50, 80, 100, or 110 contiguous amino acids with identity to a portion of an amino acid sequence set forth in Fig 4.
- the chemical conjugation sequences can be attached to the ⁇ 2 ⁇ polypeptide (e.g., at the N- and/or C- termini or linkers attached thereto) or within the ⁇ 2 ⁇ polypeptide.
- the T-Cell-MMP comprises a MHC-H polypeptide
- it may be a HLA-A, a HLA-B, or a HLA-C heavy chain.
- the MHC-H polypeptide may comprise an amino acid sequence having at least 85% amino acid sequence identity (e.g., at least 90%, 95%, 98% or 99% identity, or even 100% identity) to the amino acid sequence set forth in one of FIGs. 3A-3D.
- the MHC Class I heavy chain polypeptides may comprise an amino acid sequence having at least 20, 30, 40, 50, 80, 100, 150, 200, 250, 300, or 330 contiguous amino acids with identity to a portion of an amino acid sequence set forth in FIGs. 3A-3D.
- the chemical conjugation sequences can be attached (e.g., at the N- and/or C- termini or linkers attached thereto) or within the MHC-H polypeptides.
- the second polypeptide of the T-Cell-MMP may comprise an Ig Fc polypeptide sequence that can act as part of a molecule scaffold providing structure and the ability to multimerize to the T-Cell- MMP (or its epitope conjugate) and, in addition, potential locations for chemical conjugation.
- the Ig Fc polypeptide is an IgGl Fc polypeptide, an IgG2 Fc polypeptide, an IgG3 Fc polypeptide, an IgG4 Fc polypeptide, an IgA Fc polypeptide, or an IgM Fc polypeptide.
- the Ig Fc polypeptide may comprise an amino acid sequence that has at least 85%, 90%, 95%, 98, or 99%, or even 100%, amino acid sequence identity to an amino acid sequence depicted in one of FIGs. 2A-2D.
- Ig Fc polypeptides may comprise a sequence having at least 20, 30, 40, 50, 60, 80, 100, 120, 140, 160, 180, 200, or 220 contiguous amino acids with identity to a portion of an amino acid sequence in Fig. 2.
- the polypeptide may also comprise one or more amino acid substitutions selected from N297A, L234A, L235A, L234F, L235E, and P331S.
- the IgGl Fc polypeptide comprises L234A and L235A substitutions either alone or in combination with a second polypeptide chemical conjugation site.
- the chemical conjugation sites can be located/attached at the N- and/or C- termini or to linkers attached thereto, or within the Ig Fc polypeptides.
- the first and second polypeptide chemical conjugation sites of the T-Cell-MMPs may be any suitable site that can be modified upon treatment with a reagent and/or catalyst such as an enzyme that permits the formation of a covalent linkage to either one or both of the T-Cell-MMP polypeptides.
- a reagent and/or catalyst such as an enzyme that permits the formation of a covalent linkage to either one or both of the T-Cell-MMP polypeptides.
- each first and second polypeptide chemical conjugation site is selected such that there is only one type of conjugation site (different conjugation sites) on the respective polypeptides, permitting different molecules to be selectively conjugated to each of the polypeptides.
- a T-Cell-MMP may have one first polypeptide chemical conjugation site (e.g., for conjugating an epitope) and multiple second polypeptide chemical conjugation sites for delivering molecules of payload.
- the first and second chemical conjugation sites may be selected independently from:
- peptide sequence attached to or within the first or second polypeptide that acts as an enzyme modification sequence e.g., sulfatase, sortase, and/or transglutaminase sequences
- enzyme modification sequence e.g., sulfatase, sortase, and/or transglutaminase sequences
- non-natural amino acids and/or selenocysteines attached to or within the first or second polypeptide
- carbohydrate or oligosaccharide moieties attached to the first or second polypeptide; and e) IgG nucleotide binding sites attached to or within the first or second polypeptide.
- At least one of the one or more first and second chemical conjugation sites may comprise a sulfatase motif.
- Sulfatase motifs are usually 5 or 6 amino acids in length, and are described, for example, in U.S. Pat. No. 9,540,438 and U.S. Pat. Pub. No. 2017/0166639 Al, which are incorporated by reference. Insertion of the motif results in the formation of a protein or polypeptide that is sometimes referred to as aldehyde tagged or having an aldehyde tag.
- the motif may be acted on by formylglycine generating enzyme(s) ("FGE” or “FGEs”) to convert a cysteine or serine in the motif to a formylglycine residue ("fGly” although sometimes denoted "FGly”), which is an aldehyde containing amino acid that may be utilized for selective (e.g., site specific) chemical conjugation reactions.
- FGE formylglycine generating enzyme
- aldehyde tag or “aldehyde tagged” polypeptides refer to an amino acid sequence comprising an unconverted sulfatase motif, as well as to an amino acid sequence comprising a sulfatase motif in which the cysteine or the serine residue of the motif has been converted to fGly by action of an FGE.
- a sulfatase motif is provided in the context of an amino acid sequence, it is understood as providing disclosure of both the amino acid sequence (e.g., polypeptide) containing the unconverted motif as well as its fGly containing counterpart.
- a fGly residue may be reacted with molecules (e.g., epitope peptides) comprising a variety of reactive groups including, but not limited to thiosemicarbazide, aminooxy, hydrazide, and hydrazino groups to form a conjugate (e.g., a T-Cell- MMP epitope conjugate) having a covalent bond between the peptide and the molecule via the fGly residue.
- molecules e.g., epitope peptides
- molecules e.g., epitope peptides
- reactive groups including, but not limited to thiosemicarbazide, aminooxy, hydrazide, and hydrazino groups
- the sulfatase motif is at least 5 or 6 aa residues, but can be, for example, from 5 to 16 (e.g., 6-16, 5-14, 6-14, 5-12, 6-12, 5-10, 6-10, 5-8, or 6-8) aa in length.
- the sulfatase motif may be limited to a length less than 16, 14, 12, 10, or 8 amino acid residues.
- the sulfatase motif contains the sequence shown in Formula (I):
- Zl is cysteine or serine
- Z2 is either a proline or alanine residue (which can also be represented by "P/A");
- Z3 is a basic amino acid (arginine, lysine, or histidine, usually lysine), or an aliphatic amino acid
- XI is present or absent and, when present, can be any amino acid, though usually an aliphatic amino acid, a sulfur-containing amino acid, or a polar uncharged amino acid (e.g., other than an aromatic amino acid or a charged amino acid), usually L, M, V, S or T, more usually L, M, S or V, with the proviso that, when the sulfatase motif is at the N-terminus of the target polypeptide, XI is present; and
- X2 and X3 independently can be any amino acid, though usually an aliphatic amino acid, a polar, uncharged amino acid, or a sulfur containing amino acid (e.g., other than an aromatic amino acid or a charged amino acid), usually S, T, A, V, G or C, more usually S, T, A, V or G.
- FGly containing polypeptides may be prepared using a sulfatase motif having Formula I, where:
- Zl is cysteine or serine
- Z2 is a proline or alanine residue
- Z3 is an aliphatic amino acid or a basic amino acid
- XI is present or absent and, when present, is any amino acid, with the proviso that, when the sulfatase motif is at an N-terminus of the polypeptide, XI is present;
- X2 and X3 are each independently any amino acid, wherein the sequence is within or adjacent to a solvent accessible loop region of the Ig constant region, and wherein the sequence is not at the C-terminus of the Ig heavy chain.
- XI of the sulfatase motif may be provided by an amino acid of the sequence in which the target polypeptide is incorporated. Accordingly, in some embodiments, where the motif is present at a location other than the N-terminus of a target polypeptide, the sulfatase motif may be of the formula:
- peptides containing a sulfatase motif are being prepared for conversion into fGly- containing peptides by a eukaryotic FGE, for example by expression and conversion of the peptide in a eukaryotic cell or cell free system using a eukaryotic FGE, sulfatase motifs amenable to conversion by a eukaryotic FGE may advantageously be employed.
- sulfatase motifs amenable to conversion by a eukaryotic FGE contain a cysteine and proline at Zl and Z2 respectively in Formula (I) above (e.g., X1CX2PX3Z3, SEQ ID NO:47); and in CX2PX3Z3, SEQ ID NO:48 (encompassed by Formula (II) above).
- Peptides bearing those motifs can be modified by "SUMFl-type" FGEs.
- the sulfatase motif may comprise an amino acid sequence selected from the group consisting of:
- X1CX2PX3K or CX2PX3K SEQ ID NOs:47 and 48, where Z3 is K, and XI is present or absent;
- X1CX2PX3H or CX2PX3H (SEQ ID NOs:47 and 48, where Z3 is H, and XI is present or absent);
- the sulfatase motif comprises the sequence: X1C(X2)P(X3)Z3 (see SEQ ID NO:47), where:
- XI is present or absent and, when present, is any amino acid, provided that, when the sulfatase motif is at an N-terminus of a polypeptide, XI is present;
- X2 and X3 are independently selected serine, threonine, alanine or glycine residues.
- Sulfatase motifs of Formula (I) and Formula (II) amenable to conversion by a prokaryotic FGE often contain a cysteine or serine at Zl and a proline at Z2 that may be modified either by the "SUMP I-type” FGE or the "AtsB-type” FGE, respectively.
- sulfatase motifs of Formula (I) or (II) susceptible to conversion by a prokaryotic FGE contain a cysteine or serine at Zl, and a proline or alanine at Z2 (each of which are selected independently), with the remaining amino acids of the sequence as described for Formulas (I) and (II); and are susceptible to modification by, for example, a FGE from Clostridium perfringens (a cysteine type enzyme), Klebsiella pneumoniae (a Serine -type enzyme) or a FGE of Mycobacterium tuberculosis.
- Sulfatase motifs may be incorporated into any desired location on the first or second polypeptide of the T-Cell-MMP (or its epitope conjugate). Sulfatase motifs may be used to incorporate not only epitopes (e.g., epitope presenting peptides), but also to incorporate payloads (e.g., in the formation of conjugates with drugs and diagnostic molecules).
- a sulfatase motif may be added at or near the terminus of any element in the first or second polypeptide of the T-Cell- MMP (or its epitope conjugate), including the first and second MHC polypeptides (e.g., MHC-H and ⁇ 2 ⁇ polypeptides), the scaffold or Ig Fc, and the linkers adjoining those elements.
- a sulfatase motif may be incorporated into a ⁇ 2 ⁇ , class I MHC heavy chain, and/or a Fc Ig polypeptide.
- a sulfatase motif may be incorporated into the first polypeptide near or at the amino terminal end of the first MHC polypeptide (e.g., a ⁇ 2 ⁇ polypeptide) or a linker attached to it.
- the first polypeptide comprises a ⁇ 2 ⁇ polypeptide sequence
- the sulfatase motif X1(C/S)X2PX3Z3 (SEQ ID NO:45 where Zl is C or S and Z2 is P) may be incorporated at or near the N-terminus of a ⁇ 2 ⁇ sequence, permitting the chemical conjugation of, for example, an epitope either directly or through a linker.
- the mature sequences of ⁇ 2-microglobulin as shown in Fig. 4 begin with a 20 amino acid leader sequence, and the mature polypeptides begin with the initial sequence IQ(R/K)TP(K/Q)IQVYS... (aa residues 21-31 of SEQ ID NOs: 151-155) and continues through the remainder of the ⁇ 2 ⁇ polypeptide.
- the sulfatase motif linked to an amino acid in the N-terminal region of ⁇ 2 ⁇ can be shown as, for example:
- linkers when present, may comprise independently selected amino acid sequences (e.g., from 1 to 50 aa, such as polyglycine, polyalanine, polyserine and poly-Gly, such as AAAGG (SEQ ID NO:75) or (GGGGS) n where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, (SEQ ID NO:76)).
- the linkers shown may be present or absent, and when two are shown they may be the same or different.
- a sulfatase motif is incorporated into, or attached to (e.g., via a peptide linker), a T-Cell-MMP (or its epitope conjugate) in the first or second polypeptide having a ⁇ 2 ⁇ polypeptide with a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig. 4, or the sequence of any of the mature ⁇ 2 ⁇ polypeptides starting at amino acid 21 and ending at their C-terminus).
- sequence identity of the ⁇ 2 ⁇ polypeptide is determined relative to the corresponding portion of a ⁇ 2 ⁇ polypeptide in Fig 4 without consideration of the added sulfatase motif and any linker sequences present.
- a sulfatase motif is incorporated into, or attached to (e.g., via one or more independently selected peptide linkers at the N-, C-, or both the N- and C-termini) a T-Cell-MMP (or its epitope conjugate) having a first or second polypeptide having a ⁇ 2 ⁇ polypeptide sequence with 1 to 15 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acid deletions, insertions, and/or changes compared with a sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig.
- amino acid deletions, insertions, and/or changes in the ⁇ 2 ⁇ polypeptide are determined relative to the corresponding portion of a ⁇ 2 ⁇ polypeptide in Fig 4 without consideration of the amino acids of the sulfatase motif and any linker sequences present.
- a sulfatase motif (e.g., of the formula X1Z1X2Z2X3Z3, (C/S)X2(P/A)X3Z3, X1CX2PX3R or X1CX2PX3L described above) may either replace and/or be inserted between any of the amino terminal 15 amino acids of a mature ⁇ 2 ⁇ sequence, such as those shown in Fig. 4.
- the sulfatase motif of Formula (I) SEQ ID NO:45 or (II) SEQ ID NO:46 may be incorporated into, or attached to (e.g., via a peptide linker), an Ig Fc region as a second polypeptide chemical conjugation site.
- a sulfatase motif is incorporated into a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity relative to the corresponding portion of a sequence shown in Fig. 2 before the addition of the sulfatase motif sequence.
- the sulfatase motifs may be utilized as sites for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- the sulfatase motif of SEQ ID NO:45 (Formula (I)) or SEQ ID NO:46 (Formula II) may be incorporated into a MHC-H polypeptide sequence as a chemical conjugation site.
- the sulfatase motif is incorporated into a MHC-H sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity relative to the corresponding portion of a sequence shown in Fig. 3 before the addition of the sulfatase motif sequence.
- the sulfatase motifs may be utilized as sites for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- the one or more copies of the sulfatase motif of SEQ ID NO:45 (Formula (I)) or SEQ ID NO:46 (Formula II) may be incorporated into the IgFc region as one or more second polypeptide chemical conjugation sites. In one such embodiment they may be utilized as sites for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- a sulfatase motif of an aldehyde tag is at least 5 or 6 amino acid residues, but can be, for example, from 5 to 16 amino acids in length.
- the motif can contain additional residues at one or both of the N- and C-termini, such that the aldehyde tag includes both a sulfatase motif and an "auxiliary motif.”
- the sulfatase motif includes a C-terminal auxiliary motif (i.e., following the Z3 position of the motif), and may include 1, 2, 3, 4, 5, 6, or all 7 of the contiguous residues of an amino acid sequence selected from the group consisting of AALLTGR (SEQ ID NO:49), SQLLTGR (SEQ ID NO:50), AAFMTGR (SEQ ID NO:51), AAFLTGR (SEQ ID NO:52), and GSLFTGR (SEQ ID NO:53); numerous other auxiliary moifs have been described.
- the auxiliary motif amino acid residues are not required for FGE
- U.S. Pat. No. 9,540,438 discusses the incorporation of sulfatase motifs into the various immunoglobulin sequences, including Fc region polypeptides, and is herein incorporated by reference for its teachings on sulfatase motifs and modification of Fc polypeptides and other polypeptides. That patent is also incorporated by reference for its guidance on FGE enzymes, and their use in forming fGly residues, as well as the chemistry related to the coupling of molecules such as epitopes and payloads to fGly residues.
- the incorporation of the sulfatase motif may be accomplished by incorporating a nucleic acid sequence encoding the motif at the desired location in a nucleic acid encoding the first and/or second polypeptide of the T-Cell-MMP.
- the nucleic acid sequence may be placed under the control of a transcriptional regulatory sequence(s) (a promoter), and provided with regulatory elements that direct its expression.
- the expressed protein may be treated with one or more FGEs after expression and partial or complete purification.
- expression of the nucleic acid in cells that express a FGE recognizing the sulfatase motif results in the conversion of the cysteine or serine of the motif to fGly, which is sometimes called oxoalanine.
- a FGE recognizing the sulfatase motif results in the conversion of the cysteine or serine of the motif to fGly, which is sometimes called oxoalanine.
- two or more different sulfatase motifs are present (e.g., a first and second sulfatase motif) it is also possible to conduct the conversion of each motif during cellular expression, or each motif after cellular expression and partial or complete purification.
- each of the FGEs it is also possible to sequentially convert at least one sulfatase motif during cellular expression and at least one sulfatase motif after partial or complete purification, or to separately convert sulfatase motifs to fGly residues after expression.
- the ability to separately convert different sulfatase motifs and chemically couple them to epitopes and/or payloads in a sequential fashion permits the use of sulfatase coupling to incorporate different epitopes or payloads at the locations of different motifs.
- Host cells for production of polypeptides with unconverted sulfatase motifs, or where the cell expresses a suitable FGE for converting fGly-containing polypeptide sequences include those of a prokaryotic and eukaryotic organism.
- Non-limiting examples include Escherichia coli strains, Bacillus spp. (e.g., B. subtilis, and the like), yeast or fungi (e.g., S. cerevisiae, Pichia spp., and the like).
- Examples of other host cells including those derived from a higher organism such as insects and vertebrates, particularly mammals, include, but are not limited to, CHO cells, HEK cells, and the like (e.g., American Type Culture Collection (ATCC) No. CCL-2), CHO cells (e.g., ATCC Nos. CRL9618 and CRL9096), CHO DG44 cells, CHO-K1 cells (ATCC CCL-61), 293 cells (e.g., ATCC No. CRL- 1573), Vero cells, NIH 3T3 cells (e.g., ATCC No. CRL-1658), Hnh-7 cells, BHK cells (e.g., ATCC No. CCLIO), PC12 cells (ATCC No. CRL1721), COS cells, COS-7 cells (ATCC No. CRL1651), RATI cells, mouse L cells (ATCC No. CCLI.3), human embryonic kidney (HEK) cells (ATCC No.
- ATCC American Type Culture Collection
- CHO cells
- FGEs may be employed for the conversion (oxidation) of cysteine or serine in a sulfatase motif to fGly.
- formylglycine generating enzyme refers to fGly-generating enzymes that catalyze the conversion of a cysteine or serine of a sulfatase motif to fGly.
- FGEs may be divided into two categories, aerobic and anaerobic.
- the aerobic enzymes which include the eukaryotic enzyme (e.g., the human enzyme), convert a cysteine residue to fGly, where the cysteine is generally in the context of a sulfatase motif of the formula X1CX2PX3Z3 (SEQ ID NO:47).
- Eukaryotic FGEs are of the "SUMFl-type" and are encoded in humans by the SUMF1 gene.
- the anaerobic enzymes are of the AtsB type most often from prokaryotic sources (e.g., Clostridium perfringens, Klebsiella pneumoniae, or Mycobacterium tuberculosis) and appear to be able to convert a cysteine or a serine in their sulfatase motif to fGly using a mechanism that is different from the aerobic form.
- the ability to catalyze serine or cysteine conversion to fGly depends on the enzyme and the sulfatase motifs. Because of the differences in the ability of FGEs to convert serine and cysteine, it is possible that different sulfatase motifs may be used as different chemical conjugation sites. For example, it may be possible to incorporate into a T-Cell-MMP a sequence encoding both a cysteine containing site amenable to conversion by the eukaryotic aerobic SUMFl-type FGE and a serine containing site amenable to conversion by an AtsB-type FGE.
- the cysteine motif After expression in a eukaryotic cell expressing a SumFl-type FGE, the cysteine motif will bear a fGly residue that may be subject to a first chemical conjugation with an epitope or payload.
- the T-Cell- MMP conjugate would be treated with an AtsB-type serine-type enzyme in a cell free system, and the fGly produced from the serine containing motif can then be subjected to chemical conjugation with a molecule that is the same as or different from the molecule used in the first chemical conjugation.
- T-Cell-MMPs comprising one or more fGly residues incorporated into the sequence of the first or second polypeptide chain as discussed above.
- the fGly residues may, for example, be in the context of the sequence Xl(fGly)X2Z2X3Z3, where: fGly is the formylglycine residue; and 72, 73, XI, X2 and X3 are as defined in Formula (I) above.
- the T-Cell-MMPs comprise one or more fGly' residues incorporated into the sequence of the first or second polypeptide chain in the context of the sequence Xl(fGly')X2Z2X3Z3, where the fGly' residue is formylglycine that has undergone a chemical reaction and now has a covalently attached moiety (e.g., epitope or payload).
- a number of chemistries and commercially available reagents can be utilized to conjugate a molecule (e.g., an epitope or payload) to a fGly residue, including, but not limited to, the use of thiosemicarbazide, aminooxy, hydrazide, or hydrazino, derivatives of the molecules to be coupled at a fGly-containing chemical conjugation site.
- epitopes e.g., epitope peptides
- payloads bearing thiosemicarbazide, aminooxy, hydrazide, hydrazino or hydrazinyl functional groups e.g., attached directly to an amino acid of a peptide or via a linker such as a PEG
- fGly-containing first or second polypeptides of the T-Cell-MMP can be incorporated using, for example, biotin hydrazide as a linking agent.
- a peptide e.g., an epitope containing peptide
- a nucleophile-containing moiety e.g., an aminooxy or hydrazide moiety
- the reaction results in the formation of a conjugate in which the T-Cell-MMP and peptide (e.g., epitope or payload) are covalently linked (e.g., by hydrazone or oxime linkage).
- an epitope e.g., peptide epitope
- the resulting conjugates may contain a structure (modified amino acid residue) of the form:
- Jl is a covalently bound moiety
- each LI is a divalent moiety independently selected from alkylene, substituted alkylene, alkenylene, substituted alkenylene, alkynylene, substituted alkynylene, arylene, substituted arylene, cycloalkylene, substituted cycloalkylene, heteroarylene, substituted heteroarylene,
- heterocyclene substituted heterocyclene, acyl, amido, acyloxy, urethanylene, thioester, sulfonyl, sulfonamide, sulfonyl ester, -0-, -S-, -NH-, and substituted amine;
- n is a number selected from zero to 40 (e.g., 1-5, 5-10, 10-20, 20-30, or 30-40).
- epitopes and/or payloads may be modified to include a covalently bound hydrazinyl group, including those bearing cyclic substituents (e.g., indoles), that permits their covalent attachment to T-Cell-MMPs bearing fGly amino acid residues.
- hydrazinal compounds are compounds of Formula (III):
- R' may be a payload or epitope of interest that is to be conjugated to the fGly containing polypeptide
- R' and R" may each independently be any desired substituent including, but not limited to, hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, amino, substituted amino, carboxyl, carboxyl ester, acyl, acyloxy, acyl amino, amino acyl, alkylamide, substituted alkylamide, sulfonyl, thioalkoxy, substituted thioalkoxy, aryl, substituted aryl, heteroaryl, substituted heteroaryl, cycloalkyl, substituted cycloalkyl, heterocyclyl, and substituted heterocyclyl;
- Q 10 , Q 20 , Q 30 and Q40 may be CR n , NR 12 , N, O or S;
- R n and R 12 may be any desired substituent (e.g., alkyl). See U.S. Pat. Pub. No. 2015/0352225.
- the hydrazinyl group of modified epitopes and payloads e.g., drugs and/or diagnostic agents
- Formula (IV), (V), (Va), (VI), or (Via) See U.S. Pat. No. 9,310,374, which is incorporated by reference for its teachings on the preparation and use of hydrazinyl compounds in the formation of biological conjugates including conjugates involving peptides and polypeptides.
- one of Q 2 and Q 3 is -(CH 2 ) felicitNR 3 NHR 2 and the other is Y 4 ;
- n 0 or 1 ;
- R 2 and R3 are each independently selected from hydrogen, alkyl, substituted alkyl, alkenyl,
- Xi, X 2 , X3 and X4 are each independently selected from C, N, O and S;
- Yi, Y 2 , Y3 and Y4 are each independently selected from hydrogen, halogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, amino, substituted amino, carboxyl, carboxyl ester, acyl, acyloxy, acyl amino, amino acyl, alkylamide, substituted alkylamide, sulfonyl, thioalkoxy, substituted thioalkoxy, aryl, substituted aryl, heteroaryl, substituted heteroaryl, cycloalkyl, substituted cycloalkyl, heterocyclyl, and substituted heterocyclyl;
- L is an optional linker
- Wi is selected from an epitope (e.g., epitope polypeptide), a drug, a diagnostic agent, or other
- Q 2 is -(CH2) n NR 3 NHR 2 and Q 3 is Y 4 .
- Q 3 is
- n NR 3 NHR 2 and Q 2 is Y 4 .
- n is 1.
- R 2 and R 3 are each independently selected from alkyl and substituted alkyl.
- R 2 and R 3 are each methyl.
- Xi, X 2 , X3 and X 4 are each C.
- Yi, Y 2 , Y3 and Y 4 are each H.
- L is present and includes a group selected from alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, amino, substituted amino, carboxyl, carboxyl ester, acyl amino, alkylamide, substituted alkylamide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, cycloalkyl, substituted cycloalkyl, heterocyclyl, and substituted heterocyclyl.
- L is present and includes a polymer.
- the polymer is a polyethylene glycol.
- Alkyl refers to monovalent saturated aliphatic hydrocarbyl groups having from 1 to 10 carbon atoms and preferably 1 to 6 carbon atoms. This term includes, by way of example, linear and branched hydrocarbyl groups such as methyl (CH 3 -), ethyl (CH 3 CH 2 -), n-propyl
- substituted alkyl refers to an alkyl group as defined herein wherein one or more carbon atoms in the alkyl chain have been optionally replaced with a heteroatom such as -0-, -N-, -S-, -S(0) n - (where n is 0 to 2), or -NR- (where R is hydrogen or alkyl) and having from 1 to 5 substituents selected from the group consisting of alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, oxo, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocycl
- Alkylene refers to divalent aliphatic hydrocarbyl groups preferably having from 1 to 6 and more preferably 1 to 3 carbon atoms that are either straight-chained or branched, and which are optionally interrupted with one or more groups selected from -0-, -NR 10 -, -NR 10 C(O)-, -C(0)NR 10 - and the like. This term includes, by way of example, methylene (-CH2-), ethylene (-CH2CH2-), n-propylene (-CH 2 CH 2 CH 2 -), iso-propylene (-CH 2 CH(CH 3 )-),
- R 10 is H or alkyl (e.g., H, -CH 3 , -CH 2 CH 3 or -CH 2 CH 2 CH 3 ).
- Substituted alkylene refers to an alkylene group having from 1 to 3 hydrogens replaced with substituents as described for carbons in the definition of "substituted” below.
- alkane refers to alkyl group and alkylene group, as defined herein.
- alkylaminoalkyl refers to the groups R'NHR"- where R' is an alkyl group as defined herein and R" is an alkylene, alkenylene or alkynylene group as defined herein.
- alkaryl or “aralkyl” refers to the groups -alkylene-aryl and -substituted alkylene - aryl where alkylene, substituted alkylene and aryl are defined herein.
- Alkoxy refers to the group -O-alkyl, wherein alkyl is as defined herein. Alkoxy includes, by way of example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, t-butoxy, sec-butoxy, n- pentoxy, and the like.
- alkoxy also refers to the groups alkenyl-O-, cycloalkyl-O-, cycloalkenyl-O-, and alkynyl-O-, where alkenyl, cycloalkyl, cycloalkenyl, and alkynyl are as defined herein.
- substituted alkoxy refers to the groups substituted alkyl-O-, substituted alkenyl-O-, substituted cycloalkyl-O-, substituted cycloalkenyl-O-, and substituted alkynyl-O- where substituted alkyl, substituted alkenyl, substituted cycloalkyl, substituted cycloalkenyl and substituted alkynyl are as defined herein.
- alkoxyamino refers to the group -NH-alkoxy, wherein alkoxy is defined herein.
- haloalkoxy refers to the group alkyl-O- wherein one or more hydrogen atoms on the alkyl group have been substituted with a halo group and include, by way of examples, groups such as trifluoromethoxy, and the like.
- haloalkyl refers to a substituted alkyl group as described above, wherein one or more hydrogen atoms on the alkyl group have been substituted with a halo group.
- examples of such groups include, without limitation, fluoroalkyl groups, such as trifluoromethyl,
- alkylalkoxy refers to the groups -alkylene-O-alkyl, alkylene-O-substituted alkyl, substituted alkylene-O-alkyl, and substituted alkylene-O-substituted alkyl wherein alkyl, substituted alkyl, alkylene and substituted alkylene are as defined herein.
- alkylthioalkoxy refers to the groups -alkylene-S-alkyl, alkylene-S-substituted alkyl, substituted alkylene-S-alkyl and substituted alkylene-S-substituted alkyl wherein alkyl, substituted alkyl, alkylene and substituted alkylene are as defined herein.
- Alkenyl refers to straight chain or branched hydrocarbyl groups having from 2 to 6 carbon atoms and preferably 2 to 4 carbon atoms and having at least 1 and preferably from 1 to 2 sites of double bond unsaturation. This term includes, by way of example, bi-vinyl, allyl, and but-3-en- 1-yl. Included within this term are the cis and trans isomers or mixtures of these isomers.
- substituted alkenyl refers to an alkenyl group as defined herein having from 1 to 5 substituents, or from 1 to 3 substituents, selected from alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, oxo, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy, aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, hydroxyamino, alkoxyamin
- Alkynyl refers to straight or branched monovalent hydrocarbyl groups having from 2 to 6 carbon atoms and preferably 2 to 3 carbon atoms and having at least 1 and preferably from 1 to 2 sites of triple bond unsaturation. Examples of such alkynyl groups include acetylenyl (-C ⁇ CH), and propargyl (-CH 2 C ⁇ CH).
- substituted alkynyl refers to an alkynyl group as defined herein having from 1 to 5 substituents, or from 1 to 3 substituents, selected from alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, oxo, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy, aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, hydroxyamino, alkoxy
- Alkynyloxy refers to the group -O-alkynyl, wherein alkynyl is as defined herein.
- Alkynyloxy includes, by way of example, ethynyloxy, propynyloxy, and the like.
- Acyl refers to the groups H-C(O)-, alkyl-C(O)-, substituted alkyl-C(O)-, alkenyl-C(O)-, substituted alkenyl-C(O)-, alkynyl-C(O)-, substituted alkynyl-C(O)-, cycloalkyl-C(O)-, substituted cycloalkyl-C(O)-, cycloalkenyl -C(O)-, substituted cycloalkenyl-C(O)-, aryl-C(O)-, substituted aryl-C(O)-, heteroaryl-C(O)-, substituted heteroaryl-C(O)-, heterocyclyl-C(O)-, and substituted heterocyclyl-C(O)-, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl,
- Acylamino refers to the groups -NR 20 C(O)alkyl, -NR 20 C(O)substituted alkyl,
- R 20 is hydrogen or alkyl and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- aminocarbonyl or the term “aminoacyl” refers to the group -C(0)NR 21 R 22 , wherein R 21 and R 22 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 21 and R 22 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloal
- Aminocarbonylamino refers to the group -NR 21 C(0)NR 22 R 23 where R 21 , R 22 , and R 23 are independently selected from hydrogen, alkyl, aryl or cycloalkyl, or where two R groups are joined to form a heterocyclyl group.
- alkoxycarbonylamino refers to the group -NRC(0)OR where each R is
- alkyl, substituted alkyl, aryl, heteroaryl, or heterocyclyl independently hydrogen, alkyl, substituted alkyl, aryl, heteroaryl, and heterocyclyl wherein alkyl, substituted alkyl, aryl, heteroaryl, and heterocyclyl are as defined herein.
- acyloxy refers to the groups alkyl-C(0)0-, substituted alkyl-C(0)0-, cycloalkyl- C(0)0- substituted cycloaikyl-C(0)0- aryl-C(0)0- heteroaryl-C(0)0- and heterocyclyl- C(0)0- wherein alkyl, substituted alkyl, cycloalkyl, substituted cycloalkyl, aryl, heteroaryl, and heterocyclyl are as defined herein.
- aminosulfonyl refers to the group -S02NR 21 R 22 , wherein R 21 and R 22 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 21 and R 22 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group and alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted
- “Sulfonylamino” refers to the group -NR 21 S02R 22 , wherein R 21 and R 22 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 21 and R 22 are optionally joined together with the atoms bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, ary
- Aryl or “Ar” refers to a monovalent aromatic carbocyclic group of from 6 to 18 carbon atoms having a single ring (such as is present in a phenyl group) or a ring system having multiple condensed rings (examples of such aromatic ring systems include naphthyl, anthryl and indanyl), which condensed rings may or may not be aromatic, provided that the point of attachment is through an atom of an aromatic ring. This term includes, by way of example, phenyl and naphthyl.
- aryl groups can optionally be substituted to form "substituted aryl" groups with from 1 to 5 substituents, or from 1 to 3 substituents, selected from acyloxy, hydroxy, thiol, acyl, alkyl, alkoxy, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, substituted alkyl, substituted alkoxy, substituted alkenyl, substituted alkynyl, substituted cycloalkyl, substituted cycloalkenyl, amino, substituted amino, aminoacyl, acylamino, alkaryl, aryl, aryloxy, azido, carboxyl, carboxylalkyl, cyano, halogen, nitro, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, aminoacyloxy, oxyacylamino, thioalkoxy, substituted thio
- Aryloxy refers to the group -O-aryl, wherein aryl is as defined herein, including, by way of example, phenoxy, naphthoxy, and the like, including optionally substituted aryl groups as also defined herein.
- amino refers to the group -NH2.
- substituted amino refers to the group -NRR where each R is independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, cycloalkyl, substituted cycloalkyl, alkenyl, substituted alkenyl, cycloalkenyl, substituted cycloalkenyl, alkynyl, substituted alkynyl, aryl, heteroaryl, and heterocyclyl provided that at least one R is not hydrogen.
- Carboxyl refers to -CO 2 H or salts thereof.
- Carboxyl ester or “carboxy ester” or the terms “carboxyalkyl” or “"carboxylalkyl” refers to the groups -C(0)0-alkyl, -C(0)0-substituted alkyl, -C(0)0-alkenyl, -C(0)0-substituted alkenyl, -C(0)0-alkynyl, -C(0)0-substituted alkynyl, -C(0)0-aryl, -C(0)0-substituted aryl, -C(0)0-cycloalkyl, -C(0)0-substituted cycloalkyl, -C(0)0-cycloalkenyl, -C(0)0-substituted cycloalkenyl, -C(0)0-heteroaryl, -C(0)0-substituted heteroaryl, -C(0)0-heterocyclic, and -C(0)0-substituted heterocyclic, wherein alky
- cycloalkenyl -0-C(0)0-heteroaryl, -0-C(0)0-substituted heteroaryl, -0-C(0)0-heterocyclic, and -0-C(0)0-substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- Cycloalkyl refers to cyclic alkyl groups of from 3 to 10 carbon atoms having single or multiple cyclic rings including fused, bridged, and spiraling systems.
- suitable cycloalkyl groups include, for instance, adamantyl, cyclopropyl, cyclobutyl, cyclopentyl, cyclooctyl and the like.
- Such cycloalkyl groups include, by way of example, single ring structures such as cyclopropyl, cyclobutyl, cyclopentyl, cyclooctyl, and the like, or multiple ring structures such as adamantanyl, and the like.
- substituted cycloalkyl refers to cycloalkyl groups having from 1 to 5 substituents, or from 1 to 3 substituents, selected from alkyl, substituted alkyl, alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, oxo, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy, aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, hydroxy, hydroxy
- Cycloalkenyl refers to non-aromatic cyclic alkyl groups of from 3 to 10 carbon atoms having single or multiple rings and having at least one double bond and preferably from 1 to 2 double bonds.
- substituted cycloalkenyl refers to cycloalkenyl groups having from 1 to 5
- substituents or from 1 to 3 substituents, selected from alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, keto, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy, aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, hydroxyamino, alkoxyamino, nitro, -SO-alkyl, -SO-substituted alkyl, -SO-aryl, -SO
- Cycloalkynyl refers to non-aromatic cycloalkyl groups of from 5 to 10 carbon atoms having single or multiple rings and having at least one triple bond.
- Cycloalkoxy refers to -O-cycloalkyl
- Cycloalkenyloxy refers to -O-cycloalkenyl.
- Halo or halogen refers to fluoro, chloro, bromo, and iodo.
- Heteroaryl refers to an aromatic group of from 1 to 15 carbon atoms, such as from 1 to 10 carbon atoms and 1 to 10 heteroatoms selected from the group consisting of oxygen, nitrogen, and sulfur within the ring.
- Such heteroaryl groups can have a single ring (such as pyridinyl, imidazolyl or furyl) or multiple condensed rings in a ring system (for example as in groups such as indolizinyl, quinolinyl, benzofuran, benzimidazolyl or benzothienyl), wherein at least one ring within the ring system is aromatic, provided that the point of attachment is through an atom of an aromatic ring.
- the nitrogen and/or sulfur ring atom(s) of the heteroaryl group are optionally oxidized to provide for the N-oxide (N->0), sulfinyl, or sulfonyl moieties.
- This term includes, by way of example, pyridinyl, pyrrolyl, indolyl, thiophenyl, and furanyl.
- heteroaryl groups can be optionally substituted to form "substituted heteroaryl" groups with 1 to 5 substituents, or from 1 to 3 substituents, selected from acyloxy, hydroxy, thiol, acyl, alkyl, alkoxy, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, substituted alkyl, substituted alkoxy, substituted alkenyl, substituted alkynyl, substituted cycloalkyl, substituted cycloalkenyl, amino, substituted amino, aminoacyl, acylamino, alkaryl, aryl, aryloxy, azido, carboxyl, carboxylalkyl, cyano, halogen, nitro, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, aminoacyloxy, oxyacylamino, thioalkoxy, substituted thioal
- heteroarylkyl refers to the group -alkylene -heteroaryl where alkylene and heteroaryl are defined herein. This term includes, by way of example, pyridylmethyl, pyridylethyl, indolylmethyl, and the like.
- Heteroaryloxy refers to -O-heteroaryl.
- Heterocycle refers to a saturated or unsaturated group having a single ring or multiple condensed rings, including fused, bridged and spiro ring systems, and having from 3 to 20 ring atoms, including 1 to 10 hetero atoms. These ring atoms are selected from the group consisting of nitrogen, sulfur, or oxygen, wherein, in fused ring systems, one or more of the rings can be cycloalkyl, aryl, or heteroaryl, provided that the point of attachment is through the non-aromatic ring.
- the nitrogen and/or sulfur atom(s) of the heterocyclic group are optionally oxidized to provide for the N- oxide, -S(O)-, or -SO2- moieties.
- heterocycles and heteroaryls include, but are not limited to, azetidine, pyrrole, imidazole, pyrazole, pyridine, pyrazine, pyrimidine, pyridazine, indolizine, isoindole, indole, dihydroindole, indazole, purine, quinolizine, isoquinoline, quinoline, phthalazine,
- naphthylpyridine quinoxaline, quinazoline, cinnoline, pteridine, carbazole, carboline, phenanthridine, acridine, phenanthroline, isothiazole, phenazine, isoxazole, phenoxazine, phenothiazine, imidazolidine, imidazoline, piperidine, piperazine, indoline, phthalimide, 1,2,3,4- tetrahydroisoquinoline, 4,5,6,7-tetrahydrobenzo[b]thiophene, thiazole, thiazolidine, thiophene, benzo[b]thiophene, morpholinyl, thiomorpholinyl (also referred to as thiamorpholinyl), 1,1- dioxothiomo holinyl, piperidinyl, pyrrolidine, tetrahydrofuranyl, and the like.
- heterocyclic groups can be optionally substituted with 1 to 5, or from 1 to 3 substituents, selected from alkoxy, substituted alkoxy, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aminoacyloxy, oxyaminoacyl, azido, cyano, halogen, hydroxyl, oxo, thioketo, carboxyl, carboxylalkyl, thioaryloxy, thioheteroaryloxy, thioheterocyclooxy, thiol, thioalkoxy, substituted thioalkoxy, aryl, aryloxy, heteroaryl, heteroaryloxy, heterocyclyl, heterocyclooxy, hydroxyamino, alkoxyamino, nitro, -SO-alkyl, -SO-substituted
- Heterocyclyloxy refers to the group -O-heterocyclyl.
- heterocyclylthio refers to the group heterocyclic-S-.
- heterocyclene refers to the diradical group formed from a heterocycle, as defined herein.
- hydroxyamino refers to the group -NHOH.
- Niro refers to the group -NO2.
- “Sulfonyl” refers to the group SO 2 -alkyl, SO 2 -substituted alkyl, SO 2 -alkenyl, SO 2 -substituted alkenyl, SO 2 -cycloalkyl, SO 2 -substituted cycloalkyl, S02-cycloalkenyl, S02-substituted cycloalkenyl, SO 2 -aryl, S02-substituted aryl, S02-heteroaryl, SO 2 -substituted heteroaryl, SO2- heterocyclic, and SO 2 -substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, hetero
- “Sulfonyloxy” refers to the group -OSO 2 -alkyl, OSO 2 -substituted alkyl, OSO 2 -alkenyl, OSO 2 - substituted alkenyl, OSO 2 -cycloalkyl, OSO 2 -substituted cycloalkyl, OSO 2 -cycloalkenyl, OSO 2 - substituted cycloalkenyl, OSO 2 -aryl, OSO 2 -substituted aryl, OSO 2 -heteroaryl, OSO 2 -substituted heteroaryl, OSO 2 -heterocyclic, and OSO 2 substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkeny
- aminocarbonyloxy refers to the group -OC(0)NRR where each R is independently hydrogen, alkyl, substituted alkyl, aryl, heteroaryl, or heterocyclic wherein alkyl, substituted alkyl, aryl, heteroaryl and heterocyclic are as defined herein.
- Thiol refers to the group -SH.
- Alkylthio or the term “thioalkoxy” refers to the group -S-alkyl, wherein alkyl is as defined herein.
- sulfur may be oxidized to -S(O)-.
- the sulfoxide may exist as one or more stereoisomers.
- substituted thioalkoxy refers to the group -S-substituted alkyl.
- thioaryloxy refers to the group aryl-S- wherein the aryl group is as defined herein including optionally substituted aryl groups also defined herein.
- heteroaryloxy refers to the group heteroaryl-S- wherein the heteroaryl group is as defined herein including optionally substituted aryl groups as also defined herein.
- heterocyclooxy refers to the group heterocyclyl-S- wherein the heterocyclyl group is as defined herein including optionally substituted heterocyclyl groups as also defined herein.
- substituted when used to modify a specified group or radical, can also mean that one or more hydrogen atoms of the specified group or radical are each, independently of one another, replaced with the same or different substituent groups as defined below.
- R 60 is selected from the group consisting of optionally substituted alkyl, cycloalkyl, heteroalkyl, heterocycloalkylalkyl, cycloalkylalkyl, aryl, arylalkyl, heteroaryl and heteroarylalkyl, each R 70 is independently hydrogen or R 60 ; each R 80 is independently R 70 or, alternatively, two R 80 s, taken together with the nitrogen atom to which
- Each M + may independently be, for example, an alkali ion, such as K + , Na + , Li + ; an ammonium ion, such as + N(R 60 )4; or an alkaline earth ion, such as [Ca 2+ ]o.s, [Mg 2+ ]o.s, or [Ba 2+ ]o.s ("0.5" means that one of the counter ions for such divalent alkali earth ions can be an ionized form of a compound of the invention and the other a typical counter ion such as chloride, or two ionized compounds disclosed herein can serve as counter ions for such divalent alkali earth ions, or a doubly ionized compound of the invention can serve as the counter ion for such divalent alkali earth ions).
- an alkali ion such as K + , Na + , Li +
- an ammonium ion such as + N(R 60 )4
- -NR 80 R 80 is meant to include -NH 2 , -NH-alkyl, N- pyrrolidinyl, N-piperazinyl, 4N-methyl-piperazin-l-yl and N-morpholinyl.
- substituent groups for hydrogens on unsaturated carbon atoms in "substituted" alkene, alkyne, aryl and heteroaryl groups are, unless otherwise specified, -R 60 , halo, -O M + , -OR 70 , -SR 70 , -S M + , -NR 80 R 80 , trihalomethyl, -CF 3 , -CN, -OCN, -SCN, -NO, -NO2, -N 3 , -SO2R 70 , -SO3 M + , -SO3R 70 , -OSO 2 R 70 , -OSO3 M + , -OSO3R 70 , -PO3 2(M + ) 2 , -P(O)(OR 70 )O M + , -P(O)(OR 70 ) 2 , -C(0)R 70 , -C(S)R 70 , -C
- substituent groups for hydrogens on nitrogen atoms in "substituted" heteroalkyl and cycloheteroalkyl groups are, unless otherwise specified, -R 60 , -O M + , -OR 70 , -SR 70 , -S M + , -NR 80 R 80 , trihalomethyl, -CF 3 , -CN, -NO, -NO2, -S(0) 2 R 70 , -S(0) 2 0 M + , -S(0) 2 R 7 °, -OS(0) 2 R 7 °, -OS(0) 2 0 M + , -OS(0) 2 R 70 , -P(0)(0 ) 2 (M + ) 2 , -P(O)(OR 70 )O M + , -P(O)(OR 70 )(OR 70 ), -C(0)R 70 , -C(S)R 70 , - C(NR 70 ),
- an epitope e.g., peptide epitope
- a fGly containing polypeptide has the form of Formula (III), (IV), (V), (Va), (VI), or (Via).
- an epitope is covalently bound in a compound of Formula (III), (IV), (V), (Va), (VI), or (Via).
- the epitope is a peptide comprising the aa sequence of an epitope (e.g., a viral or cancer epitope).
- the peptide epitope has a length from about 4 aa to about 20 aa (e.g., 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, or 20 aa) in length.
- aa e.g., 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, or 20 aa
- the disclosure provides for methods of preparing T-Cell-MMP-epitope conjugates and/or T- Cell-MMP-payload conjugates comprising:
- a sulfatase motif including a serine or cysteine e.g., a sulfatase motif of Formula (I) or (II) such as X1CX2PX3Z3 (SEQ ID NO:47); CX1PX2Z3 (SEQ ID NO:48) discussed above
- sulfatase motif -containing first polypeptide and/or second polypeptide in a cell that i) expresses a FGE and converts the serine or cysteine of the sulfatase motif to a fGly and partially or completely purifying the fGly-containing first polypeptide and/or second polypeptide separately or as the T-Cell-MMP, or
- ii) does not express a FGE that converts a serine or cysteine of the sulfatase motif to a fGly, purifying or partially purifying the T-Cell-MMP containing the fGly residue and contacting the purified or partially purified T-Cell-MMP with a FGE that converts the serine or cysteine of the sulfatase motif into a fGly residue;
- T-Cell-MMP with an epitope and/or payload that has been functionalized with a group that forms a covalent bond between the aldehyde of the fGly and epitope and/or payload;
- T-Cell-MMP-epitope conjugate and/or T-Cell-MMP payload conjugate.
- the epitope (epitope contining molecule) and/or payload may be functionalized by any suitable function group that reacts selectively with an aldehyde group.
- suitable function group may, for example, be selected from the group consisting of thiosemicarbazide, aminooxy, hydrazide, and hydrazino.
- epitope and or payload is part of a hydrazinyl compound of Formula (III), (IV), (V), (Va), (VI), or (Via).
- the sulfatase motif is incorporated into a T-Cell-MMP first polypeptide comprising a ⁇ 2 ⁇ aa sequence, either within the ⁇ 2 ⁇ sequence or a linker attached thereto (e.g., within 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 aa of the N-terminus.
- a sulfatase motif is incorporated into a first or second polypeptide comprising a ⁇ 2 ⁇ aa sequence with at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) sequence identity to a ⁇ 2 ⁇ sequence shown in Fig.
- the sulfatase motif may be placed between the signal sequence and the sequence of the mature peptide, or at the N-terminus of the mature peptide, and the motif may be separated from the ⁇ 2 ⁇ sequence(s) by peptide linkers,
- a sulfatase motif of SEQ ID NO:45 (Formula (I)) or SEQ ID NO:46 may be incorporated into an IgFc region of a second polypeptide as a second polypeptide chemical conjugation site.
- a sulfatase motif is incorporated into a sequence comprising a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 2 before the addition of the sulfatase motif sequence.
- the sulfatase motif of SEQ ID NO:45 (Formula (I)) or SEQ ID NO:46 may be incorporated into a MHC Class I heavy chain polypeptide as a chemical conjugation site.
- a sulfatase motif is incorporated into a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 3 (e.g., with sequence identity calculated without including or before the addition of the sulfatase motif sequence).
- the sulfatase motifs may be utilized as sites for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- Epitopes e.g., peptides comprising the sequence of an epitope
- payloads may be attached at the N- and/or C-termini of the first and/or second polypeptides of a T-Cell-MMP by incorporating sites for Sortase A conjugation at those locations.
- Sortase A recognizes a C-terminal pentapeptide sequence LP(X5)TG/A (SEQ ID NO 54, with X5 being any single amino acid, and G/A being a glycine or alanine), and creates an amide bond between the threonine within the sequence and glycine or alanine in the N-terminus of the conjugation partner.
- the recognition sequences can be incorporated into either conjugation partner permitting either the amino or carboxyl terminus of the first or second polypeptide to serve as a chemical conjugation site.
- the LP(X5)TG/A sequence does not require any non-natural amino acids, allowing expression to the T-Cell-MMPs to be carried out under a wide variety of conditions in diverse cell types.
- a potential disadvantage of Sortase A enzymatic ligation is that it employs bacterial transglutaminases (mTGs) that can also catalyze the coupling of glutamine side chains to alkyl primary amines, such as lysine. Bacterial mTGs appear unable to modify glutamine residues in native IgGl, but may result in secondary modifications of the polypeptide sequences when employed.
- mTGs bacterial transglutaminases
- an LP(X5)TG/A is engineered into the carboxy terminal portion of the desired peptide(s).
- An exposed stretch of glycines or alanines (e.g., (G)3 5 (SEQ ID NOs:55 and 56) when using Sortase A from Staphylococcus aureus or (A)3-s (SEQ ID NOs:57 and 58) when using Sortase A from Streptococcus pyogenes) is engineered into the N-terminus of a peptide that comprises an epitope (or a linker attached thereto), a peptide payload (or a linker attached thereto), or a peptide covalently attached to a non-peptide epitope or payload.
- G g., (G)3 5 (SEQ ID NOs:55 and 56) when using Sortase A from Staphylococcus aureus or (A)3-s (SEQ ID NOs:57 and 58) when using Sortase A from Streptococcus pyogenes
- an exposed stretch of glycines e.g., (G)2, 3, 4, or 5) or alanines (e.g., (A)3 ⁇ 4 3, 4, or 5) is engineered to appear at the N-terminus of the desired polypeptide(s), and a LP(X5)TG/A is engineered into the carboxy terminal portion of a peptide that comprises an epitope (or a linker attached thereto), a peptide payload (or a linker attached thereto), or a peptide covalently attached to a non- peptide epitope or payload.
- glycines e.g., (G)2, 3, 4, or 5
- alanines e.g., (A)3 ⁇ 4 3, 4, or 5
- a LP(X5)TG/A is engineered into the carboxy terminal portion of a peptide that comprises an epitope (or a linker attached thereto), a peptide payload (or a linker attached thereto), or
- At least one LP(X5)TG/A amino acid sequence at the carboxy terminus of the first and/or second polypeptides e.g., for coupling with an epitope peptide modified with oligoglycine or oligo alanine at its N-terminus;
- At least one oligoglycine e.g., (G)2, 3, 4, or 5
- at least one oligoglycine e.g., (G)2, 3, 4, or 5
- the amino terminus of the first and/or second polypeptides e.g., for coupling with an epitope polypeptide modified with LP(X5)TG/A amino acid sequence at its N-terminus
- At least one oligo alanine e.g., (A)2, 3, 4, or 5
- at least one oligo alanine e.g., (A)2, 3, 4, or 5
- at least one oligo alanine e.g., (A)2, 3, 4, or 5
- amino terminus of the first and/or second polypeptides e.g., for coupling with an epitope polypeptide modified with LP(X5)TG/A amino acid sequence at its N-terminus
- LP(X5)TA e.g., LPETA, SEQ ID NO:54 where X5 is E and the end position is A
- amino acid sequence in the first and/or second polypeptides e.g., for coupling with an epitope peptide modified with oligoglycine or oligo alanine at its N-terminus
- LP(X5)TG e.g., LPETG, SEQ ID NO:54 where X5 is E and the end position is G
- amino acid sequence in the first and/or second polypeptides e.g., for coupling with an epitope peptide modified with oligoglycine or oligo alanine at its N-terminus.
- LPETGG SEQ ID NOs:59
- aureus Sortase A coupling or a LPETAA (SEQ ID NOs:60) peptide may be used for 5.
- pyogenes Sortase A coupling may be used for 5.
- the conjugation reaction is still between the threonine and the amino terminal oligoglycine or oligoalanine peptide to yield a carboxy-modified polypeptide -LP(X5)T*G/A-amino-modified polypeptide, where the "*" represents the bond formed between the threonine and the glycine or alanine of the N-terminal modified peptide.
- the first polypeptide of the T-Cell-MMP comprises a ⁇ 2 ⁇ polypeptide
- the first polypeptide contains an oligoglycine (e.g., (G)2, 3, 4, or 5) or an oligoalanine (e.g., (A)2, 3, 4, or 5) at the N-terminus of the polypeptide, or at the N-terminus of a polypeptide linker attached to the first polypeptide (e.g., the linker is co-translated with, and at the N-terminus of the first polypeptide).
- an oligoglycine e.g., (G)2, 3, 4, or 5
- an oligoalanine e.g., (A)2, 3, 4, or 5
- the oligoglycine or oligoalanine may be used as a Sortase A chemical conjugation site to introduce an epitope molecule into the T-Cell-MMP by conjugating it with an epitope comprising a polypeptide bearing a LP(X5)TG/A in its carboxy terminal region.
- Sortase A chemical conjugation site to introduce an epitope molecule into the T-Cell-MMP by conjugating it with an epitope comprising a polypeptide bearing a LP(X5)TG/A in its carboxy terminal region.
- the sequences of ⁇ 2 ⁇ as shown in Fig. 4 begin with a 20 amino acid leader sequence, and the mature polypeptide begins with the initial sequence IQRTP(K/Q)IQVYS and continues through the remainder of the polypeptide.
- the sortase motifs of SEQ ID NOs:54, 59, and 69 may be incorporated therein, for example as:
- MSRSVALAVLALLSLSGLEA (A 2-5 or G 2-5 )-linker-IQ(R/K)TP(K/Q)IQVYS...,
- MSRSVALAVLALLSLSGLEA (A 2-5 or G 2-5 )-linker-Q(R/K)TP(K/Q)IQVYS...,
- MSRSVALAVLALLSLSGLEA (A 2-5 or G 2-5 )-linker-(R/K)TP(K/Q)IQVYS...
- linkers when present, may comprise independently selected amino acid sequences (e.g., from 1 to 50 amino acids, such as polyglycine, polyalanine, polyserine and poly-Gly, such as AAAGG (SEQ ID NO:75) or (GGGGS) n where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, (SEQ ID NO:76)), or chemical group (e.g., polyethylene oxide, polyethylene glycol, etc.).
- Linkers may be present or absent and when two are shown they may be the same or different.
- a thrombin cleavage site (Leu-Val-Pro-Arg-Gly, SEQ ID NO:61) may be inserted to precede the glycine.
- thrombin cleaves between the Arg and Gly residues, it ensures that upon cleavage the glycines are exposed on the protein molecule to be labeled with oligo glycine and conjugated, provided there are no other thrombin sites in the polypeptide.
- a A 2 -5 or a G 2-5 motif is incorporated into a polypeptide comprising a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 4 (e.g., either the entire sequences shown in Fig. 4, or the sequence of the mature polypeptides starting at amino acid 21 and ending at their C-terminus), with sequence identity assessed without consideration of the added A 2 -5 or a G 2-5 motif and any linker sequences present.
- an A 2 -5 or a G 2-5 motif is incorporated into a polypeptide comprising a ⁇ 2 ⁇ sequence having 1 tol5 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acid deletions, insertions and/or changes compared with a sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig. 4, or any of the mature polypeptide sequences starting at amino acid 21 and ending at their C-terminus), with amino acid deletions, insertions and/or changes assessed without consideration of the added A2-5 or a G2-5 motif and any linker sequences present.
- 1 tol5 e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15
- amino acid deletions, insertions and/or changes compared with a sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig. 4, or any of the mature polypeptide sequences starting at amino acid 21 and ending at their
- an A2-5 or a G2-5 motif may either replace and/or be inserted between any of the amino terminal 15 (e.g., 1-5, 5-10 or 10-15) amino acids of a mature ⁇ 2 ⁇ sequence, such as those shown in Fig. 4.
- Transglutaminases catalyze the formation of a covalent bond between the amide group on the side chain of a glutamine residue and a primary amine donor (e.g., a primary alkyl amine, such as is found on the side chain of a lysine residue in a polypeptide).
- Transglutaminases may be employed to conjugate epitopes and payloads to T-Cell-MMPs, either directly or indirectly via a linker comprising a free primary amine.
- glutamine residues present in the first and/or second polypeptides of the T-Cell-MMP may be considered as chemical conjugation sites when they can be accessed by enzymes such as Streptoverticillium mobaraense transglutaminase. That enzyme (EC 2.3.2.13) is a stable, calcium-independent enzyme catalyzing the ⁇ -acyl transfer of glutamine to the ⁇ - amino group of lysine.
- Glutamine residues appearing in a sequence are, however, not always accessible for enzymatic modification. The limited accessibility can be advantageous as it limits the number of locations where modification may occur.
- bacterial mTGs are generally unable to modify glutamine residues in native IgGls; however, Schibli and co-workers (Jeger, S., et al. Angew Chem (Int Engl). 2010;49:99957 and Dennler P, et al. Bioconjug Chem. 2014;25(3):569-78) found that deglycosylating IgGls at N297 rendered glutamine residue Q295 accessible and permitted enzymatic ligation to create an antibody drug conjugate. Further, by producing a N297 to Q297 IgGl mutant, they introduce two sites for enzymatic labeling by transglutaminase.
- a glutamine residue or a sequence comprising an accessible glutamine that can act as a substrate of a transglutaminase (sometimes referred to as a "glutamine tag" or a "Q- tag"), may be incorporated into the polypeptide.
- the added glutamine or Q-tag may act as a first polypeptide chemical conjugation site or a second polypeptide chemical conjugation site.
- Incorporation of glutamine residues and Q-tags may be accomplished chemically where the peptide is synthesized, or by modifying a nucleic acid that encodes the polypeptide and expressing the modified nucleic acid in a cell or cell free system.
- first polypeptide chemical conjugation site is a glutamine or Q-tag
- the glutamine or Q-tag may be at any of the locations indicated for first polypeptide chemical conjugation sites or second polypeptide chemical conjugation sites described above.
- the added glutamine residue or Q-tag is attached to ⁇ e.g., at the N- or C- terminus), or within, the sequence of the first MHC polypeptide, or, if present, a linker attached to the first MHC polypeptide. Additional first polypeptide chemical conjugation sites may be present (attached to or within) any location on the first polypeptide of the T-Cell-MMP.
- the first MHC polypeptide of a T-Cell-MMP is a ⁇ 2 ⁇ polypeptide
- an added glutamine or Q-tag is incorporated within 20, 15, or 10 amino acids of the N-terminus of a mature ⁇ 2 ⁇ polypeptide sequence, which exclude the 20 base pair signal sequence, provided in Fig. 4 (or a peptide having at least 85%, 90%, 95%, 98%, 99, or even 100% sequence identity to a mature ⁇ 2 ⁇ polypeptide in Fig. 4).
- the glutamine or Q-tag is present in a polypeptide linker attached to the N-terminus of one of the mature ⁇ 2 ⁇ polypeptides provided in Fig. 4.
- the added glutamine residue or Q-tag is attached to (e.g., at the N- or C- terminus), or within, the sequence of the second polypeptide of a T-Cell-MMP, for example a terminus or within a second MHC polypeptide (e.g., a MHC-H peptide), or, if present, a Fc, scaffold peptide or linker attached directly or indirectly to the second MHC polypeptide. Additional second polypeptide chemical conjugation sites may be present (attached to or within) any location on the second polypeptide of the T-Cell-MMP.
- the second MHC polypeptide is a MHC-H polypeptide
- the second polypeptide comprises a Fc polypeptide
- an added glutamine or Q-tag is incorporated within the MHC-H or the Fc polypeptide sequence.
- the glutamine or Q-tag is present within a polypeptide linker between the MHC-H and Fc polypeptides, or within a linker attached to the carboxyl terminus of the Fc polypeptide.
- the glutamine -containing tag comprises an amino acid sequence selected from the group consisting of LQG, LLQGG (SEQ ID NO:62), LLQG (SEQ ID NO:63), LSLSQG (SEQ ID NO:64), and LLQLQG (SEQ ID NO:65) (numerous others are available).
- Payloads and epitopes that contain, or have been modified to contain, a primary amine group may be used as the amine donor in a transglutaminase catalyzed reaction forming a covalent bond between a glutamine residue (e.g., a glutamine residue in a Q-tag) and the epitope or payload.
- a glutamine residue e.g., a glutamine residue in a Q-tag
- an epitope or payload does not comprise a suitable primary amine to permit it to act as the amine donor
- the epitope or payload may be chemically modified to incorporate an amine group (e.g., modified to incorporate a primary amine by linkage to a lysine, aminocaproic acid, cadaverine etc.).
- an epitope or payload comprises a peptide, and requires a primary amine to act as the amine donor, a lysine, or other amine containing compound that a primary amine with a
- transglutaminase can act on, may be incorporated into the peptide.
- Other amine containing compounds that may provide a primary amine group and that may be incorporated into, or at the end of, an alpha amino acid chain include, but are not limited to, homolysine, 2,7-diaminoheptanoic acid, and aminoheptanoic acid.
- the epitope or payload may be attached to a peptide or non-peptide linker that comprises a suitable amine group.
- suitable non-peptide linkers include an alkyl linker and a PEG (polyethylene glycol) linker.
- Transglutaminase can be obtained from a variety of sources, and include enzymes from: mammalian liver (e.g., guinea pig liver); fungi (e.g., Oomycetes, Actinomycetes, Saccharomyces, Candida, Cryptococcus, Monascus, or Rhizopus transglutaminases); myxomycetes (e.g., Physarum polycephalum transglutaminase); and/or bacteria (e.g., Streptoverticillium mobarensis,
- mammalian liver e.g., guinea pig liver
- fungi e.g., Oomycetes, Actinomycetes, Saccharomyces, Candida, Cryptococcus, Monascus, or Rhizopus transglutaminases
- myxomycetes e.g., Physarum polycephalum transglutaminase
- bacteria e.g
- Streptoverticillium griseocarneum Streptoverticillium ladakanum, Streptomyces mobarensis,
- the transglutaminase is a calcium independent transglutaminase which does not require calcium to induce enzyme conformational changes and allow enzyme activity.
- a glutamine or Q-tag may be incorporated into any desired location on the first or second polypeptide of the T-Cell-MMP.
- a glutamine or Q- tag may be added at or near the terminus of any element in the first or second polypeptide of the T-Cell- MMP, including the first and second MHC polypeptides ⁇ e.g., MHC-H and ⁇ 2 ⁇ polypeptides), the scaffold or Ig Fc, and the linkers adjoining those elements.
- the first polypeptide of the T-Cell-MMP comprises a ⁇ 2 ⁇ polypeptide sequence
- the first polypeptide contains a glutamine or Q-tag at the N-terminus of the polypeptide, or at the N-terminus of a polypeptide linker attached to the first polypeptide ⁇ e.g., the linker is attached to the N-terminus of the first polypeptide).
- the glutamine or Q-tag may be used as a chemical conjugation site to introduce an epitope molecule into the T-Cell-MMP by conjugating it with a primary amine bearing epitope, or an epitope bound to a linker comprising a primary amine, that can be used as an amide donor by a transglutaminase.
- the sequences of ⁇ 2 ⁇ as shown in Fig. 4 begin with a 20 amino acid leader sequence, and the mature polypeptide begins with the initial sequence IQRTP(K/Q)IQVYS and continues through the remainder of the polypeptide.
- a Q-tag with the amino acid sequence LLQG (SEQ ID NO:63), which is representative of, and substitutable by, the other Q-tags shown above, can be incorporated at the N-terminus of ⁇ 2 ⁇ as shown:
- linkers when present, may comprise independently selected amino acid sequences (e.g., from 1 to 50 amino acids, such as polyglycine, polyalanine, polyserine and poly-Gly, such as AAAGG (SEQ ID NO:75) or (GGGGS) n where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 (SEQ ID NO:76), or a chemical group (e.g., polyethylene oxide, polyethylene glycol, etc.).
- Linkers may be present or absent and when two are shown they may be the same or different.
- a Q-tag motif is incorporated into a polypeptide comprising a ⁇ 2 ⁇ sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 4 (e.g., any of the full-length sequences shown in Fig. 4, or the sequence of any of the mature ⁇ 2 ⁇ polypeptide starting at amino acid 21 and ending at their C- terminus), with identity assessed without consideration of the added Q-tag motif and any linker sequences present.
- a Q-tag motif is incorporated into a sequence having 1 to 15 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acid deletions, insertions and/or changes compared with a sequence shown in Fig. 4 (either the entire sequences shown in Fig. 4, or the sequence of the mature polypeptides starting at amino acid 21 and ending at their C-terminus). Changes are assessed without consideration of the amino acids of the Q-tag motif and any linker sequences present.
- a Q-tag motif may replace and/or be inserted between any of the amino terminal 15 (e.g., 1-5, 5-10, or 10-15) amino acids of a mature ⁇ 2 ⁇ sequence, such as those shown in Fig. 4.
- sequence around any one, two, or three of the glutamine residues appearing in a MHC-H chain sequence appearing in a T-Cell-MMP may be modified to match that of a Q-tag and used as a chemical conjugation site for addition of an epitope or payload.
- glutamines or Q-tags may be incorporated into the IgFc region as second polypeptide chemical conjugation sites. In one such embodiment they may be utilized as sites for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker bearing primary amine.
- One strategy for providing site-specific chemical conjugation sites in the first and/or second polypeptides of a T-Cell-MMP employs the insertion of amino acids with reactivity distinct from the other amino acids present in the polypeptide.
- amino acids include, but are not limited to, the non- natural amino acids, acetylphenylalanine (p-acetyl-L -phenylalanine, pAcPhe), parazido phenylalanine, and propynyl-tyrosine, and the naturally occurring amino acid, selenocysteine (Sec).
- Thanos et al. in US Pat. Publication No. 20140051836 Al discuss some other non-natural amino acids including O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, a 3-methyl-phenylalanine, an O- 4-allyl-L -tyrosine, a 4-propyl-L -tyrosine, a tri-O-acetyl-GlcNAc -serine, L-Dopa, a fluorinated phenylalanine, an isopropyl-L-phenylalanine, a p-acyl-L-phenylalanine, a p-benzoyl-L-phenylalanine, L-phosphoserine, a phosphonoserine, a phosphonotyrosine, a p-iodo-phenylalanine, a p- bromophenylalanine, a p-amino
- Non-natural amino acids include reactive groups including amino, carboxy, acetyl, hydrazino, hydrazido, semicarbazido, sulfanyl, azido and alkynyl. See, e.g., US Pat. Publication No. 20140046030 Al.
- non-natural amino acid acetylphenylalanine may be incorporated at an amber codon using a tRNA/aminoacyl tRNA synthetase pair in an in vivo or cell free transcription-translation system.
- In vivo systems generally rely on engineered cell-lines to incorporate non-natural amino acids that act as bio-orthogonal chemical conjugation sites into polypeptides and proteins. See, e.g., International Published Application No. 2002/085923 entitled "In vivo incorporation of unnatural amino acids.”
- In vivo non-natural amino acid incorporation relies on a tRNA and an aminoacyl tRNA synthetase (aaRS) pair that is orthogonal to all the endogenous tRNAs and synthetases in the host cell.
- aaRS aminoacyl tRNA synthetase
- the non-natural amino acid of choice is supplemented to the media during cell culture or fermentation, making cell-permeability and stability important considerations.
- Various cell-free synthesis systems provided with the charged tRNA may also be utilized to incorporate non-natural amino acids. Such systems include those described in US Published Pat.
- epitopes and/or payload bearing groups reactive with the incorporated selenocysteine or non-natural amino acid are brought into contact with the T-Cell-MMP under suitable conditions to form a covalent bond.
- the keto group of the pAcPhe is reactive towards alkoxy-amines, via oxime coupling, and can be conjugated directly to alkoxyamine containing epitopes and/or payloads or indirectly to epitopes and payloads via an alkoxyamine containing linker.
- Selenocysteine reacts with, for example, primary alkyl iodides (e.g., iodoacetamide which can be used as a linker), maleimides, and methylsulfone phenyloxadiazole groups. Accordingly, epitopes and/or payloads bearing those groups or bound to linkers bearing those groups can be covalently bound to polypeptide chains bearing selenocysteines.
- primary alkyl iodides e.g., iodoacetamide which can be used as a linker
- maleimides e.g., methylsulfone phenyloxadiazole groups
- selenocysteines and/or non-natural amino acids may be incorporated into any desired location in the first or second polypeptide of the T-Cell-MMP.
- selenocysteines and/or non-natural amino acids may be added at or near the terminus of any element in the first or second polypeptide of the T-Cell-MMP, including the first and second MHC polypeptides (e.g., MHC-H and ⁇ 2 ⁇ polypeptides), the scaffold or Ig Fc, and the linkers adjoining those elements.
- selenocysteines and/or non-natural amino acids may be incorporated into a ⁇ 2 ⁇ , class I MHC heavy chain, and/or a Fc Ig polypeptide.
- selenocysteines and/or non-natural amino acids may be incorporated into the first polypeptide near or at the amino terminal end of the first MHC polypeptide (e.g., the ⁇ 2 ⁇ polypeptide) or a linker attached to it.
- the first polypeptide comprises a ⁇ 2 ⁇ sequence
- selenocysteines and/or non-natural amino acids may be incorporated at or near the N-terminus of a ⁇ 2 ⁇ sequence, permitting the chemical conjugation of, for example, an epitope either directly or through a linker.
- the sequences of ⁇ 2 ⁇ as shown in Fig. 4 begin with a 20 amino acid leader sequence, and the mature polypeptide begins with the initial sequence IQRTP(K/Q)IQVYS and continues through the remainder of the polypeptide.
- Selenocysteines and/or non-natural amino acids may be incorporated therein, for example as:
- linkers when present, may comprise independently selected amino acid sequences (e.g., from 1 to 50 amino acids such as polyglycine, polyalanine, polyserine and poly-Gly, such as AAAGG (SEQ ID NO:75) or (GGGGS) n where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 (SEQ ID NO:76)), or a chemical group (e.g., polyethylene oxide, polyethylene glycol, etc.).
- Linkers may be present or absent and when two are shown they may be the same or different.
- selenocysteines and/or non-natural amino acids are incorporated into a polypeptide comprising a ⁇ 2 ⁇ sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a ⁇ 2 ⁇ sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig. 4, or the sequence of any of the mature ⁇ 2 ⁇ polypeptides starting at amino acid 21 and ending at their C-terminus), with sequence identity assessed without consideration of the added selenocysteines and/or non-natural amino acids and any linker sequences present.
- a polypeptide comprising a ⁇ 2 ⁇ sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a ⁇ 2 ⁇ sequence shown in Fig. 4 (e.g., any of the full length sequences shown in Fig. 4, or the sequence of any of the mature ⁇ 2
- selenocysteines and/or non-natural amino acids are incorporated into a polypeptide comprising a ⁇ 2 ⁇ sequence having 1 tol5 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acid deletions, insertions and/or changes compared with a ⁇ 2 ⁇ sequence shown in Fig. 4 (e.g., any of the full-length sequences shown in Fig. 4, or the sequence of any of the mature ⁇ 2 ⁇ polypeptides starting at amino acid 21 and ending at their C-terminus). Changes are assessed without consideration of the amino acids of the selenocysteines and/or non-natural amino acids and any linker sequences present.
- a selenocysteine and/or non-natural amino acid may replace and/or be inserted between any of the amino terminal 15 amino acids of a mature ⁇ 2 ⁇ sequence, such as those shown in Fig. 4.
- selenocysteines and/or non-natural amino acids may be incorporated into polypeptides comprising a MHC-H chain or IgFc polypeptide sequences (including linkers attached thereto) as chemical conjugation sites. In one such embodiment they may be utilized as sites for the conjugation of, for example, epitopes and/or payloads conjugated to the T-Cell-MMP either directly or indirectly through a peptide or chemical linker.
- any of the variety of functionalities e.g., -SH, -N3 ⁇ 4, -OH, -COOH and the like
- the main disadvantages of utilizing such amino acid residues is the potential variability and heterogeneity of the products.
- an IgG has over 80 lysines, with over 20 at solvent- accessible sites. See, e.g., McComb and Owen, AAPS J. 117(2): 339-351.
- Cysteines tend to be less widely distributed; they tend to be engaged in disulfide bonds and may be inaccessible and not located where it is desirable to place a chemical conjugation site. Accordingly, it is possible to engineer the first and/or second polypeptide to incorporate non-naturally occurring amino acids at the desired locations for selective modification of the T-Cell-MMP first and/or second polypeptides. Engineering may take the form of direct chemical synthesis of the polypeptides (e.g., by coupling appropriately blocked amino acids) and/or by modifying the sequence of a nucleic acid encoding the polypeptide and expressing it in a cell or cell free system. Accordingly, the specification includes and provides for the preparation of all or part of the first and/or second polypeptide of a T-Cell-MMP by
- engineered polypeptide bearing a non-natural or natural (including selenocysteine) amino acid to be used as a chemical conjugation site (e.g., for epitopes or peptides).
- the engineered peptide may be joined by any suitable method, including the use of a sortase as described for epitope peptides above and may include a linker peptide sequence.
- the engineered peptide may comprise a sequence of 2, 3, 4, or 5 alanines or glycines that may serve for sortase conjugation and/or as part of a linker sequence.
- a first or second polypeptide of a T-Cell-MMP contains at least one naturally occurring amino acid to be used as a chemical conjugation site engineered into a ⁇ 2 ⁇ sequence as shown in Fig. 4, an IgFc sequence as shown in Fig. 2, or a MHC Class I heavy chain polypeptide as shown in Fig. 3.
- at least one naturally occurring amino acid to be used as a chemical conjugation site is engineered into a polypeptide having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a ⁇ 2 ⁇ sequence as shown in Fig. 4, an IgFc sequence as shown in Fig.
- At least one naturally occurring amino acid to be used as a chemical conjugation site is engineered into a T-Cell-MMP first or second polypeptide comprising: a ⁇ 2 ⁇ amino acid sequence having at least 90% (e.g., at least 93%, 95%, 98% or 99%, or even 100%) amino acid sequence identity with at least the amino terminal 10, 20, 30, 40, 50 60 or 70 amino acids of a mature ⁇ 2 ⁇ sequence as shown in Fig. 4; an IgFc sequence as shown in Fig. 2; or a MHC Class I heavy chain polypeptide as shown in Fig. 3.
- At least one naturally occurring amino acid to be used as a chemical conjugation site is engineered into a polypeptide comprising a contiguous sequence of at least 30, 40, 50, 60, 70, 80, 90, or 100 amino acids having 100% amino acid sequence identity to a ⁇ 2 ⁇ sequence as shown in Fig. 4, an IgFc sequence as shown in Fig. 2, or a MHC Class I heavy chain sequence as shown in Fig. 3.
- the amino acid may be selected from the group consisting of arginine, lysine, cysteine, serine, threonine, glutamic acid, glutamine, aspartic acid, and asparagine.
- the amino acid is selected from the group consisting of lysine, cysteine, serine, threonine, and glutamine. In another such embodiment, the amino acid is selected from the group consisting of lysine, glutamine, and cysteine. In an embodiment the amino acid is cysteine. In an embodiment the amino acid is lysine; in another embodiment the amino acid is glutamine.
- Any method known in the art may be used to couple payloads or epitopes to amino acids engineered into the first or second polypeptides of the T-Cell-MMP.
- maleimides may be utilized to couple to sulfhydryls
- N-hydroxysuccinimide may be utilized to couple to amine groups
- acid anhydrides or chlorides may be used to couple to alcohols or amines
- dehydrating agents may be used to couple alcohols or amines to carboxylic acid groups.
- an epitope or payload may be coupled directly, or indirectly through a linker (e.g., a homo- or hetero- bifunctional crosslinker), to a location on a first and/or second polypeptide.
- an epitope peptide (or a peptide -containing payload) including a maleimide amino acid can be conjugated to a sulfhydryl of a chemical conjugation site (e.g., a cysteine residue) that is naturally occurring or engineered into a T-Cell-MMP.
- a chemical conjugation site e.g., a cysteine residue
- T-Cell-MMP e.g., T-Cell-MMP.
- a Diels-Alder/retro-Diels-Alder protecting scheme it is possible to directly incorporate maleimide amino acid into a peptide (e.g., an epitope peptide) using solid phase peptide synthetic techniques. See, e.g., Koehler, Kenneth Christopher (2012),
- an epitope peptide comprises a maleimide amino acid that is coupled to a cysteine present in the binding pocket of a T-Cell-MMP.
- a maleimide may also be appended to an epitope peptide using a crosslinker that attaches a maleimide to the peptide (e.g., a heterobifunctional N- hydroxysuccinimide - maleimide crosslinker, which can attach maleimide to an amine group on, for example, a peptide lysine).
- a crosslinker that attaches a maleimide to the peptide (e.g., a heterobifunctional N- hydroxysuccinimide - maleimide crosslinker, which can attach maleimide to an amine group on, for example, a peptide lysine).
- an epitope peptide having at least one (e.g., 1 or 2) maleimide amino acid is conjugated to a MHC heavy chain having cysteine residues at any one or more (e.g., 1 or 2) amino acid positions selected from positions 5, 7, 59, 84, 116, 139, 167, 168, 170, and/or 171 (e.g., Y7C, Y59C, Y84C, Y116C, A139C, W167C, L168C, R170C, and Y171C substitutions) with the numbering as in Fig. 3D.
- a MHC heavy chain having cysteine residues at any one or more (e.g., 1 or 2) amino acid positions selected from positions 5, 7, 59, 84, 116, 139, 167, 168, 170, and/or 171 (e.g., Y7C, Y59C, Y84C, Y116C, A139C, W167C, L168C, R
- an epitope peptide having at least one (e.g., 1 or 2) maleimide amino acids is conjugated to a MHC heavy chain having cysteine residues at any one or more (e.g., 1 or 2) amino acid positions selected from positions 7, 84 and/or 116, (e.g., Y7C, Y84C, and Yl 16C substitutions) with the numbering as in Fig. 3D.
- an epitope peptide having at least one (e.g., 1 or 2) maleimide amino acids is conjugated to a MHC heavy chain having cysteine residues at any one or more (e.g., 1 or 2) amino acid positions selected from positions 84 and/or 116 (e.g., Y84C and/or Y116C substitutions) with the numbering as in Fig. 3D.
- a pair of sulfhydryl groups may be employed simultaneously to create a chemical conjugate to a T-Cell-MMP.
- a T-Cell-MMP that has a disulfide bond, or has two cysteines (or selenocysteines) engineered into locations proximate to each other, may be utilized as a chemical conjugation site through the use of bis-thiol linkers.
- Bis-thiol linkers described by Godwin and co-workers, avoid the instability associated with reducing a disulfide bond by forming a bridging group in its place and at the same time permit the incorporation of another molecule, which can be an epitope or payload.
- the bis-thiol linker may be used to incorporate an epitope or payload by reducing the bond, generally with stoichiometric or near stoichiometric amounts of dithiol reducing agents (e.g., dithiothreitol) and allowing the linker to react with both cysteine residues.
- dithiol reducing agents e.g., dithiothreitol
- the use of stoichiometric or near stoichiometric amounts of reducing agents may allow for selective modification at one site. See, e.g., Brocchini, et al., Adv. Drug. Delivery Rev. (2008) 60:3-12.
- first and/or second polypeptides of the T-Cell-MMP do not comprise a pair of cysteines and/or selenocysteines (e.g., a selenocysteine and a cysteine), they may be engineered into the polypeptide (by introducing one or both of the cysteines or selenocysteines) to provide a pair of residues that can interact with a bis-thiol linker.
- the cysteines and/or selenocysteines should be located such that a bis-thiol linker can bridge them (e.g., at a location where two cysteines could form a disulfide bond).
- cysteines and selenocysteines may be employed (i.e. two cysteines, two selenocysteines, or a selenocysteine and a cysteine).
- the cysteines and/or selenocysteines may both be present on the first and/or second polypeptide of a T-Cell-MMP.
- the cysteines and/or selenocysteines may be present on the first polypeptide and their counterpart for bis-thiol linker reaction present on the second polypeptide of a T-Cell-MMP.
- a pair of cysteines and/or selenocysteines is incorporated into a first or second polypeptide of a T-Cell-MMP comprising a ⁇ 2 ⁇ sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 4 before the addition of the pair of cysteines and/or selenocysteines, or into a peptide linker attached to one of those sequences.
- the pair of cysteines and/or selenocysteines may be utilized as a bis-thiol linker coupling site for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- the pair of cysteines and/or selenocysteines is located within 10, 20, 30, 40 or 50 amino acids of the amino terminus of the first polypeptide of the T-Cell-MMP.
- a pair of cysteines and/or selenocysteines is incorporated into an IgFc sequence incorporated into a second polypeptide to provide a chemical conjugation site.
- a pair of cysteines and/or selenocysteines is incorporated into a polypeptide comprising an IgFc sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 2 before the addition of the pair of cysteines or selenocysteines, or into a peptide linker attached to one of those sequences.
- the pair of cysteines and/or selenocysteines may be utilized as a bis-thiol linker coupling site for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- a pair of cysteines and/or selenocysteines is incorporated into a polypeptide comprising a MHC Class I heavy chain polypeptide sequence as a chemical conjugation site.
- a pair of cysteines and/or selenocysteines is incorporated into a polypeptide comprising a sequence having at least 85% (e.g., at least 90%, 95%, 98% or 99%, or even 100%) amino acid sequence identity to a sequence shown in Fig. 3 before the addition of a pair of cysteines or selenocysteines, or into a peptide linker attached to one of those sequences.
- the pair of cysteines and/or selenocysteines may be utilized as a bis-thiol linker coupling site for the conjugation of, for example, epitopes and/or payloads either directly or indirectly through a peptide or chemical linker.
- a pair of sulfhydryl groups may be employed simultaneously to create a chemical conjugate to a T-Cell-MMP.
- a T-Cell-MMP that has a disulfide bond, or has two cysteines (or selenocysteines) engineered into locations proximate to each other may be utilized as a chemical conjugation site through the use of bis-thiol linkers.
- carbohydrates e.g., oligosaccharides of the type added to antibodies expressed in mammalian cells. Accordingly, where first and/or second polypeptides of a T-Cell-MMP are prepared by cellular expression, carbohydrates may be present and available as site selective chemical conjugation sites in glycol-conjugation reactions. McCombs and Owen, AAPS Journal, (2015) 17(2): 339-351, and references cited therein describe the use of carbohydrate residues for glycol-conjugation of molecules to antibodies.
- carbohydrate residues may also be conducted ex vivo, through the use of chemicals that alter the carbohydrates (e.g., periodate, which introduces aldehyde groups), or by the action of enzymes (e.g., fucosyltransferases) that can incorporate chemically reactive carbohydrates or carbohydrate analogs for use as chemical conjugation sites.
- chemicals that alter the carbohydrates e.g., periodate, which introduces aldehyde groups
- enzymes e.g., fucosyltransferases
- the incorporation of an IgFc scaffold with known glycosylation sites may be used to introduce site specific chemical conjugation sites.
- This disclosure includes and provides for T-Cell-MMPs and their epitope conjugates having carbohydrates as chemical conjugation (glycol-conjugation) sites.
- the disclosure also includes and provides for the use of such molecules in forming conjugates with epitopes and with other molecules such as drugs and diagnostic agents, and the use of those molecules in methods of medical treatment and diagnosis.
- Nucleotide binding sites offer site-specific functionalization through the use of a UV -reactive moiety that can covalently link to the binding site.
- Bilgicer et ah Bioconjug Chem. 2014;25(7): 1198— 202, reported the use of an indole-3 -butyric acid (IBA) moiety that can be covalently linked to an IgG at a nucleotide binding site.
- IBA indole-3 -butyric acid
- T-Cell-MMP By incorporation of the sequences required to form a nucleotide binding site, chemical conjugates of T-Cell-MMP with suitably modified epitopes and/or other molecules (e.g., drugs or diagnostic agents) bearing a reactive nucleotide may be employed to prepare T-Cell-MMP- epitope conjugates.
- other molecules e.g., drugs or diagnostic agents
- This disclosure includes and provides for T-Cell-MMPs having nucleotide binding sites as chemical conjugation sites.
- the disclosure also includes and provides for the use of such molecules in forming conjugates with epitopes and with other molecules such as drugs and diagnostic agents, and the use of those molecules in methods of treatment and diagnosis. I.A.2.7 Binding and Properties of T-Cell-MMPs, Epitopes and MOD
- the present disclosure provides T-Cell-MMP-epitope conjugates.
- the disclosure provides for a T-Cell-MMP epitope conjugate comprising: a) a first polypeptide; and b) a second polypeptide, wherein the first and second polypeptides of the multimeric polypeptide comprise an epitope; a first MHC polypeptide; a second MHC polypeptide; and optionally an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold.
- the present disclosure also provides a T-Cell-MMP-epitope conjugate comprising: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) optionally an Ig Fc polypeptide or a non-Ig scaffold.
- At least one of the first and second polypeptides of the T-Cell-MMP-epitope conjugates of the present disclosure comprise one or more (e.g., at least one) MODs.
- the one or more MODs are located at: A) the C-terminus of the first polypeptide; B) the N-terminus of the second polypeptide; C) the C-terminus of the second polypeptide; and/or D) at the C-terminus of the first polypeptide and at the N-terminus of the second polypeptide.
- At least one (e.g., at least two, or at least three) of the one or more MODs is a variant MOD that exhibits reduced affinity to a Co-MOD compared to the affinity of a corresponding wild-type MOD for the Co-MOD.
- the epitope present in a T-Cell-MMP-epitope conjugate of the present disclosure binds to a T-cell receptor (TCR) on a T-cell with an affinity of at least 100 ⁇ (e.g., at least 10 ⁇ , at least 1 ⁇ , at least 100 nM, at least 10 nM or at least 1 nM).
- TCR T-cell receptor
- a T-Cell- MMP-epitope conjugate of the present disclosure binds to a first T-cell with an affinity that is at least 25% higher than the affinity with which the T-Cell-MMP-epitope conjugate binds to a second T-cell, where the first T-cell expresses on its surface the Co-MOD and a TCR that binds the epitope with an affinity of at least 100 ⁇ , and where the second T-cell expresses on its surface the Co-MOD but does not express on its surface a TCR that binds the epitope with an affinity of at least 100 ⁇ (e.g., at least 10 ⁇ , at least 1 ⁇ , at least 100 nM, at least 10 nM, or at least 1 nM).
- the epitope present in a T-Cell-MMP-epitope conjugate of the present disclosure binds to a TCR on a T-cell with an affinity of from about 10 4 M to about 5 x 10 4 M, from about 5 x 10 4 M to about 10 -5 M, from about 10 -5 M to about 5 x 10 -5 M, from about 5 x 10 -5 M to about 10 6 M, from about 10 6 M to about 5 x 10 6 M, from about 5 x 10 6 M to about 10 7 M, from about 10 7 M to about 10 s M or from about 10 s M to about 10 9 M.
- the epitope present in a T-Cell-MMP-epitope conjugate of the present disclosure binds to a TCR on a T-cell with an affinity of from about 0.1 ⁇ to about 0.5 ⁇ , from about 0.5 ⁇ to about 1 ⁇ , from about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or from about 75 ⁇ to about 100 ⁇ .
- a variant MOD present in a T-Cell-MMP-epitope conjugate of the present disclosure binds to its Co-MOD with an affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the affinity of a corresponding wild- type MOD for the Co-MOD.
- a variant MOD present in a T-Cell-MMP-epitope conjugate of the present disclosure has a binding affinity for a Co-MOD that is from 1 nM to 100 nM, or from 100 nM to 100 ⁇ .
- a variant MOD present in a T-Cell-MMP-epitope conjugate of the present disclosure has a binding affinity for a Co-MOD that is from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM, from about 100 nM to about 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇
- a variant MOD present in a T-Cell-MMP of the present disclosure has a binding affinity for a Co-MOD that is from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM.
- a T-Cell-MMP-epitope conjugate of the present disclosure binds selectively to a first T-cell that displays both: i) a TCR specific for the epitope present in the T-Cell-MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell-MMP-epitope conjugate, compared to binding to a second T-cell that displays: i) a TCR specific for an epitope other than the epitope present in the T-Cell-MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell-MMP-epitope conjugate.
- a T-Cell-MMP-epitope conjugate of the present disclosure binds to the first T-cell with an affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 200% (2-fold), at least 250% (2.5- fold), at least 500% (5-fold), at least 1,000% (10-fold), at least 1,500% (15-fold), at least 2,000% (20- fold), at least 2,500% (25-fold), at least 5,000% (50-fold), at least 10,000% (100-fold), or more than 100-fold, higher than the affinity to which it binds the second T-cell.
- a T-Cell-MMP epitope conjugate of the present disclosure when administered to an individual in need thereof, induces both an epitope-specific T-cell response and an epitope nonspecific T-cell response.
- the T-Cell-MMP epitope conjugate of the present disclosure when administered to an individual in need thereof, induces an epitope-specific T-cell response by modulating the activity of a first T-cell that displays both: i) a TCR specific for the epitope present in the T-Cell-MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell- MMP-epitope conjugate.
- the T-Cell-MMP epitope conjugate also induces an epitope non-specific T- cell response by modulating the activity of a second T-cell that displays: i) a TCR specific for an epitope other than the epitope present in the T-Cell-MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell-MMP-epitope conjugate.
- the ratio of the epitope-specific T- cell response to the epitope-non-specific T-cell response is at least 2: 1, at least 5:1, at least 10: 1, at least 15: 1, at least 20: 1, at least 25: 1, at least 50: 1, or at least 100: 1.
- the range of the epitope-specific T-cell response to the epitope-non-specific T-cell response is from about 2: 1 to about 5: 1, from about 5: 1 to about 10: 1, from about 10: 1 to about 15: 1, from about 15: 1 to about 20: 1, from about 20: 1 to about 25: 1, from about 25: 1 to about 50: 1, from about 50: 1 to about 100: 1, or more than 100: 1.
- Modulating the activity of a T-cell can include one or more of: i) activating a cytotoxic (e.g., CD8 + ) T-cell; ii) inducing cytotoxic activity of a cytotoxic (e.g., CD8 + ) T-cell; iii) inducing production and release of a cytotoxin (e.g., a perforin; a granzyme; a granulysin) by a cytotoxic (e.g., CD8 + ) T-cell; and iv) inhibiting activity of an autoreactive T-cell; and the like.
- a cytotoxic e.g., CD8 +
- a cytotoxic activity of a cytotoxic e.g., CD8 +
- a cytotoxin e.g., a perforin; a granzyme; a granulysin
- a T-Cell-MMP-epitope conjugate of the present disclosure binds with higher avidity to a first T-cell that displays both: i) a TCR specific for the epitope present in the T-Cell- MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell-MMP-epitope conjugate, compared to the avidity with which it binds to a second T-cell that displays: i) a TCR specific for an epitope other than the epitope present in the T-Cell-MMP-epitope conjugate; and ii) a Co-MOD that binds to the MOD present in the T-Cell
- Binding affinity between a MOD and its Co-MOD can be determined by bio-layer interferometry (BLI) using purified MOD and purified Co-MOD. Binding affinity between a T-Cell- MMP-epitope conjugate and its Co-MOD can be determined by BLI using purified T-Cell-MMP- epitope conjugate and the Co-MOD. BLI methods are well known to those skilled in the art. See, e.g., Lad et al. (2015) /. Biomol. Screen., 20(4):498-507; and Shah and Duncan (2014) /. Vis. Exp.
- a BLI assay can be carried out using an Octet RED 96 (Pal ForteBio) instrument, or a similar instrument, as follows.
- a Co-MOD for a T-Cell-MMP or its epitope conjugate
- the T-Cell-MMP or its epitope conjugate
- the T-Cell-MMP is immobilized onto an insoluble support (a "biosensor").
- the immobilized T- Cell-MMP (or its epitope conjugate) is the "target.” Immobilization can be effected by immobilizing a capture antibody onto the insoluble support, where the capture antibody immobilizes the T-Cell-MMP (or its epitope conjugate).
- immobilization can be effected by immobilizing anti-Fc (e.g., anti-human IgG Fc) antibodies onto the insoluble support, and contacting the T-Cell-MMP epitope conjugate with the immobilized anti-Fc antibodies which will bind to and immobilize it.
- a Co-MOD is applied, at several different concentrations, to the immobilized T-Cell-MMP (or its immobilized epitope conjugate), and the instrument's response recorded. Assays are conducted in a liquid medium comprising 25mM HEPES pH 6.8, 5% polyethylene glycol) 6000, 50 mM KC1, 0.1% bovine serum albumin, and 0.02% Tween 20 nonionic detergent. Binding of the Co-MOD to the immobilized T-Cell-MMP(or its epitope conjugate) is conducted at 30°C. As a positive control for binding affinity, an anti-MHC Class I monoclonal antibody can be used.
- anti-HLA Class I monoclonal antibody W6/32(American Type Culture Collection No. HB-95; Parham et al. (1979) /. Immunol. 123:342), which has a KD of 7 nM, can be used.
- a standard curve can be generated using serial dilutions of the anti-MHC Class I monoclonal antibody.
- the Co-MOD, or the anti-MHC Class I mAb is the "analyte.”
- BLI analyzes the interference pattern of white light reflected from two surfaces: i) from the immobilized polypeptide ("target"); and ii) from an internal reference layer.
- a change in the number of molecules ("analyte”; e.g., Co-MOD; anti-HLA antibody) bound to the biosensor tip causes a shift in the interference pattern; this shift in interference pattern can be measured in real time.
- the two kinetic terms that describe the affinity of the target/analyte interaction are the association constant (k a ) and dissociation constant (k d ). The ratio of these two terms (kjk ⁇ ) gives rise to the affinity constant KD.
- the assay can also be conducted with purified wild-type or its variant MOD immobilized on the biosensor while the Co-MOD is applied, at several different concentrations, to determine the binding parameters between a MOD and its Co-MOD.
- a Co-MOD e.g., IL-2R
- a wild-type MOD e.g., IL-2
- a variant MOD e.g., an IL-2 variant as disclosed herein
- T-Cell-MMP or its epitope conjugate
- the BLI assay is carried out in a multi-well plate. To run the assay, the plate layout is defined, the assay steps are defined, and biosensors are assigned in Octet Data Acquisition software. The biosensor assembly is hydrated. The hydrated biosensor assembly and the assay plate are equilibrated for 10 minutes on the Octet instrument. Once the data are acquired, the acquired data are loaded into the Octet Data Analysis software. The data are processed in the Processing window by specifying method for reference subtraction, y-axis alignment, inter-step correction, and Savitzky- Golay filtering. Data are analyzed in the Analysis window by specifying steps to analyze (Association and Dissociation), selecting curve fit model (1 : 1), fitting method (global), and window of interest (in seconds).
- K D values for each data trace can be averaged if within a 3-fold range.
- K D error values should be within one order of magnitude of the affinity constant values; R 2 values should be above 0.95. See, e.g., Abdiche et al. (2008), /. Anal. Biochem. , 377:209.
- the affinity of a T-Cell-MMP-epitope conjugate of the present disclosure for a Co-MOD is determined using BLI, as described above.
- the affinity of a MOD and its Co-MOD polypeptide can be determined using BLI as described above.
- the ratio of: i) the binding affinity of a control T-Cell-MMP-epitope conjugate (where the control comprises a wild-type MOD) to a Co-MOD to ii) the binding affinity of a T-Cell- MMP-epitope conjugate of the present disclosure comprising a variant of the wild-type MOD to the Co- MOD, when measured by BLI (as described above), is at least 1.5: 1, at least 2:1, at least 5: 1, at least 10: 1, at least 15: 1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 :1, at least 5 x 10 2 : 1, at least 10 3 :1, at least 5 x 10 3 :1, at least 10 4 :1, at least 10 5 :1, or at least 10 6 :1.
- the ratio of: i) the binding affinity of a control T-Cell-MMP-epitope conjugate (where the control comprises a wild-type MOD) to a Co-MOD to ii) the binding affinity of a T-Cell-MMP-epitope conjugate of the present disclosure comprising a variant of the wild-type MOD to the Co-MOD, when measured by BLI, is in a range of from 1.5: 1 to 10 6 : 1 , e.g., from 1.5: 1 to 10: 1, from 10: 1 to 50: 1, from 50: 1 to 10 2 :1, from 10 2 : 1 to 10 3 : 1, froml0 3 : l to 10 4 : 1, from 10 4 : 1 to 10 5 : 1, or from 10 s : l to 10 6 :1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type IL-2 polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant IL-2 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type IL-2 polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell- MMP-epitope conjugate to an IL-2 receptor (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell- MMP-epitope conjugate of the present disclosure to the IL-2 receptor (i.e., the Co-MOD), when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15:1, at least 20:1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500:1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 : 1, at least 10 4 : 1 , at least 10 5 : 1, or at least 10 6 :1.
- a control T-Cell- MMP-epitope conjugate comprises a wild-type IL-2 polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant IL-2 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type IL-2 polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell-MMP-epitope conjugate to IL-2 receptor (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the IL-2 receptor when measured by BLI, is in a range of from 1.5:1 to 10 6 : 1 , e.g., from 1.5: 1 to 10: 1, from 10: 1 to 50: 1, from 50: 1 to 10 2 : 1, from 10 2 : 1 to 10 3 :1, froml0 3 : l to 10 4 : 1, from 10 4 :1 to 10 s : 1, or from 10 s : 1 to 10 6 :1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type PD-Ll polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant PD-Ll polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type PD-Ll polypeptide) as the MOD
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the PD-1 polypeptide, when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15:1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 : 1, at least 10 4 :1, at least 10 5 : 1, or at least 10 6 :1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type CD80 polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell-MMP-epitope conjugate to CTLA4 polypeptide (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the CTLA4 polypeptide, when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15: 1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 : 1, at least 5 x 10 2 : 1, at least 10 3 : 1, at least 5 x 10 3 :1, at least 10 4 :1, at least 10 5 :1, or at least 10 6 : 1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type CD80 polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell-MMP-epitope conjugate to CD28 polypeptide (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the CD28 polypeptide, when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15:1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 : 1, at least 10 4 :1, at least 10 5 : 1, or at least 10 6 :1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type 4- 1BBL polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant 4-lBBL polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type 4-lBBL polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell-MMP-epitope conjugate to 4- IBB polypeptide (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the 4-lBB polypeptide, when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15:1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 : 1, at least 10 4 :1, at least 10 5 : 1, or at least 10 6 :1.
- a control T-Cell-MMP-epitope conjugate comprises a wild-type CD86 polypeptide
- a T-Cell-MMP-epitope conjugate of the present disclosure comprises a variant CD86 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild- type CD 86 polypeptide) as the MOD, the ratio of: i) the binding affinity of the control T-Cell-MMP-epitope conjugate to CD28 polypeptide (i.e.
- the Co-MOD) to ii) the binding affinity of the T-Cell-MMP-epitope conjugate of the present disclosure to the CD28 polypeptide, when measured by BLI, is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15:1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 : 1, at least 10 4 :1, at least 10 5 : 1, or at least 10 6 :1.
- Binding affinity of a T-Cell-MMP-epitope conjugate of the present disclosure to a target T- cell can be measured in the following manner: A) contacting a T-Cell-MMP-epitope conjugate of the present disclosure with a target T-cell expressing on its surface: i) a Co-MOD that binds to the parental wild-type MOD; and ii) a TCR that binds to the epitope, where the T-Cell-MMP-epitope conjugate comprises an epitope tag or fluorescent label, such that the T-Cell-MMP-epitope conjugate binds to the target T-cell; B) if the T-Cell-MMP epitope conjugate is unlabeled, contacting the target T-cell-bound T-Cell-MMP-epitope conjugate with a fluorescently labeled binding agent (e.g., a fluorescently labeled antibody) that binds to the epitope tag
- the epitope tag can be, e.g., a FLAG tag, a hemagglutinin tag, a c-myc tag, a poly(histidine) tag, etc.
- the MFI measured over a range of concentrations of the T-Cell-MMP-epitope conjugate (library member) provides a measure of the affinity.
- the MFI measured over a range of concentrations of the T-Cell-MMP-epitope conjugate (library member) provides a half maximal effective concentration (EC50) of the T-Cell-MMP-epitope conjugate.
- the EC5 0 of a T-Cell-MMP-epitope conjugate of the present disclosure for a target T-cell is in the nM range; and the EC5 0 of the T-Cell-MMP-epitope conjugate for a control T-cell (where a control T-cell expresses on its surface: i) a Co-MOD that binds the parental wild-type MOD; and ii) a T-cell receptor that does not bind to the epitope present in the T-Cell-MMP-epitope conjugate) is in the ⁇ range.
- the ratio of the ECso of a T-Cell-MMP-epitope conjugate of the present disclosure for a control T-cell to the EC5 0 of the T-Cell-MMP-epitope conjugate for a target T- cell is at least 1.5: 1, at least 2: 1, at least 5: 1, at least 10: 1, at least 15: 1, at least 20: 1, at least 25: 1, at least 50: 1, at least 100: 1, at least 500: 1, at least 10 2 : 1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 :1, at least 10 4 : 1 , at lease 10 s : 1, or at least 10 6 :1.
- the ratio of the ECso of a T-Cell-MMP-epitope conjugate of the present disclosure for a control T-cell to the EC5 0 of the T-Cell-MMP-epitope conjugate for a target T-cell is an expression of the selectivity of the T-Cell-MMP-epitope conjugate.
- a T-Cell-MMP- epitope conjugate of the present disclosure exhibits selective binding to a target T-cell, compared to binding of the T-Cell-MMP-epitope conjugate (library member) to a control T-cell that comprises: i) the Co-MOD that binds the parental wild-type MOD; and ii) a TCR that binds to an epitope other than the epitope present in the T-Cell-MMP-epitope conjugate library member.
- T-Cell-MMPs of the present disclosure can be dimerized, i.e., the present disclosure provides a multimeric polypeptide comprising a dimer of a multimeric T-Cell-MMP of the present disclosure.
- the present disclosure provides a multimeric T-Cell-MMP comprising: A) a first heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising a second MHC polypeptide, wherein the first heterodimer comprises one or more MODs; and B) a second heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising a second MHC polypeptide, wherein the second heterodimer comprises one or more MODs, and wherein the first heterodimer and the second heterodimer are covalently linked to one another.
- the two multimeric T-Cell-MMPs are identical to one another in amino acid sequence.
- the first heterodimer and the second heterodimer are covalently linked to one another via a C-terminal region of the second polypeptide of the first heterodimer and a C-terminal region of the second polypeptide of the second heterodimer.
- the first heterodimer and the second heterodimer are covalently linked to one another via the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer; for example, in some cases, the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer are linked to one another, either directly or via a linker.
- the linker can be a peptide linker.
- the peptide linker can have a length of from 1 aa to 200 aa (e.g., from 1 aa to 5 aa, from 5 aa to 10 aa, from 10 aa to 25 aa, from 25 aa to 50 aa, from 50 aa to 100 aa, from 100 aa to 150 aa, or from 150 aa to 200 aa).
- the peptide epitope of the first heterodimer and the peptide epitope of the second heterodimer comprise the same amino acid sequence.
- the first MHC polypeptides of the first and second heterodimers are MHC Class I ⁇ 2 ⁇ , and the second MHC polypeptides of the first and second heterodimers are MHC Class I heavy chain.
- the MOD of the first heterodimer and the MOD of the second heterodimer comprise the same amino acid sequence.
- the MOD of the first heterodimer and the MOD of the second heterodimer are variant MODs that comprise from 1 to 10 amino acid substitutions compared to a corresponding parental wild-type MOD, wherein from 1 to 10 amino acid substitutions result in reduced affinity binding of the variant MOD to a Co-MOD.
- the MOD of the first heterodimer and the MOD of the second heterodimer are selected from the group consisting of IL- 2, 4-1BBL, PD-L1, CD70, CD80, CD86, ICOS-L, OX-40L, FasL, JAG1(CD339), TGF , ICAM, and variant MODs thereof (e.g., variant MODs having 1 to 10 amino acid substitutions compared to a corresponding parental wild-type MOD). Examples of suitable MHC polypeptides, MODs, and peptide epitopes are described below.
- T-Cell-MMPs and T-Cell-MMP epitope conjugates of the present disclosure may form higher order complexes including trimers, tetramers, or pentamers.
- Compositions comprising multimers of T-Cell-MMPs may also comprise lower order complexes such as monomers and, accordingly, may comprise monomers, dimers, trimers, tetramers, pentamers, or combinations of any thereof (e.g., a mixture of monomers and dimers).
- T-Cell-MMPs and T-Cell-MMP-epitope conjugates include MHC polypeptides.
- MHC polypeptides include MHC Class I polypeptides of various species, including human MHC (also referred to as human leukocyte antigen (HLA)) polypeptides, rodent (e.g., mouse, rat, etc.) MHC polypeptides, and MHC polypeptides of other mammalian species (e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- MHC polypeptide is meant to include Class I MHC polypeptides (e.g., ⁇ -2 microglobulin and MHC Class I heavy chain and/or portions thereof).
- the first and second MHC polypeptides of the T-Cell-MMPs and T-Cell- MMP-epitope conjugates described herein are Class I MHC polypeptides (e.g., in some cases, the first MHC polypeptide is a MHC Class I ⁇ 2 ⁇ ( ⁇ 2 ⁇ ) polypeptide, and the second MHC polypeptide is a MHC Class I heavy chain (H chain) (“MHC-H”)).
- MHC-H MHC Class I heavy chain
- both the ⁇ 2 ⁇ and MHC-H chain sequences in a T-Cell-MMP (or its epitope conjugate) are of human origin.
- the T-Cell-MMPs described herein are not intended to include membrane anchoring domains (transmembrane regions) of the MHC Class I molecule, or a part of that molecule sufficient to anchor the resulting T-Cell-MMP, or a peptide thereof, to a cell (e.g., eukaryotic cell such as a mammalian cell) in which it is expressed.
- a cell e.g., eukaryotic cell such as a mammalian cell
- a MHC polypeptide of a T-Cell-MMP, or a T-Cell-MMP-epitope conjugate is a Class I HLA polypeptide, e.g., a ⁇ 2 ⁇ polypeptide, or a Class I HLA heavy chain polypeptide.
- Class I HLA heavy chain polypeptides that can be included in a T-Cell-MMP or their epitope conjugates include HLA-A heavy chain polypeptides, HLA-B heavy chain polypeptides, HLA-C heavy chain polypeptides, HLA-E heavy chain polypeptides, HLA-F heavy chain polypeptides, and HLA-G heavy chain polypeptides, or polypeptides comprising a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity (e.g., they may comprise 1-30, 1-5, 5-10, 10-15, 15-20, 20-25 or 25-30 amino acid insertions, deletions, and/or substitutions) to amino acids 25-365 of the amino acid sequence of any of the human HLA heavy chain polypeptides depicted in FIGs.
- HLA-A heavy chain polypeptides HLA-B heavy chain polypeptides, HLA-C heavy chain polypeptid
- a MHC Class I heavy chain polypeptide of a multimeric polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to amino acids 25-365 of the amino acid sequence of any of the human HLA-A heavy chain polypeptides depicted in FIG. 3A.
- HLA-A HLA-A*01:01:01:01
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-A*01 :01 :01 :01 (HLA-A in FIG. 3D (SEQ ID NO: 140)), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-A heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a substitution at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-A heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations.
- the HLA-A heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations.
- the HLA-A heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-A*0201 (SEQ ID NO: 143) provided in FIG. 3D, or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-A*0201 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-A*0201 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-A*0201 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-A*0201 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-A*1101(SEQ ID NO: 148) provided in FIG. 3D, or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-A*1101 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-A*1101 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-A*1101 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-A*1101 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-A*2402 (SEQ ID NO: 149) provided in FIG. 3D, or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-A*2402 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-A*2402 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-A*2402 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-A*2402 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations. HLA-A*3303
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-A*3303 (SEQ ID NO: 150) provided in FIG. 3D, or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-A*3303 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-A*3303 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-A*3303 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-A*3303 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-B (SEQ ID NO: 141) (HLA-B in FIG. 3D), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-B heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-B heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-B heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-B heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of HLA-C (SEQ ID NO: 142) (HLA-C in FIG. 3D), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-C heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-C heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the HLA-C heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the HLA-C heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- a MHC Class I heavy chain polypeptide of a T-Cell-MMP or a T-Cell- MMP-epitope conjugate comprises an amino acid sequence of MOUSE H2K (SEQ ID NO: 144) (MOUSE H2K in FIG. 3D), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the MOUSE H2K heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the MOUSE H2K heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84A and A236C mutations. In an embodiment, the MOUSE H2K heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C and A139C mutations. In an embodiment, the MOUSE H2K heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises the Y84C, A139C and A236C mutations.
- Any MHC Class I heavy chain sequences may further comprise a cysteine substitution at position 116 (Yl 16C, providing thiol for anchoring an epitope peptide such as by reaction with a maleimide peptide) and/or one of an alanine (W167A) or cysteine (W167C) at position 167.
- substitutions that open one end of the MHC-H binding pocket e.g., at position 84 or its equivalent such as Y84A
- substitution of an alanine or glycine at position 167 or its equivalent e.g., a W167A substitution
- substitutions at positions 84 and 167 or their equivalent may be used in combination to modify the binding pocket of MHC-H chains.
- a cysteine at position 167 (e.g., a W167C mutation) or its equivalent provides a thiol residue for anchoring an epitope peptide).
- Cysteine substitutions at positions 116 and 167 may be used separately to anchor epitopes (e.g., epitope peptides), or in combination to anchor the epitope in two locations (e.g., the ends of the epitope containing peptide.
- Mutations at positions 116 and/or 167 may be combined with any one or more mutations at positions 84, 139 and/or 236 described above.
- amino acids 84 and 139 are both cysteines they may form an intrachain disulfide bond which can stabilize the MHC Class 1 protein and permit translation and excretion by eukaryotic cells, even when not loaded with an epitope peptide.
- position 84 is a C residue, it can also form an intrachain disulfide bond with a linker attached to the N-terminus of a ⁇ 2 ⁇ polypeptide (e.g., epitope - GCGGS(G 4 S)n (SEQ ID NO: 133) mature ⁇ 2 ⁇ polypeptide, see SEQ ID NOs: 151 to 155).
- amino acid 236 When amino acid 236 is a cysteine it can form an interchain disulfide bond with cysteine at amino acid 12 of a variant ⁇ 2 ⁇ polypeptide that comprises R12 C substitution at that position.
- MHC Class 1 heavy chain sequence modifications that may be incorporated into a T- Cell-MMP or its epitope conjugate are shown in the Table that follows. Any combination of substitutions provided in the table at residues 84, 139 and 236 may be combined with any combination of substitutions at positions 116 and 167 provided in the table.
- a ⁇ 2 ⁇ polypeptide of a multimeric polypeptide can be a human ⁇ 2 ⁇ polypeptide, a non- human primate ⁇ 2 ⁇ polypeptide, a murine ⁇ 2 ⁇ polypeptide, and the like.
- a ⁇ 2 ⁇ polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to a ⁇ 2 ⁇ amino acid sequence depicted in FIG. 4.
- a ⁇ 2 ⁇ polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to amino acids 21 to 119 of a ⁇ 2 ⁇ amino acid sequence depicted in FIG. 4.
- a MHC polypeptide comprises a single amino acid substitution relative to a reference MHC polypeptide (where a reference MHC polypeptide can be a wild-type MHC
- cysteine residues when present in a MHC polypeptide of a first polypeptide of a T-Cell- MMP, or its epitope conjugate, can form a disulfide bond with a cysteine residue present in a second polypeptide chain.
- a first MHC polypeptide in a first polypeptide of a multimeric polypeptide, and/or a second MHC polypeptide in a second polypeptide of a multimeric polypeptide include an amino acid substitution to substitute an amino acid with a cysteine, where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with a cysteine in the second MHC polypeptide, where a cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide, or where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide.
- one of following pairs of residues in a HLA ⁇ 2 ⁇ and a HLA Class I heavy chain is substituted with cysteines (where residue numbers are those of the mature polypeptide): 1) ⁇ 2 ⁇ residue 12, HLA Class I heavy chain residue 236; 2) ⁇ 2 ⁇ residue 12, HLA Class I heavy chain residue 237; 3) ⁇ 2 ⁇ residue 8, HLA Class I heavy chain residue 234; 4) ⁇ 2 ⁇ residue 10, HLA Class I heavy chain residue 235; 5) ⁇ 2 ⁇ residue 24, HLA Class I heavy chain residue 236; 6) ⁇ 2 ⁇ residue 28, HLA Class I heavy chain residue 232; 7) ⁇ 2 ⁇ residue 98, HLA Class I heavy chain residue 192; 8) ⁇ 2 ⁇ residue 99, HLA Class I heavy chain residue 234; 9) ⁇ 2 ⁇ residue 3, HLA Class I heavy chain residue 120; 10) ⁇ 2 ⁇ residue 31, HLA Class I heavy chain residue 96; 11) ⁇ 2 ⁇ residue 53, HLA Class I heavy chain residue 35;
- the amino acid numbering of the MHC/HLA Class I heavy chain is in reference to the mature MHC/HLA Class I heavy chain, without a signal peptide.
- Glyl20 is Glyl44
- Gln96 is Glnl20; etc.
- the ⁇ 2 ⁇ polypeptide comprises an R12C substitution
- the HLA Class I heavy chain comprises an A236C substitution; in such cases, a disulfide bond forms between Cys-12 of the ⁇ 2 ⁇ polypeptide and Cys-236 of the HLA Class I heavy chain.
- residue 236 of the mature HLA-A amino acid sequence ⁇ i.e.
- residue 260 of the amino acid sequence depicted in FIG. 3A is substituted with a Cys.
- residue 236 of the mature HLA-B amino acid sequence ⁇ i.e. , residue 260 of the amino acid sequence depicted in FIG. 3B) is substituted with a Cys.
- residue 236 of the mature HLA-C amino acid sequence ⁇ i.e., residue 260 of the amino acid sequence depicted in FIG. 3C) is substituted with a Cys.
- residue 32 (corresponding to Arg-12 of mature ⁇ 2 ⁇ ) of an amino acid sequence depicted in FIG. 4 is substituted with a Cys.
- the HLA-heavy chain of a T-Cell-MMP or its epitope conjugate may be substituted with cysteines to form an intrachain disulfide bond between a cysteine substituted into the carboxyl end portion of the al helix and a cysteine in the amino end portion of the a2-l helix.
- Such disulfide bonds stabilize the T-Cell-MMP and permit its cellular processing and excretion from eukaryotic cells in the absence of a bound epitope peptide (or null peptide).
- the carboxyl end portion of the al helix is from about amino acid position 79 to about amino acid position 89 and the amino end portion of the a2-l helix is from about amino acid position 134 to amino acid position 144 of the MHC Class I heavy chain (the amino acid positions are determined based on the sequence of the heavy chains without their leader sequence ⁇ see, e.g., FIG. 3D).
- the disulfide bond is between a cysteine located at positions 83, 84, or 85 and a cysteine located at any of positions 138, 139 or 140 of the MHC Class I heavy chain.
- a disulfide bond may be formed from cysteines incorporated into the MHC Class I heavy chain at amino acid 83 and a cysteine at an amino acid located at any of positions 138, 139 or 140.
- a disulfide bond may be formed between a cysteine inserted at position 84 and a cysteine inserted at any of positions 138, 139 or 140, or between a cysteine inserted at position 85 and a cysteine at any one of positions 138, 139 or 140.
- the MHC Class 1 heavy chain intrachain disulfide bond is between cysteines substituted into a heavy chain sequence at positions 84 and 139 ⁇ e.g., the heavy chain sequence may be one of the heavy chain sequences set forth in FIG. 3D).
- the heavy chain sequence may be one of the heavy chain sequences set forth in FIG. 3D.
- any of the MHC Class I intrachain disulfide bonds, including a disulfide bond between cysteines at 84 and 139 may be combined with intrachain disulfide bonds including a bond between MHC Class 1 heavy position 236 and position 12 of a mature ⁇ 2 ⁇ polypeptide sequence (lacking its leader) as shown, for example, in FIG. 4.
- an intrachain disulfide bond may be formed in a MHC-H sequence of a T-Cell-MMP, or its epitope conjugate, between a cysteine substituted into the region between amino acid positions 79 and 89 and a cysteine substituted into the region between amino acid positions 134 and 144 of the sequences given in FIG. 3D.
- the MHC Class I heavy chain sequence may have insertions, deletions and/or substitutions of 1 to 5 amino acids preceding or following the cysteines forming the disulfide bond between the carboxyl end portion of the al helix and the amino end portion of the a2-l helix. Any inserted amino acids may be selected from the naturally occurring amino acids or the naturally occurring amino acids except proline and alanine.
- the ⁇ 2 ⁇ polypeptide of a T-Cell-MMP or its epitope conjugate comprises a mature ⁇ 2 ⁇ polypeptide sequence (aas 21-119) of any one of NP_004039.1, NP_ 001009066.1, NP_ 001040602.1, NP_ 776318.1 , or NP_ 033865.2( SEQ ID NOs 151 tol55).
- a HLA Class I heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises any one of the HLA-A, B or C sequences set forth in FIG. 3D. Any of the heavy chain sequences may further comprise cysteine substitutions at positions 84 and 139, which may form an intrachain disulfide bond.
- the ⁇ 2 ⁇ polypeptide of a T-Cell-MMP, or its epitope conjugate comprises a mature ⁇ 2 ⁇ polypeptide sequence (aas 21-119) of any one of the sequences in FIG. 4, which further comprises a R12C substitution.
- a T-Cell-MMP or its epitope conjugate, comprises a first polypeptide comprising a mature ⁇ 2 ⁇ polypeptide sequence (e.g., aas 21-119 of any one of the sequences in FIG. 4) having a R12C substitution, and a second polypeptide comprising any one of the HLA-A, B or C heavy chain sequences in FIG. 3D bearing a cysteine at position 236.
- an intrachain disulfide bond may form between the cysteines at positions 12 and 236.
- any of the heavy chain sequences may further comprise cysteine substitutions at positions 84 and 139, which may form an intrachain disulfide bond.
- a HLA Class I heavy chain polypeptide of a T-Cell-MMP, or its epitope conjugate comprises the amino acid sequence of HLA-A*0201 (FIG. 3D).
- a HLA Class I heavy chain polypeptide of a T-Cell-MMP, or its epitope conjugate comprises the amino acid sequence of HLA-A*0201 having an A236C substitution (FIG. 3D).
- a HLA Class I heavy chain polypeptide of a T-Cell-MMP, or its epitope conjugate comprises the amino acid sequence of HLA-A*0201 having a Y84A and a A236C substitution (FIG. 3D).
- a T-Cell-MMP or its epitope conjugate, comprises a first polypeptide comprising amino acid residues 21-119 of NP_004039.1 with a R12C substitution (see FIG. 4), and a second polypeptide comprising a HLA-A0201 (HLA-A2) sequence in FIG 3D.
- the HLA-A0201 sequence has an A236C substitution.
- the HLA-A0201 sequence has a Y84C and A139C substitution.
- the HLA- A0201 sequence has a Y84C, A139C, and A236C substitution.
- MHC-H sequences with Y84C and A139C substitutions may form a stabilizing intrachain disulfide bond, and cysteines at position 236 may bond to cysteines at position 12 of a mature ⁇ 2 ⁇ polypeptide.
- a T-Cell-MMP or its epitope conjugate, comprises a first polypeptide comprising amino acid residues 21-119 of NP_004039.1 with a R12C substitution (see FIG. 4), and a second polypeptide, a HLA Class I heavy chain polypeptide comprises the amino acid sequence GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGE TRK VKAHS QTHRVDL(aa cluster l) ⁇ C ⁇ (aa cluster 2)AGSHTVQRMYGCDVGSDWRFLRGYHQY AYDGKDYIALKEDLRSW(aa cluster 3) ⁇ C ⁇ (aa cluster 4)HKWEAAHVAEQLRAYLEGTCVEWLRR YLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVE TRPAGDGTFQKWAAVVVPSGQ
- IQRTPKIQVY SCHPAENGKS NFLNCYVSGF HPSDIEVDLLKNGERIEKVE HSDLSFSKDW SFYLLYYTEF TPTEKDEYAC RVNHVTLSQP KIVKWDRDM (SEQ ID NO: 157)
- the second polypeptide comprises the amino acid acid sequence
- cysteine residues indicated as ⁇ C ⁇ form a disulfide bond between the al and a2-l helices and the (C) residue forms a disulfide bond with the ⁇ 2 ⁇ polypeptide cysteine at position 12.
- Each occurrence of aa cluster 1, aa cluster 2, aa cluster 3, aa cluster 4, aa cluster 5, and aa cluster 6 is independently selected to be 1-5 amino acid residues, wherein the amino acid residues are each selected independently from i) any naturally occurring (proteogenic) amino acid or ii) any naturally occurring amino acid except proline or glycine.
- aa cluster 1 may be the amino acid sequence GTLRG or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., L replaced by I, V, A or
- aa cluster 2 may be the amino acid sequence YNQSE or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aa cluster 3 may be the amino acid sequence TAADM or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., T replaced by S, A replaced by G, D replaced by E, and/or M replaced by L, V, or I);
- aa cluster 4 may be the amino acid sequence AQTTK or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., A replaced by G, Q replaced by N, or T replaced by S, and or K replaced by R or Q);
- aa cluster 5 may be the amino acid sequence VETRP or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., V replaced by I or L, E replaced by D, T replaced by S, and/or R replaced by K); and/or
- aa cluster 6 may be the amino acid sequence GDGTF or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., D replaced by E, T replaced by S, or F replaced by L, W, or Y).
- the ⁇ 2 ⁇ polypeptide comprises the amino acid sequence:
- IQRTPKIQVYSCHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLL YYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM SEQ ID NO: 157.
- the first polypeptide and the second polypeptide of a T-Cell-MMP of the present disclosure are disulfides linked to one another through: i) a Cys residue present in a linker connecting the peptide epitope and a ⁇ 2 ⁇ polypeptide in the first polypeptide chain (e.g., with the epitope placed in the N-terminal to the linker and the ⁇ 2 ⁇ sequences); and ii) a Cys residue present in a MHC Class I heavy chain in the second polypeptide chain.
- the Cys residue present in the MHC Class I heavy chain is a Cys introduce as a Y84C substitution.
- the linker connecting the peptide epitope and the ⁇ 2 ⁇ polypeptide in the first polypeptide chain is
- GCGGS(G 4 S)n where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9 (SEQ ID NO: 133) (e.g., epitope-GCGGS(G 4 S)n- mature ⁇ 2 ⁇ polypeptide).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:78).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:79). Examples of such a disulfide-linked first and second polypeptide are depicted schematically in FIGs. 6E-6H.
- T-Cell-MMPs and T-Cell-MMP-epitope conjugates can comprise a Fc polypeptide, or can comprise another suitable scaffold polypeptide.
- Suitable scaffold polypeptides include antibody-based scaffold polypeptides and non- antibody-based scaffolds.
- Non-antibody-based scaffolds include, e.g., albumin, an XTEN (extended recombinant) polypeptide, transferrin, a Fc receptor polypeptide, an elastin-like polypeptide (see, e.g., Hassouneh et al. (2012) Methods Enzymol.
- a silk-like polypeptide see, e.g., Valluzzi et al. (2002) Philos Trans R Soc Lond B Biol Sci. 357: 165
- SELP silk-elastin-like polypeptide
- Suitable XTEN polypeptides include, e.g., those disclosed in WO 2009/023270, WO 2010/091122, WO 2007/103515, US 2010/0189682, and US 2009/0092582; see also Schellenberger et al. (2009) Nat Biotechnol. 27: 1186).
- Suitable albumin polypeptides include, e.g., human serum albumin.
- Suitable scaffold polypeptides will in some cases be half-life extending polypeptides.
- a suitable scaffold polypeptide increases the in vivo half-life ⁇ e.g., the serum half -life) of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the scaffold polypeptide.
- a scaffold polypeptide increases the in vivo half -life of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the scaffold polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25- fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- a Fc polypeptide increases the in vivo half-life (serum half -life) of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the Fc polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- the first and/or the second polypeptide chains of a T-Cell-MMP (or its corresponding T-Cell-MMP-epitope conjugate) comprise a Fc polypeptide which may be modified to include one or more chemical conjugation sites within or attached ⁇ e.g., at a terminus or attached by a linker) to the polypeptide.
- the Fc polypeptide of a T-Cell-MMP or T-Cell-MMP-epitope conjugate can be, for example, from an IgA, IgD, IgE, IgG, or IgM, which may contain a human polypeptide sequence, a humanized polypeptide sequence, a Fc region polypeptide of a synthetic heavy chain constant region, or a consensus heavy chain constant region.
- the Fc polypeptide can be from a human IgGl Fc, a human IgG2 Fc, a human IgG3 Fc, a human IgG4 Fc, a human IgA Fc, a human IgD Fc, a human IgE Fc, a human IgM Fc, etc.
- the Fc polypeptides used in the T-Cell-MMPs and their epitope conjugates do not comprise a trans-membrane anchoring domain or a portion thereof sufficient to anchor the T-Cell-MMP or its epitope conjugate to a cell membrane.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to an amino acid sequence of a Fc region depicted in FIGs. 2A-2G.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgGl Fc polypeptide depicted in FIG. 2A.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgGl Fc polypeptide depicted in FIG. 2A; and comprises a substitution of N77; e.g., the Fc polypeptide comprises a N77A substitution.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgG2 Fc polypeptide depicted in FIG. 2A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to amino acids 99-325 of the human IgG2 Fc polypeptide depicted in FIG. 2A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgG3 Fc polypeptide depicted in FIG. 2A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to amino acids 19-246 of the human IgG3 Fc polypeptide depicted in FIG. 2A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgM Fc polypeptide depicted in FIG. 2B; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to amino acids 1-276 to the human IgM Fc polypeptide depicted in FIG. 2B.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to the human IgA Fc polypeptide depicted in FIG. 2C; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% amino acid sequence identity to amino acids 1-234 to the human IgA Fc polypeptide depicted in FIG. 2C.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2 A (human IgGl Fc). In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2 A (human IgGl Fc), except for a substitution of N297 with an amino acid other than asparagine. In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2C (human IgGl Fc comprising an N297A substitution). In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2A (human IgGl Fc), except for a substitution of L235 with an amino acid other than leucine.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2E. In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2F. In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2G (human IgGl Fc comprising an L234A substitution and an L235A substitution). In some cases, the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2 A (human IgGl Fc), except for substitutions at L234 and L235 with amino acids other than leucine.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2A (human IgGl Fc), except for substitutions at L234 and L235 with amino acids other than leucine, and a substitution of P331 with an amino acid other than proline.
- the Fc polypeptide present in a multimeric polypeptide comprises the amino acid sequence depicted in FIG. 2B (human IgGl Fc comprising L234F, L235E, and P331S substitutions). In some cases, the Fc polypeptide present in a multimeric polypeptide is an IgGl Fc polypeptide that comprises L234A and L235A substitutions.
- T-Cell-MMPs can include one or more independently selected linker peptides interposed between, for example, any one or more of: i) a MHC polypeptide and an Ig Fc polypeptide, where such a linker is referred to herein as a "LI linker”; ii) a MHC polypeptide and a MOD, where such a linker is referred to herein as a "L2 linker”; iii) a first MOD and a second MOD, where such a linker is referred to herein as a "L3 linker" (e.g., between a first variant 4-lBBL polypeptide and a second variant 4-lBBL polypeptide; or between a second variant 4-lBBL polypeptide and a third variant 4-lBBL polypeptide); iv) a conjugation site or a peptide antigen (conjugated "epito
- Suitable linkers can be readily selected and can be of any of a number of suitable lengths, such as from 1 aa to 25 aa, from 3 aa to 20 aa, from 2 aa to 15 aa, from 3 aa to 12 aa, from 4 aa to 10 aa, from 5 aa to 9 aa, from 6 aa to 8 aa, or from 7 aa to 8 aa.
- a suitable linker can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 aa in length.
- a linker has a length of from 25 aa to 50 aa, e.g., from 25 to 30, from 30 to 35, from 35 to 40, from 40 to 45, or from 45 to 50 aa in length.
- Exemplary linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n , (GSGGS) n (SEQ ID NO:66) and (GGGS) n (SEQ ID NO:67), where n is an integer of at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art.
- Glycine and glycine-serine polymers can both be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components.
- Exemplary linkers can also comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO:68), GGSGG (SEQ ID NO:69), GSGSG (SEQ ID NO:70), GSGGG (SEQ ID NO:71), GGGSG (SEQ ID NO:72), GSSSG (SEQ ID NO:73), and the like.
- Exemplary linkers can include, e.g., Gly(Ser4)n (SEQ ID NO:74), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- the linker comprises the amino acid sequence AAAGG (SEQ ID NO:75).
- a linker comprises the amino acid sequence (GGGGS) n (SEQ ID NO:76), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a linker polypeptide, present in a first polypeptide of a T-Cell-MMP or its epitope conjugate includes a cysteine residue that can form a disulfide bond with a cysteine residue present in an epitope or a second polypeptide of a T-Cell-MMP or its epitope conjugate.
- the linker comprises the amino acid sequence GCGGS(G 4 S)n where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9 (SEQ ID NO: 133), GCGASGGGGSGGGGS (SEQ ID NO:77), the sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:78) or th sequence
- Linkers including the polypeptide linkers described above, may be present between a payload coupled to the first or second polypeptide of a T-Cell-MMP (or its epitope conjugate).
- the linkers used to attach a payload or epitope (e.g., peptide) to the first and/or second polypeptide can be non-peptides.
- Such non-peptide linkers include polymers comprising, for example, polyethylene glycol (PEG).
- Other linkers including those resulting from coupling with a bifunctional crosslinking agent, such as those recited below, may also be utilized.
- epitopes may include for example glycopeptides.
- an epitope present in a multimeric polypeptide can have a length of from about 4 aa to about 25 aa, e.g., the epitope can have a length of from 4 aa to 10 aa, from 10 aa to 15 aa, from 15 aa to 20 aa, or from 20 aa to 25 aa.
- an epitope present in a T-Cell-MMP-epitope conjugate can have a length of 4 aa, 5 aa, 6 aa, 7, aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa.
- an epitope present in a multimeric polypeptide has a length of from 5 aa to 10 aa, e.g., 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, or 10 aa.
- an epitope present in a multimeric polypeptide is specifically bound by a T-cell, i.e. , the epitope is specifically bound by an epitope-specific T-cell.
- An epitope-specific T-cell binds an epitope having a reference amino acid sequence, but does not substantially bind an epitope that differs from the reference amino acid sequence.
- an epitope-specific T-cell binds an epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 6 M, less than 10 M, or less than -5 10 4 M.
- An epitope-specific T-cell can bind an epitope for which it is specific with an affinity of at least 10 7 M, at least 10 s M, at least 10 9 M, or at least 10 10 M.
- Suitable peptide/polypeptide epitopes include, but are not limited to, epitopes present in a cancer-associated antigen.
- Cancer-associated antigens are known in the art; see, e.g., Cheever et al. (2009) Clin. Cancer Res. 15:5323.
- Cancer-associated antigens include, but are not limited to, a-folate receptor; carbonic anhydrase IX (CAIX); CD19; CD20; CD22; CD30; CD33; CD44v7/8;
- carcinoembryonic antigen CEA
- epithelial glycoprotein-2 EGF
- epithelial glycoprotein-40 EGF- 40
- folate binding protein FBP
- fetal acetylcholine receptor ganglioside antigen GD2; Her2/neu; IL- 13R-a2; kappa light chain; LeY; LI cell adhesion molecule; melanoma-associated antigen (MAGE); MAGE-A1 ; mesothelin; MUC1 ; NKG2D ligands; oncofetal antigen (h5T4); prostate stem cell antigen (PSCA); prostate-specific membrane antigen (PSMA); tumor-associate glycoprotein-72 (TAG-72); vascular endothelial growth factor receptor-2 (VEGF-R2) (see, e.g., Vigneron et al.
- VEGF-R2 vascular endothelial growth factor receptor-2
- epidermal growth factor receptor (EGFR) vIII polypeptide ⁇ see, e.g., Wong et al. (1992) Proc. Natl. Acad. Sci. USA 89:2965; and Miao et al. (2014) PLoSOne 9:e94281).
- the epitope is a human papilloma virus E7 antigen epitope; ⁇ see, e.g., Ramos et al. (2013) J. Immunother. 36:66).
- a suitable peptide epitope is a peptide fragment of from about 4 aa to about 20 aa ⁇ e.g., 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, or 20 aa) in length of a MUC1 polypeptide, a human papillomavirus (HPV) E6 polypeptide, a LMP2 polypeptide, a HPV E7 polypeptide, an epidermal growth factor receptor (EGFR) vIII polypeptide, a HER-2/neu polypeptide, a melanoma antigen family A, 3 (MAGE A3) polypeptide, a p53 polypeptide, a mutant p53 polypeptide, a NY
- Amino acid sequences of cancer-associated antigens are known in the art; see, e.g., MUC1 (GenBank CAA56734); LMP2 (GenBank CAA47024); HPV E6 (GenBank AAD33252); HPV E7 (GenBank AHG99480); EGFRvIII (GenBank NP_001333870); HER-2/neu (GenBank AAI67147); MAGE-A3 (GenBank A AH 11744); p53 (GenBank BAC16799); NY-ESO-1 (GenBank CAA05908); PSMA (GenBank AAH25672); CEA (GenBank AAA51967); melan/MARTl (GenBank NP_005502); Ras (GenBank NP_001123914); gplOO (GenBank AAC60634); bcr-abl (GenBank AAB60388);
- tyrosinase GenBank AAB60319; survivin (GenBank AAC51660); PSA (GenBank CAD54617); hTERT (GenBank BACI IOIO); SSX (GenBank NP_001265620); Eph2A (GenBank NP_004422); PAP (GenBank AAH16344); ML-IAP (GenBank AAH14475); AFP (GenBank NP_001125); EpCAM (GenBank NP_002345); ERG (TMPRSS2 ETS fusion) (GenBank ACA81385); PAX3 (GenBank AAI01301); ALK (GenBank NP_004295); androgen receptor (GenBank NP_000035); cyclin Bl (GenBank CA099273); MYCN (GenBank NP_001280157); RhoC (GenBank AAH52808); TRP-2 (GenBank AAC60627); mesothelin (GenBank AAH09272); PSCA (GenBank A
- LGMN1 GenBank NP_001008530
- TIE-2 GenBank NP_000450
- PAGE4 GeneBank NP_001305806
- VEGFR2 GeneBank NP_002244
- MAD- CT-1 GeneBank NP_005893 NP_056215
- FAP GeneBank NP_004451
- PDGF GeneBank NP_004451
- the epitope is an epitope of an infectious disease agent such as a virus, mycoplasma ⁇ e.g., Mycoplasma pneumoniae), or bacterial agent.
- the epitope is a viral epitope
- the epitope is from a core protein, early protein, late protein, DNA or RNA polymerase, or coat protein.
- the viral epitope is a peptide epitope from a papilloma virus ⁇ e.g., a human papilloma virus (HPV)) or a hepatitis virus ⁇ e.g., hepatitis A virus or hepatitis B virus (HBV)).
- the epitopes are from Cytomegalovirus ("CMV").
- the epitope is an HPV virus it is derived from Human Papiloma early proteins.
- the epitope is from HPV E6 polypeptide, HPV E7 polypeptide, HPV 16 Early Protein 7 (HPV16E7) amino acids 82-90 (HPV16E7/82-90, LLMGTLGIV; SEQ ID NO:80).
- the epitope is HPV16E7 amino acids 86-93 (TLGIVCPI; SEQ ID NO:81).
- the epitope is HPV16E7 amino acids 11-20 (YMLDLQPETT; SEQ ID NO:82).
- the epitope isHPV16E7 amino acids 11-19 (YMLDLQPET; SEQ ID NO:83). See, e.g., Ressing et al. ((1995) /. Immunol. 154:5934) for additional suitable HPV epitopes.
- the epitope is a hepatitis B virus (HBV) epitope.
- HBV epitopes are known in the art. See, e.g., Desmond et al. (2008) Antiviral Therapy 13: 161 ; Lumley et al. (2016) Wellcome Open Res. 1:9; and Kefalakes et al. (2015) Hepatology 62:47.
- a HBV peptide suitable for inclusion in a T-Cell-MMP epitope conjugate of the present disclosure can be a HBV peptide from any of various HBV genotypes, including HBV genotype A, HBV genotype B, HBV genotype C, or HBV genotype D.
- a HBV peptide suitable for inclusion in a T-cell-MMP of the present disclosure can be a HBV peptide from any of various HBV sub-genotypes.
- a HBV peptide suitable for inclusion in a T- cell-MMP of the present disclosure may bind to a MHC complex with an affinity of at least 10 7 M, at least 10 s M, at 5 x 10 9 M, at least 10 9 M, at 5 x 10 10 M, or at least 10 10 M; and is bound by a TCR when complexed with the MHC complex.
- a HBV peptide suitable for inclusion in a T-cell-MMP of the present disclosure can have a length of from about 4 aa to about 25 aa, e.g., the epitope can have a length of from 4 aa to 10 aa, from 9 aa to 15 aa, from 10 aa to 15 aa, from 15 aa to 20 aa, or from 20 aa to 25 aa.
- a HBV peptide suitable for inclusion in a T-cell-MMP of the present disclosure can have a length of 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa.
- a HBV peptide suitable for inclusion in a T-cell-MMP of the present disclosure is a MHC Class I-restricted HBV peptide (e.g., it is restricted to a particular HLA class I allele).
- a HBV peptide suitable for inclusion in a T-cell-MMP of the present disclosure is restricted to HLA-A, e.g., HLA-A2, HLA-Al l (HLA-A*1101), HLA-A*2402 or HLA-A3303 (see e.g., FIG. 3).
- a HBV peptide suitable for inclusion in a T-Cell-MMP epitope conjugate of the present disclosure is restricted to a HLA-B.
- a HBV peptide suitable for inclusion in a T-Cell-MMP epitope conjugate of the present disclosure is restricted to a HLA-C.
- HBV peptides suitable for inclusion in a T-Cell-MMP epitope conjugate described herein are: HBV envelope peptides; HBV precore/core peptides; polymerase peptides and HBV X-protein peptides.
- HBV epitopes are known in the art. See, e.g., Desmond et al. (2008) Antiviral Therapy 13: 161 ; Lumley et al. (2016) Wellcome Open Res. 1 :9; and Kefalakes et al. (2015) Hepatology 62:47.
- HBV peptides suitable for inclusion in T-Cell-MMP epitope conjugates of the present disclosure may bind to a MHC Class I complex with an affinity of at least 10 7 M, at least 10 s M, at 5 x 10 9 M, at least 10 9 M, at 5 x 10 10 M, or at least 10 10 M; and are bound by a TCR when complexed with the MHC complex.
- the Table of HBV Epitopes provided herein sets forth non- limiting embodiments of HBV epitope containing peptide sequences that may form all or part of an epitope peptide incorporated into an T-Cell-MMP-epitope conjugate.
- Suitable MOD polypeptides may be incorporated into T-Cell-MMPs as domains that exhibit reduced affinity for Co-MODs.
- the MOD polypeptides can have from 1 aa to 10 aa differences from a wild-type immunomodulatory domain.
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure may differ in amino acid sequence by, for example.
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure has and/or includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 (e.g., from 1 to 5, from 2 to 5, from 3 to 5, from 5 to 10, or from 10 to 20) amino acid
- variant MOD polypeptides present in a T-Cell-MMP include a single amino acid substitution compared to a corresponding reference (e.g., wild-type) MOD.
- a variant MOD present in a T-Cell- MMP includes, relative to a corresponding wild- type reference (e.g., a wild-type MOD): 1 to 2 aa substitutions; 1 to 3 aa substitutions; 1 to 4 aa substitutions; 1 to 5 aa substitutions;!
- variant MODs suitable for inclusion as domains (MOD polypeptides) in T-Cell-MMPs of the present disclosure include those that exhibit reduced affinity for a Co-MOD, compared to the affinity of a corresponding wild- type MOD for the Co-MOD.
- Suitable variant MODs can be identified by, for example, mutagenesis, such as scanning mutagenesis (e.g., alanine, serine, or glycine scanning mutagenesis).
- Exemplary pairs of MODs and Co-MODs include, but are not limited to entries (a) to (r) listed in the following table:
- a variant MOD present in a T-Cell-MMP of the present disclosure has a binding affinity for a Co-MOD that is from 100 nM to 100 ⁇ .
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure (or its epitope conjugate) has a binding affinity for a Co-MOD (e.g., a T-Cell-MMP or its epitope conjugate comprises a variant MOD that has a binding affinity for a Co-MOD) that is from about 100 nM to about 150 nM, from about 100 nM to about 500 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM
- a variant MOD polypeptide present in a T-Cell- MMP of the present disclosure is a variant PD-L1 polypeptide. Wild-type PD-L1 binds to PD1.
- a wild-type human PD-L1 polypeptide can comprise the following amino acid sequence: MRIFAVFIFM TYWHLLNAFT VTVPKDLYVV EYGSNMTIEC KFPVEKQLDL AALIVYWEME DKNIIQFVHG EEDLKVQHSS YRQRARLLKD QLSLGNAALQ ITDVKLQDAG VYRCMISYGG ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS DHQVLSGKTT TTNSKREEKL FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPGNI LNVSIKICLT LSPST
- a wild-type human PD-L1 ectodomain can comprise the following amino acid sequence: FT VTVPKDLYVV EYGSNMTIEC KFPVEKQLDL AALIVYWEME DKNIIQFVHG EEDLKVQHSS YRQRARLLKD QLSLGNAALQ ITDVKLQDAG VYRCMISYGG ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS DHQVLSGKTT TTNSKREEKL FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPGNI LNVSIKI (SEQ ID NO: 14).
- a wild-type PD-1 polypeptide (NCBI Accession No. NP_005009.2, aas 21-288) can comprise the following amino acid sequence: PGWFLDSPDR PWNPPTFSPA LLVVTEGDNA TFTCSFSNTS ESFVLNWYRM SPSNQTDKLA AFPEDRSQPG QDCRFRVTQL PNGRDFHMSV VRARRNDSGT YLCGAISLAP KAQIKESLRA ELRVTERRAE VPTAHPSPSP RPAGQFQTLV VGVVGGLLGS LVLLVWVLAV ICSRAARGTI GARRTGQPLK EDPSAVPVFS VDYGELDFQW REKTPEPPVP CVPEQTEYAT IVFPSGMGTS SPARRGSADG PRSAQPLRPE DGHCSWPL (SEQ ID NO: 15).
- a variant PD-L1 polypeptide which can be employed as a MOD polypeptide, exhibits reduced binding affinity to its Co-MOD PD-1 (e.g., a PD-1 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 15) compared to the binding affinity of a PD-L1 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 13 or SEQ ID NO: 14.
- a variant PD-L1 polypeptide of the present disclosure binds PD-1 (e.g., a PD-1 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 15) with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less , at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a PD-L1 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 13 or SEQ ID NO: 14.
- a variant PD-L1 polypeptide has a binding affinity to PD-1 that is from 1 nM to 1 ⁇ . In some cases, a variant PD-L1 polypeptide of the present disclosure has a binding affinity to PD-1 that is from 100 nM to 100 ⁇ .
- a variant PD-L1 polypeptide has a binding affinity for PDl (e.g., a PDl polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 15) that is from about 100 nM to about 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , from about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- a variant PD-L1 polypeptide has a single amino acid substitution compared to the PD-L1 amino acid sequence set forth in SEQ ID NO: l or SEQ ID NO:2. In some cases, a variant PD-L1 polypeptide has from 2 to 10 amino acid substitutions compared to the PD-L1 amino acid sequence set forth in SEQ ID NO: 13 or SEQ ID NO: 14. In some cases, a variant PD-L1 polypeptide has 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to the PD-L1 amino acid sequence set forth in SEQ ID NO: 13 or SEQ ID NO: 14.
- a suitable PD-L1 variant includes a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to the following amino acid sequence:
- a suitable PD-L1 variant includes a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to the following amino acid sequence:
- a suitable PD-L1 variant includes a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to the following amino acid sequence: [00252] FT VTVPKDLYVV EYGSNMTIEC KFPVEKQLDL AALIVYWEME DKNIIQFVHG EXDLKVQHSS YRQRARLLKD QLSLGNAALQ ITDVKLQDAG VYRCMISYGG ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS DHQVLSGKTT TTNSKREEKL FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPGNI LNVSIKI (SEQ ID NO: 14), where X is any amino acid other than Glu. In some cases, X is Arg.
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure is a variant CD80 polypeptide. Wild-type CD80 binds to CD28.
- a wild-type amino acid sequence of the ectodomain of human CD80 can be as follows:
- a wild-type CD28 amino acid sequence can be as follows: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLD SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPP PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLV TVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS (SEQ ID NO: 17).
- a Co-MOD is a CD28 polypeptide comprising the amino acid sequence of SEQ ID NO: 18.
- a wild-type CD28 amino acid sequence can be as follows: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSW KHLCPSPLFP GPSKPFWVLV VVGGVLACYS LLVTVAFIIF WVRSKRSRLL HSDYMNMTPR RPGPTRKHYQ PYAPPRDFAA YRS (SEQ ID NO: 17).
- a wild-type CD28 amino acid sequence can be as follows: MLRLLLALNL FPSIQVTGKH LCPSPLFPGP SKPFWVLVVV GGVLACYSLL VTVAFIIFWV RSKRSRLLHS DYMNMTPRRP GPTRKHYQPY APPRDFAAYR S (SEQ ID NO: 19).
- a variant CD80 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 16 for CD28.
- a variant CD80 polypeptide binds CD28 with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 16 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs: 17, 18, or 19).
- a variant CD80 polypeptide has a binding affinity to CD28 that is from 100 nM to 100 ⁇ .
- a variant CD80 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 17, SEQ ID NO: 18, or SEQ ID NO: 19) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900
- a variant CD80 polypeptide has a single amino acid substitution compared to the CD80 amino acid sequence set forth in SEQ ID NO: 16. In some cases, a variant CD80 polypeptide has from 2 to 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO: 16. In some cases, a variant CD80 polypeptide has 2, 3, 4, 5, 6,7, 8. 9, or 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO: 16.
- CD80 variants include a polypeptide that comprises an amino acid sequence having a sequence identity of at least 90% (less than 20 substitutions), at least 95% less than 10 substitutions), at least 97% (less than 6 substitutions), at least 98% (less than 4 substitutions), at least 99% (less than 2 substitutions), or at least 99.5% (one substitution) amino acid sequence identity to any one of the following amino acid sequences:
- X is Ala; [00274] VIHVTK EVKEVATLSC GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNXWPEYKNR TIFDITNNLS IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DN (SEQ ID NO: 16), where X is any amino acid other than He. In some cases, X is Ala;
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure is a variant CD86 polypeptide. Wild-type CD86 binds to CD28.
- amino acid sequence of the full ectodomain of a wild-type human CD86 can be as follows:
- the amino acid sequence of the IgV domain of a wild-type human CD86 can be as follows: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMNR TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:21).
- a variant CD86 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD 86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:20 or SEQ ID NO:21 for CD28.
- a variant CD86 polypeptide binds CD28 with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less than the binding affinity of a CD86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:20 or SEQ ID NO:21 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs: 17, 18, or 19).
- a variant CD86 polypeptide has a binding affinity to CD28 that is from 100 nM to 100 ⁇ .
- a variant CD86 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs: 17, 18, or 19) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1
- a variant CD86 polypeptide has a single amino acid substitution compared to the CD86 amino acid sequence set forth in SEQ ID NO:20. In some cases, a variant CD86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:20. In some cases, a variant CD86 polypeptide has 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:20.
- a variant CD86 polypeptide has a single amino acid substitution compared to the CD 86 amino acid sequence set forth in SEQ ID NO:21. In some cases, a variant CD 86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:21. In some cases, a variant CD86 polypeptide has 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:21. [00287] Suitable CD86 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to any one of the following amino acid sequences:
- APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHS KYMXRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:20), where X is any amino acid other than Asn. In some cases, X is Ala;
- APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHS KYMNRTSFDSDSXTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:20), where X is any amino acid other than Trp. In some cases, X is Ala;
- APLKIQAYFNETADLPCQFANSQNQSLSELVVFWXDQENLVLNEVYLGKEKFDSVHS KYMNRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:20), where X is any amino acid other than Gin. In some cases, X is Ala;
- APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHS KYMNRTSFDSDSWTXRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:20), where X is any amino acid other than Leu. In some cases, X is Ala;
- X is Ala; [00305] APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHS KXMNRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL (SEQ ID NO:20), where X is any amino acid other than Tyr. In some cases, X is Ala;
- APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHS KYMXRTSFDSDSWTLRLHNLQIKDKGLYQCIIHXKKPTGMIRIHQMNSELSVL (SEQ ID NO: 20), where Xi is any amino acid other than Asn and X 2 IS any amino acid other than His. In some cases, Xi andX 2 are both Ala;
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure is a variant 4-1BBL polypeptide. Wild-type 4-1BBL binds to 4-1BB (CD137).
- a wild-type 4-1BBL amino acid sequence can be as follows: MEYASDASLD
- a variant 4-lBBL polypeptide is a variant of the tumor necrosis factor (TNF) homology domain (THD) of human 4-lBBL.
- TNF tumor necrosis factor
- a wild-type amino acid sequence of the THD of human 4-lBBL can be, e.g., one of SEQ ID NOs:23-25, as follows:
- a wild-type 4-lBB amino acid sequence can be as follows: MGNSCYNIVA TLLLVLNFER TRSLQDPCSN CPAGTFCDNN RNQICSPCPP NSFSSAGGQR TCDICRQCKG VFRTRKECSS TSNAECDCTP GFHCLGAGCS MCEQDCKQGQ ELTKKGCKDC CFGTFNDQKR GICRPWTNCS LDGKSVLVNG TKERDVVCGP SPADLSPGAS SVTPPAPARE PGHSPQIISF FLALTSTALL FLLFFLTLRF SVVKRGRKKL LYIFKQPFMR PVQTTQEEDG CSCRFPEEEE GGCEL (SEQ ID NO:26).
- a Co-MOD is a 4-lBB polypeptide comprising the amino acid sequence of SEQ ID NO:26.
- a variant 4-lBBL polypeptide exhibits reduced binding affinity to 4-lBB, compared to the binding affinity of a 4-lBBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:22-25.
- a variant 4-lBBL polypeptide of the present disclosure binds 4-lBB with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less than the binding affinity of a 4-lBBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs: 22-25 for a 4- IBB polypeptide (e.g., a 4- IBB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:26), when assayed under the same conditions.
- a 4- IBB polypeptide e.g., a 4- IBB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:26
- a variant 4-lBBL polypeptide has a binding affinity to 4-1BB that is from 100 nM to 100 ⁇ .
- a variant 4-lBBL polypeptide has a binding affinity for 4-1BB (e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:26) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ ,
- a variant 4-lBBL polypeptide has a single amino acid substitution compared to the 4-lBBL amino acid sequence set forth in one of SEQ ID NOs:22-25.
- a variant 4- 1BBL polypeptide has from 2 to 10 amino acid substitutions compared to the 4-lBBL amino acid sequence set forth in one of SEQ ID NOs:22-25.
- a variant 4-lBBL polypeptide has 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to the 4-lBBL amino acid sequence set forth in one of SEQ ID NOs:22-25.
- Suitable 4-lBBL variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to any one of the following amino acid sequences:
- KELVVAKAGV YYVFFQLELR RVVAGEGSGS VSLALHLQPL RSAAGAAALA LTVDLPPASS EARNSAFGFQ GRLLHLSAGQ RLGVHLHTEA RARHAWQLTQ GATVLGLFRV TPEIPAGLPS PRSE (SEQ ID NO:23), where X is any amino acid other than Met. In some cases, X is Ala;
- PAGLLDLRQG MFAQLVAQNV LLIGGPLSWX SDPGLAGVSL TGGLSYKEDT KELVVAKAGV YYVFFQLELR RVVAGEGSGS VSLALHLQPL RSAAGAAALA LTVDLPPASS EARNSAFGFQ GRLLHLSAGQ RLGVHLHTEA RARHAWQLTQ GATVLGLFRV TPEIPAGLPS PRSE (SEQ ID NO:23), where X is any amino acid other than Tyr. In some cases, X is Ala;
- a variant MOD polypeptide present in a T-Cell-MMP of the present disclosure is a variant IL-2 polypeptide.
- Wild-type IL-2 binds to IL-2 receptor (IL-2R), i.e. , a heterotrimeric polypeptide comprising IL-2Ra, IL-2R , and IL-2Ry.
- IL-2R IL-2 receptor
- a wild-type IL-2 amino acid sequence can be as follows: APTSSSTKKT OLOLEHLLLD LQMILNGINN YKNPKLTRML TFKFYMPKKA TELKHLQCLEEELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNRWITFCQSIIS TLT (SEQ ID NO:27).
- Wild-type IL2 binds to an IL2 receptor (IL2R) on the surface of a cell.
- An IL2 receptor is in some cases a heterotrimeric polypeptide comprising an alpha chain (IL-2Ra; also referred to as CD25), a beta chain (IL-2R ; also referred to as CD122), and a gamma chain (IL-2Ry; also referred to as CD132).
- IL-2Ra alpha chain
- IL-2R also referred to as CD122
- IL-2Ry also referred to as CD132
- Amino acid sequences of human IL-2Ra, IL2R , and IL-2Ry can be as follows.
- Human IL-2Ra ELCDDDPPE IPHATFKAMA YKEGTMLNCE CKRGFRRIKS
- Human IL-2R VNG TSQFTCFYNS RANISCVWSQ DGALQDTSCQ VHAWPDRRRW NQTCELLPVS QASWACNLIL GAPDSQKLTT VDIVTLRVLC REGVRWRVMA IQDFKPFENL RLMAPISLQV VHVETHRCNI SWEISQASHY FERHLEFEAR TLSPGHTWEE APLLTLKQKQ EWICLETLTP DTQYEFQVRV KPLQGEFTTW SPWSQPLAFR TKPAALGKDT IPWLGHLLVG LSGAFGFIIL VYLLINCRNT GPWLKKVLKC NTPDPSKFFS QLSSEHGGDV QKWLSSPFPS SSFSPGGLAP EISPLEVLER DKVTQLLLQQ DKVPEPASLS SNHSLTSCFT NQGYFFFHLP DALEIEACQV YFTYDPYSEE DPDEGVAGAP TGSSPQ
- Human IL-2Ry LNTTILTP NGNEDTTADF FLTTMPTDSL SVSTLPLPEV
- a Co-MOD is an IL-2R comprising polypeptides comprising the amino acid sequences of SEQ ID NO:28, 29, and 30.
- a variant IL-2 polypeptide exhibits reduced binding affinity to IL-2R, compared to the binding affinity of an IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:27.
- a variant IL-2 polypeptide binds IL-2R with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less than the binding affinity of an IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:27 for an IL-2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NOs:28-30), when assayed under the same conditions.
- a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less
- a variant IL-2 polypeptide has a binding affinity to IL-2R that is from 100 nM to 100 ⁇ .
- a variant IL-2 polypeptide has a binding affinity for IL- 2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NOs:28-30) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM
- a variant IL-2 polypeptide has a single amino acid substitution compared to the IL-2 amino acid sequence set forth in SEQ ID NO:27. In some cases, a variant IL-2 polypeptide has from 2 to 10 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:27. In some cases, a variant IL-2 polypeptide has 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid
- Suitable IL-2 variant MOD polypeptides include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to any one of the following amino acid sequences:
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than Phe. In some cases, X is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than Asp. In some cases, X is Ala; [00421] APTSSSTKKT QLQLXHLLLD LQMILNGINN YKNPKLTRML TFKFYMPKKA
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than Glu. In some cases, X is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than His. In some cases, X is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than His.
- X is Ala, Asn, Asp, Cys, Glu, Gin, Gly, He, Lys, Leu, Met, Phe, Pro, Ser, Thr, Tyr, Trp or Val;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where X is any amino acid other than Tyr. In some cases, X is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCXSIIS TLT (SEQ ID NO:27), where X is any amino acid other than Gin. In some cases, X is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than His, and where X 2 is any amino acid other than Phe.
- Xi is Ala.
- X 2 is Ala.
- Xi is Ala; and X 2 is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than Asp; and where X 2 is any amino acid other than Phe.
- Xi is Ala.
- X 2 is Ala.
- Xi is Ala; and X 2 is Ala;
- Xi is any amino acid other than Glu
- X 2 is any amino acid other than Asp
- X 3 is any amino acid other than Phe.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- Xi is Ala
- X 2 is Ala
- X 3 is Ala
- Xi is any amino acid other than His
- X 2 is any amino acid other than Asp
- X 3 is any amino acid other than Phe.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCX3SIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than Asp; where X 2 is any amino acid other than Phe; and where X 3 is any amino acid other than Gin.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than Asp; where X 2 is any amino acid other than Phe; and where X 3 is any amino acid other than Tyr.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCQSIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than His; where X 2 is any amino acid other than Asp; where X 3 is any amino acid other than Phe; and where X 4 is any amino acid other than Tyr.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- Xi is Ala; X 2 is Ala; X 3 is Ala; and X 4 is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCX 4 SIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than Asp; where X 2 is any amino acid other than Phe; where X 3 is any amino acid other than Tyr; and where X 4 is any amino acid other than Gin.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- Xi is Ala; X 2 is Ala; X 3 is Ala; and X 4 is Ala;
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCX 5 SIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than His; where X 2 is any amino acid other than Asp; where X 3 is any amino acid other than Phe; where X 4 is any amino acid other than Tyr; and where X5 is any amino acid other than Gin.
- Xi is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X5 is Ala.
- TELKHLQCLE EELKPLEEVL NLAQSKNFHL RPRDLISNIN VIVLELKGSE TTFMCEYADE TATIVEFLNR WITFCX3SIIS TLT (SEQ ID NO:27), where Xi is any amino acid other than His; where X 2 is any amino acid other than Phe; and where X3 is any amino acid other than Gin.
- Xi is Ala.
- X 2 is Ala.
- X3 Ala.
- Xi is Ala; X 2 is Ala; and X3 is Ala.
- the cysteine at position 125 may be substituted with an alanine (a C125A subsititution).
- an epitope containg peptide or payload is to be conjugated to a cysteine residue elsewhere in a T-Cell-MMP first or second polypeptide, thereby avoiding competition from the C125 of the IL-2 MOD sequence.
- a polypeptide chain of a T-Cell-MMP or its epitope conjugate can include one or more polypeptides in addition to those described above. Suitable additional polypeptides include epitope tags and affinity domains. The one or more additional polypeptide(s) can be included as part of a polypeptide translated by cell or cell free system at the N-terminus of a polypeptide chain of a multimeric polypeptide, at the C-terminus of a polypeptide chain of a multimeric polypeptide, or internally within a polypeptide chain of a multimeric polypeptide.
- Suitable epitope tags include, but are not limited to, hemagglutinin (HA; e.g., YPYDVPDYA (SEQ ID NO:31)); FLAG (e.g., DYKDDDDK (SEQ ID N032)); c-myc (e.g., EQKLISEEDL; SEQ ID NO:33)), and the like.
- HA hemagglutinin
- FLAG e.g., DYKDDDDK (SEQ ID N032)
- c-myc e.g., EQKLISEEDL; SEQ ID NO:33
- Affinity domains include peptide sequences that can interact with a binding partner, e.g., such as one immobilized on a solid support, useful for identification or purification.
- DNA sequences encoding multiple consecutive single amino acids, such as histidine, when fused to the expressed protein, may be used for one-step purification of the recombinant protein by high affinity binding to a resin column, such as nickel SEPHAROSE®.
- affinity domains include His5 (HHHHH) (SEQ ID N034), HisX6 (HHHHHH) (SEQ ID NO:35), C-myc (EQKLISEEDL) (SEQ ID N033), Flag (DYKDDDDK) (SEQ ID NO:32, StrepTag (WSHPQFEK) (SEQ ID NO:36), hemagglutinin, (e.g., HA Tag (YPYDVPDYA) (SEQ ID NO:31)), glutathione-S-transferase (GST), thioredoxin, cellulose binding domain, RYIRS (SEQ ID NO:37), Phe-His-His-Thr (SEQ ID NO:38), chitin binding domain, S-peptide, T7 peptide, SH2 domain, C-end RNA tag, WEAAAREACCRECCARA (SEQ ID NO:39), metal binding domains, e.g., zinc binding domains or calcium binding domains such as those from calcium-binding
- a broad variety of payloads may be associated with T-Cell-MMPs and T-Cell-MMP-epitope conjugates, which may incorporate more than one type of payload in addition to epitopes conjugated (covalently) to the T-Cell-MMPs at a first or second chemical conjugation site.
- T-Cell-MMP molecules or their epitope conjugates multimerize, it may be possible to incorporate monomers labeled with different payloads into a multimer. Accordingly, it is possible to introduce one or more payloads selected from the group consisting of: therapeutic agents, chemotherapeutic agents, diagnostic agents, labels and the like. It will be apparent that some payloads may fall into more than one category (e.g., a radio label may be useful as a diagnostic and as a therapeutic for selectively irradiating specific tissue or cell type).
- T-Cell-MMP polypeptides e.g., a scaffold or Fc polypeptide
- crosslinking reagents to conjugate payloads and/or epitopes to chemical conjugation sites attached to or in the first or second polypeptide of the T-Cell-MMPs (e.g., at a chemical conjugation site such as an engineered cysteine or lysine).
- Such crosslinking agents include succinimidyl 4-(N- maleimidomethyl)-cyclohexane-l-carboxylate (SMCC), sulfo-SMCC, maleimidobenzoyl-N- hydroxysuccinimide ester (MBS), sulfo-MBS or succinimidyl-iodoacetate.
- SMCC succinimidyl 4-(N- maleimidomethyl)-cyclohexane-l-carboxylate
- MBS maleimidobenzoyl-N- hydroxysuccinimide ester
- sulfo-MBS succinimidyl-iodoacetate.
- Some bifunctional linkers for introducing payloads into T-Cell-MMPs and their epitope conjugates include cleavable linkers and non-cleavable linkers.
- the payload linker is a protease-cleavable linker.
- Suitable payload linkers include, e.g., peptides (e.g., from 2 to 10 amino acids in length; e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in length), alkyl chains, poly(ethylene glycol), disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups, and esterase labile groups.
- Non-limiting examples of suitable linkers are: N-succinimidyl- [(N- maleimidopropionamido)-tetraethyleneglycol]ester (NHS-PEG4-maleimide); N-succinimidyl 4-(2- pyridyldithio)butanoate (SPDB); disuccinimidyl suberate (DSS); disuccinimidyl glutarate (DGS); dimethyl adipimidate (DMA); N-succinimidyl 4-(2-pyridyldithio)2-sulfobutanoate (sulfo-SPDB); N- succinimidyl 4-(2-pyridyldithio) pentanoate (SPP); N-succinimidyl-4-(N-maleimidomethyl)- cyclohexane-l-carboxy-(6-amidocaproate) (LC-SMCC); ⁇ -maleimidound
- Control of the stoichiometry of the reaction may result in some selective modification where engineered sites with chemistry orthogonal to all other groups in the molecule is not utilized.
- Reagents that display far more selectivity such as the bis-thio linkers discussed above, tend to permit more precise control of the location and stoichiometry than reagents that react with single lysine, or cysteine residues.
- the Fc polypeptide can comprise one or more covalently attached molecules of payload that are attached directly or indirectly through a linker.
- the polypeptide chain comprising the Fc polypeptide can be of the formula (A)-(L)-(C), where (A) is the polypeptide chain comprising the Fc polypeptide; where (L), if present, is a linker; and where (C) is a payload (e.g., a cytotoxic agent). (L), if present, links (A) to (C).
- the polypeptide chain comprising the Fc polypeptide can comprise more than one molecule of payload (e.g., 2, 3, 4, 5, or more than 5 cytotoxic agent molecules).
- the payload is selected from the group consisting of: biologically active agents or drugs, diagnostic agents or labels, nucleotide or nucleoside analogs, nucleic acids or synthetic nucleic acids (e.g., antisense nucleic acids, small interfering RNA, double stranded (ds)DNA, single stranded (ss)DNA, ssRNA, dsRNA), toxins, liposomes (e.g., incorporating a chemotherapeutic such as 5-fluorodeoxyuridine), nanoparticles (e.g., gold or other metal bearing nucleic acids or other molecules, lipids, particle bearing nucleic acids or other molecules), and combinations thereof.
- nucleic acids or synthetic nucleic acids e.g., antisense nucleic acids, small interfering RNA, double stranded (ds)DNA, single stranded (ss)DNA, ssRNA, dsRNA
- toxins e.g., incorporating a chem
- the payload is selected from biologically active agents or drugs selected independently from the group consisting of: therapeutic agents (e.g., drugs or prodrugs) ,
- chemotherapeutic agents cytotoxic agents, antibiotics, antivirals, cell cycle synchronizing agents, ligands for cell surface receptor(s), immunomodulatory agents (e.g., immunosuppressants such as cyclosporine), pro-apoptotic agents, anti-angiogenic agents, cytokines, chemokines, growth factors, proteins or polypeptides, antibodies or antigen binding fragments thereof, enzymes, proenzymes, hormones and combinations thereof.
- immunomodulatory agents e.g., immunosuppressants such as cyclosporine
- pro-apoptotic agents e.g., anti-angiogenic agents
- cytokines cytokines
- chemokines growth factors
- proteins or polypeptides e.g., antibodies or antigen binding fragments thereof
- enzymes, proenzymes hormones and combinations thereof.
- the payload is selected from biologically active agents or drugs selected independently from therapeutic diagnostic agents or labels, selected independently from the group consisting of photodetectable labels (e.g., dyes, fluorescent labels, phosphorescent labels, luminescent labels), contrast agents (e.g., iodine or barium containing materials), radiolabels, imaging agents, paramagnetic labels/imaging agents (gadolinium containing magnetic resonance imaging labels), ultrasound labels and combinations thereof.
- photodetectable labels e.g., dyes, fluorescent labels, phosphorescent labels, luminescent labels
- contrast agents e.g., iodine or barium containing materials
- radiolabels e.g., iodine or barium containing materials
- imaging agents e.g., paramagnetic labels/imaging agents (gadolinium containing magnetic resonance imaging labels), ultrasound labels and combinations thereof.
- a polypeptide chain of a T-Cell-MMP can comprise a payload, including, but not limited, to small molecule drug linked (e.g., covalently attached) to the first or second polypeptide chain at chemical conjugation sites.
- the linkage between a payload and a first or second polypeptide chain of a T-Cell-MMP or its epitope conjugate may be a direct or indirect linkage.
- Direct linkage can involve linkage directly to an amino acid side chain.
- Indirect linkage can be linkage via a linker.
- a drug e.g., a payload such as a cancer chemotherapeutic agent
- a polypeptide chain e.g., a Fc polypeptide
- T-Cell-MMP of the present disclosure via a thioether bond, an amide bond, a carbamate bond, a disulfide bond, or an ether bond.
- Suitable therapeutic agents include, e.g., rapamycin, retinoids, such as all-trans retinoic acid (ATRA); vitamin D3; vitamin D3 analogs; and the like.
- a drug is a cytotoxic agent. Cytotoxic agents are known in the art.
- a suitable cytotoxic agent can be any compound that results in the death of a cell, or induces cell death, or in some manner decreases cell viability, and includes, for example, maytansinoids and maytansinoid analogs, benzodiazepines, taxoids, CC-1065 and CC-1065 analogs, duocarmycins and duocarmycin analogs, enediynes, such as calicheamicins, dolastatins and dolastatin analogs including auristatins, tomaymycin derivatives, leptomycin derivatives, methotrexate, cisplatin, carboplatin, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil and morpholino doxorubicin.
- the cytotoxic agent is a compound that inhibits microtubule formation in eukaryotic cells.
- agents include, e.g., maytansinoid, benzodiazepine, taxoid, CC- 1065, duocarmycin, a duocarmycin analog, calicheamicin, dolastatin, a dolastatin analog, auristatin, tomaymycin, and leptomycin, or a pro-drug of any one of the foregoing.
- Maytansinoid compounds include, e.g., N(2')-deacetyl-N(2')-(3-mercapto-l-oxopropyl)-maytansine (DM1); N(2')-deacetyl-N(2')- (4-mercapto-l-oxopentyl)-maytansine (DM3); and N(2')-deacetyl-N2-(4-mercapto-4-methyl-l- oxopentyl)-maytansine (DM4).
- Benzodiazepines include, e.g., indolinobenzodiazepines and oxazolidinobenzodiazepines .
- Cytotoxic agents include taxol; cytochalasin B; gramicidin D; ethidium bromide; emetine; mitomycin; etoposide; tenoposide; vincristine; vinblastine; colchicin; doxorubicin; daunorubicin; dihydroxy anthracin dione; maytansine or an analog or derivative thereof; an auristatin or a functional peptide analog or derivative thereof; dolastatin 10 or 15 or an analogue thereof; irinotecan or an analogue thereof; mitoxantrone; mithramycin; actinomycin D; 1-dehydrotestosterone; a glucocorticoid; procaine; tetracaine; lidocaine; propranolol; puromycin; calicheamicin or an analog or derivative thereof; an antimetabolite; 6 mercaptopurine; 6 thioguanine; cytarabine;
- Staphylococcal enterotoxin A pokeweed antiviral protein
- diphtherin toxin diphtherin toxin
- Pseudomonas endotoxin Pseudomonas endotoxin
- the first and/or second polypeptide chains of a T-Cell-MMP can comprise one or more molecules of payload of photodetectable labels (e.g., dyes, fluorescent labels, phosphorescent labels, luminescent labels), contrast agents (e.g., iodine or barium containing materials), radiolabels, imaging agents, spin labels, Forster Resonance Energy Transfer (FRET)-type labels, paramagnetic labels (e.g., dyes, fluorescent labels, phosphorescent labels, luminescent labels), contrast agents (e.g., iodine or barium containing materials), radiolabels, imaging agents, spin labels, Forster Resonance Energy Transfer (FRET)-type labels, paramagnetic
- photodetectable labels e.g., dyes, fluorescent labels, phosphorescent labels, luminescent labels
- contrast agents e.g., iodine or barium containing materials
- radiolabels e.g., iodine or barium containing
- labels/imaging agents e.g., gadolinium containing magnetic resonance imaging labels
- ultrasound labels and combinations thereof.
- the conjugate moiety comprises a label that is or includes a radioisotope.
- radioisotopes or other labels include, but are not limited to, 3 H, 11 C, 14 C, 15 N, 35 S, 18 F, 32 P, 33 P, 64 Cu, 68 Ga, 89 Zr, 90 Y, "Tc, 123 I, 124 I, 125 I, 131 I, m ln, 131 In, 153 Sm, 186 Re, 188 Re, 211 At, 212 Bi, and 153 Pb.
- the present disclosure provides a method of obtaining T-Cell-MMPs and T-Cell-MMP- epitope conjugates, including those comprising one or more variant MODs that exhibit lower affinity for a Co-MOD compared to the affinity of the corresponding parental wild- type MOD for the Co-MOD, the method comprising:
- polypeptide of the T-Cell-MMP in cells or cell free systems wherein each member comprises: a) a first polypeptide comprising: i) a first MHC Class I polypeptide (e.g., a ⁇ 2 ⁇ polypeptide); and
- a second polypeptide comprising: i) a second MHC polypeptide (e.g., a MHC Class I heavy chain polypeptide); and ii) optionally an Ig Fc polypeptide or a non-Ig scaffold, wherein the first polypeptide comprises a first chemical conjugation site and/or the second polypeptides comprise a second chemical conjugation site, and at least one of the first polypeptide or second polypeptide comprises one or more independently selected MODs (e.g., 1, 2, 3 or more wild-type and/or variant MODs); and B) contacting the first polypeptide and second polypeptide (if co-expressed in the same cell or cell- free system the polypeptides may come into contact as they are translated) to form a T-Cell- MMP;
- a second MHC polypeptide e.g., a MHC Class I heavy chain polypeptide
- optionally an Ig Fc polypeptide or a non-Ig scaffold wherein the first polypeptide comprises a first chemical
- the nascent chemical conjugation site may be optionally activated to produce a T-Cell-MMP with the first and/or second chemical conjugation site (e.g., reacting sulfatase motifs with a formyl glycine generating enzyme if the cells expressing the T-Cell- MMP do not express a formylglycine generating enzyme).
- the method may be stopped at this point and the T-Cell-MMP obtained by purification; alternatively, where a T-Cell-MMP epitope conjugate is desired the method may be continued with the following step:
- an epitope e.g., an epitope peptide
- the first and/or second chemical conjugation site e.g., a hydrazinyl or hydrazinyl indole modified peptide for reaction with a formyl glycine of a sulfatase motif
- the T-Cell- MMP e.g., under suitable reaction conditions
- a T-Cell-MMP may contain a payload (e.g., a small molecule drug, radio label, etc.)
- the payload may be reacted with the T-Cell-MMP in place of the epitope conjugate as described above.
- the payload may be reacted with the chemical conjugation site(s) either before or after the epitope is contacted and reacted with its chemical reaction site(s).
- the selectivity of the epitope and the payload for different conjugation sites may be controlled through the use of orthogonal chemistries and/or control of stoichiometry in the conjugation reactions.
- linkers e.g., polypeptides or other bifunctional chemical linkers
- the present disclosure provides a method of obtaining a T-Cell-MMP epitope conjugate comprising one or more variant MODs that exhibit lower affinity for a Co-MOD compared to the affinity of the corresponding parental wild-type MOD for the Co-MOD, the method comprising:
- the affinity is determined by BLI using purified T-Cell-MMP library members and the Co-MOD.
- BLI methods are well known to those skilled in the art. A BLI assay is described above. See, e.g., Lad et al. (2015) J. Biomol. Screen. 20(4): 498-507; and Shah and Duncan (2014) /. Vis. Exp. 18:e51383.
- the present disclosure provides a method of obtaining a T-Cell-MMP-epitope conjugate that exhibits selective binding to a T-cell, the method comprising:
- a) a first polypeptide comprising: i) a first MHC polypeptide
- a second polypeptide comprising: i) a second MHC polypeptide; and ii) optionally an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold,
- each member comprises a different variant MOD on the first polypeptide, the second polypeptide, or both the first and the second polypeptide, wherein the variant MOD differs in amino acid sequence by from 1 aa to 10 aa from a parental wild- type MOD,
- T-Cell-MMP-epitope conjugate library members further comprise an epitope tag or a fluorescent label
- one of the first or second polypeptides comprises an epitope covalently bound through a chemical conjugation site, either directly or indirectly through a linker, to the first and/or second polypeptide;
- T-Cell-MMP-epitope conjugate library member with a target T-cell expressing on its surface with: i) a Co-MOD that binds the parental wild-type MOD; and ii) a TCR that binds to the epitope;
- T-Cell-MMP epitope conjugate comprises an epitope tag
- MFI mean fluorescence intensity
- T-Cell-MMP-epitope conjugate library member that selectively binds the target T- cell, compared to binding of the T-Cell-MMP-epitope conjugate library member to a control T- cell that comprises: i) the Co-MOD that binds the parental wild-type MOD; and ii) a TCR that binds to an epitope other than the epitope present in the T-Cell-MMP library member.
- a T-Cell-MMP library member that is identified as selectively binding to a target T-cell is isolated from the library.
- parental wild- type MOD and Co-MOD pairs are selected from:IL-2 and IL-2 receptor; 4-1BBL and 4-1BB; PD-L1 and PD-1 ; FasL and Fas; TGFfi and TGFfi receptor; CD80 and CD28; CD86 and CD28; OX40L and OX40; ICOS-L and ICOS; ICAM and LFA- 1 ; JAG1 and Notch; JAG1 and CD46; CD70 and CD27; CD80 and CTLA4; and CD86 and CTLA4.
- the present disclosure provides a method of obtaining a T-Cell-MMP-epitope conjugate comprising one or more variant MODs that exhibit reduced affinity for a Co-MOD compared to the affinity of the corresponding parental wild-type MOD for the Co-MOD, the method comprising selecting, from a library of T-Cell-MMP-epitope conjugates comprising a plurality of members, a member that exhibits reduced affinity for the Co-MOD, wherein each of the plurality of members comprises: a) a first polypeptide comprising: i) an epitope covalently bound to a chemical conjugation site; and ii) a first MHC polypeptide; and b) a second polypeptide comprising: i) a second MHC polypeptide; and ii) optionally an Ig Fc polypeptide or a non-Ig scaffold, wherein the members of the library comprise a plurality of variant MODs present in the first polypeptide, the second polypeptide,
- the selecting step comprises determining the affinity, using BLI, of binding between T-Cell-MMP-epitope conjugate library members and the Co- MOD.
- the T-Cell-MMP-epitope conjugate is as described above.
- the method of obtaining T-Cell-MMP-epitope conjugates comprising one or more variant MODs that exhibit reduced affinity for a Co-MOD compared to the affinity of the corresponding parental wild-type MODs for the Co-MOD further comprises: a) contacting the selected T-Cell-MMP-epitope conjugate library member with a target T-cell expressing on its surface: i) a Co- MOD that binds the parental wild- type MOD; and ii) a TCR that binds to the epitope, wherein the T- Cell-MMP-epitope conjugate library member comprises an epitope tag, such that the T-Cell-MMP- epitope conjugate library member binds to the target T-cell; b) contacting the selected T-Cell-MMP- epitope conjugate library member bound to the target T-cell with a fluorescently labeled binding agent that binds to the epitope tag, generating a selected T-
- the binding agent is an antibody specific for the epitope tag.
- the variant MOD comprises from 1 to 20 amino acid substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions) compared to the corresponding parental wild-type MOD.
- the T-Cell-MMP-epitope conjugate comprises two variant MODs.
- the two variant MODs comprise the same amino acid sequence.
- the first polypeptide comprises one of the two variant MODs and the second polypeptide comprises the second of the two variant MODs.
- the two variant MODs are on the same polypeptide chain of the T-Cell-MMP-epitope conjugate.
- the two variant MODs are on the first polypeptide of the T-Cell-MMP-epitope conjugate. In some cases, the two variant MODs are on the second polypeptide of the T-Cell-MMP-epitope conjugate.
- the method of obtaining a T-Cell-MMP-epitope conjugate comprising one or more variant MODs that exhibit reduced affinity for a Co-MOD compared to the affinity of the corresponding parental wild-type MOD for the Co-MOD further comprises isolating the selected T- Cell-MMP-epitope conjugate library member from the library.
- the method further comprises providing a nucleic acid comprising a nucleotide sequence encoding a T-Cell-MMP with at least one chemical conjugation site used to prepare the selected library member.
- the nucleic acid is present in a recombinant expression vector.
- the nucleotide sequence is operably linked to a transcriptional control element that is functional in a eukaryotic cell.
- the method further comprises introducing the nucleic acid into a eukaryotic host cell, and culturing the cell in a liquid medium to synthesize the encoded T-Cell-MMP with at least one chemical conjugation site in the cell, isolating the synthesized T-Cell-MMP with at least one chemical conjugation site from the cell or from liquid culture medium, and conjugating it to at least one epitope to form the selected T-Cell-MMP-epitope conjugate.
- the selected T-Cell-MMP with at least one chemical conjugation site comprises an Ig Fc polypeptide.
- the method further comprises conjugating a drug to the Ig Fc polypeptide.
- the drug is a cytotoxic agent that is selected from maytansinoid, benzodiazepine, taxoid, CC-1065, duocarmycin, a duocarmycin analog, calicheamicin, dolastatin, a dolastatin analog, auristatin, tomaymycin, and leptomycin, or a pro-drug of any one of the foregoing.
- the drug is a retinoid.
- the parental wild-type MOD and the Co-MODs are selected from: IL-2 and IL-2 receptor; 4-1BBL and 4-1BB; PD-L1 and PD-1 ; FasL and Fas; TGFfi and TGFfi receptor; CD70 and CD27; CD80 and CD28; CD86 and CD28; OX40L and OX40; FasL and Fas; ICOS-L and ICOS; ICAM and LFA-1 ; and JAG1 and Notch; JAG1 and CD46; CD80 and CTLA4; and CD86 and CTLA4.
- the present disclosure provides a method of obtaining a T-Cell-MMP-epitope conjugate comprising one or more variant MODs that exhibit reduced affinity for a Co-MOD compared to the affinity of the corresponding parental wild-type MOD for the Co-MOD, the method comprising:
- the selecting step comprises determining the affinity, using BLI, of binding between T-Cell-MMP-epitope conjugate library members and the Co-MOD. In some cases, the selecting step comprises determining the affinity, using BLI, of binding between T-Cell-MMP-epitope conjugate library members and the Co-MOD. In some cases, the T-Cell- MMP-epitope conjugate is as described above.
- the method further comprises: a) contacting the selected T-Cell-MMP-epitope conjugate library member with a target T-cell expressing on its surface: i) a Co-MOD that binds the parental wild-type MOD; and ii) a T-cell receptor that binds to the epitope, wherein the T-Cell-MMP- epitope conjugate library member comprises an epitope tag, such that the T-Cell-MMP-epitope conjugate library member binds to the target T-cell; b) contacting the selected T-Cell-MMP-epitope conjugate library member bound to the target T-cell with a fluorescently labeled binding agent that binds to the epitope tag, generating a selected T-Cell-MMP-epitope conjugate library member/target T- cell/binding agent complex; and c) measuring the MFI of the selected T-Cell-MMP-epitope conjugate library member
- the binding agent is an antibody specific for the epitope tag.
- the variant MOD comprises from 1 to 20 amino acid substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid substitutions) compared to the corresponding parental wild-type MOD.
- the T-Cell-MMP-epitope conjugate comprises two variant MODs.
- the two variant MODs comprise the same amino acid sequence.
- the first polypeptide comprises one of the two variant MODs and the second polypeptide comprises the second of the two variant MODs.
- the two variant MODs are on the same polypeptide chain of the T-Cell-MMP-epitope conjugate.
- the two variant MODs are on the first polypeptide of the T-Cell-MMP-epitope conjugate. In some cases, the two variant MODs are on the second polypeptide of the T-Cell-MMP-epitope conjugate.
- the method further comprises isolating the selected T-Cell-MMP-epitope conjugate library member from the library.
- the method further comprises providing a nucleic acid comprising a nucleotide sequence encoding a T-Cell-MMP with at least one chemical conjugation site used to prepare the selected library member.
- the nucleic acid is present in a recombinant expression vector.
- the nucleotide sequence is operably linked to a transcriptional control element that is functional in a eukaryotic cell.
- the method further comprises introducing the nucleic acid into a eukaryotic host cell, and culturing the cell in a liquid medium to synthesize the encoded T-Cell-MMP with at least one chemical conjugation site in the cell, isolating the synthesized selected T-Cell-MMP with at least one chemical conjugation site from the cell or from liquid culture medium, and conjugating it to at least one epitope to form the selected T-Cell- MMP-epitope conjugate.
- the selected T-Cell-MMP library member comprises an Ig Fc polypeptide.
- the method further comprises conjugating a drug to the Ig Fc polypeptide.
- the drug is a cytotoxic agent selected from maytansinoid, benzodiazepine, taxoid, CC- 1065, duocarmycin, a duocarmycin analog, calicheamicin, dolastatin, a dolastatin analog, auristatin, tomaymycin, and leptomycin, or a pro-drug of any one of the foregoing.
- the drug is a retinoid.
- the parental wild-type MODs and the cognate MODs are selected from: IL-2 and IL-2 receptor; 4-1BBL and 4-1BB; PD-L1 and PD-1 ; FasL and Fas; TGF and TGF receptor; CD70 and CD27; CD80 and CD28; CD86 and CD28; OX40L and OX40; FasL and Fas; ICOS-L and ICOS; ICAM and LFA-1 ; and JAG1 and Notch; JAG1 and CD46; CD80 and CTLA4; and CD86 and CTLA4.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a T-Cell-MMP of the present disclosure.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a T-Cell-MMP of the present disclosure including chemical conjugation sites that are engineered into the polypeptides of the T-Cell-MMP.
- the present disclosure provides nucleic acids comprising nucleotide sequences encoding the T-Cell-MMPs described herein.
- the individual polypeptide chains of a T-Cell-MMP of the present disclosure are encoded in separate nucleic acids.
- all polypeptide chains of a T-Cell-MMP of the present disclosure are encoded in a single nucleic acid.
- a first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a T-Cell-MMP of the present disclosure; and a second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a T-Cell-MMP of the present disclosure.
- a single nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a T-Cell-MMP of the present disclosure and a second polypeptide of a T-Cell-MMP of the present disclosure.
- nucleic acids comprising nucleotide sequences encoding a T- Cell-MMP.
- the individual polypeptide chains of a T-Cell-MMP are encoded in separate nucleic acids.
- nucleotide sequences encoding the separate polypeptide chains of a T-Cell-MMP are operably linked to transcriptional control elements, e.g., promoters, such as promoters that are functional in a eukaryotic cell, where the promoter can be a constitutive promoter or an inducible promoter.
- the present disclosure provides a first nucleic acid and a second nucleic acid, where the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a T-Cell-MMP of the present disclosure, where the first polypeptide comprises, in order from N-terminus to C-terminus: a) a first MHC polypeptide; and b) a MOD (e.g., a reduced-affinity variant MOD polypeptide as described above); and where the second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a T-Cell-MMP, where the second polypeptide comprises, in order from N-terminus to C- terminus: a) a second MHC polypeptide; and b) an Ig Fc polypeptide.
- the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a T-Cell-MMP of the present disclosure, where the first polypeptide comprises, in
- At least one of the first and second polypeptides comprises a chemical conjugation site (or a nascent site that can be converted to a chemical conjugation site).
- the nucleotide sequences encoding the first and second polypeptides are operably linked to transcriptional control elements.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- the nucleic acids are present in separate expression vectors.
- the present disclosure provides a first nucleic acid and a second nucleic acid, where the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a T-Cell-MMP, where the first polypeptide comprises a first MHC polypeptide; and where the second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a T-Cell-MMP, where the second polypeptide comprises, in order from N-terminus to C-terminus: a) a MOD (e.g., a reduced-affinity variant MOD polypeptide as described above); b) a second MHC polypeptide; and c) an Ig Fc polypeptide.
- a MOD e.g., a reduced-affinity variant MOD polypeptide as described above
- Suitable MHC polypeptides, MODs, and Ig Fc polypeptides are described above. At least one of the first and second polypeptides comprises a chemical conjugation site.
- the nucleotide sequences encoding the first and the second polypeptides are operably linked to transcriptional control elements.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- the nucleic acids are present in separate expression vectors.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Virology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Developmental Biology & Embryology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2020536495A JP2020534352A (ja) | 2017-09-07 | 2018-09-06 | コンジュゲーション部位を有するt細胞調節多量体ポリペプチド及びその使用方法 |
| AU2018327224A AU2018327224A1 (en) | 2017-09-07 | 2018-09-06 | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| CA3074839A CA3074839A1 (en) | 2017-09-07 | 2018-09-06 | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| CN201880071636.1A CN111315768A (zh) | 2017-09-07 | 2018-09-06 | 具有缀合位点的t细胞调节性多聚体多肽及其使用方法 |
| KR1020207009953A KR20200064085A (ko) | 2017-09-07 | 2018-09-06 | 접합 부위를 갖는 t-세포 조절 다량체 폴리펩타이드 및 이의 사용 방법 |
| EP18853566.0A EP3679064A4 (en) | 2017-09-07 | 2018-09-06 | T-LYMPHOCYTE MODULATOR MULTIMER POLYPEPTIDE WITH ASSOCIATED CONJUGATION SITES AND METHODS OF USE |
| IL273091A IL273091A (en) | 2017-09-07 | 2020-03-05 | T-cell modulatory multimeric polypeptide containing conjugation sites and methods for using it |
| US16/812,125 US12006348B2 (en) | 2017-09-07 | 2020-03-06 | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US18/656,531 US20240409606A1 (en) | 2017-09-07 | 2024-05-06 | T-Cell Modulatory Multimeric Polypeptide with Conjugation Sites and Methods of Use Thereof |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762555559P | 2017-09-07 | 2017-09-07 | |
| US62/555,559 | 2017-09-07 | ||
| US201762609082P | 2017-12-21 | 2017-12-21 | |
| US62/609,082 | 2017-12-21 | ||
| US201862615402P | 2018-01-09 | 2018-01-09 | |
| US62/615,402 | 2018-01-09 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/812,125 Continuation US12006348B2 (en) | 2017-09-07 | 2020-03-06 | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2019051127A1 true WO2019051127A1 (en) | 2019-03-14 |
| WO2019051127A9 WO2019051127A9 (en) | 2019-08-29 |
Family
ID=65634577
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/049803 Ceased WO2019051127A1 (en) | 2017-09-07 | 2018-09-06 | MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US12006348B2 (enExample) |
| EP (1) | EP3679064A4 (enExample) |
| JP (1) | JP2020534352A (enExample) |
| KR (1) | KR20200064085A (enExample) |
| CN (1) | CN111315768A (enExample) |
| AU (1) | AU2018327224A1 (enExample) |
| CA (1) | CA3074839A1 (enExample) |
| IL (1) | IL273091A (enExample) |
| TW (1) | TW201920249A (enExample) |
| WO (1) | WO2019051127A1 (enExample) |
Cited By (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110684081A (zh) * | 2019-09-02 | 2020-01-14 | 天益健康科学研究院(镇江)有限公司 | 一种编码分泌型多肽氨基酸的重组溶瘤新城疫病毒及其制备方法 |
| US10676516B2 (en) | 2017-05-24 | 2020-06-09 | Pandion Therapeutics, Inc. | Targeted immunotolerance |
| WO2020193745A1 (en) * | 2019-03-28 | 2020-10-01 | Immunocore Limited | Binding molecules specfic for hbv envelope protein |
| WO2020243315A1 (en) * | 2019-05-29 | 2020-12-03 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| WO2020257191A1 (en) * | 2019-06-19 | 2020-12-24 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| WO2021055594A1 (en) * | 2019-09-20 | 2021-03-25 | Cue Biopharma, Inc. | T-cell modulatory polypeptides and methods of use thereof |
| US10961310B2 (en) | 2017-03-15 | 2021-03-30 | Pandion Operations, Inc. | Targeted immunotolerance |
| WO2021081239A1 (en) * | 2019-10-23 | 2021-04-29 | Cue Biopharma, Inc. | T-cell modulatory chimeric molecules and methods of use thereof |
| US11091527B2 (en) | 2017-12-06 | 2021-08-17 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| WO2021195411A1 (en) * | 2020-03-25 | 2021-09-30 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| WO2022099156A3 (en) * | 2020-11-06 | 2022-06-16 | Cue Biopharma, Inc. | T-cell modulatory polypeptides with conjugation sites and methods of use thereof |
| EP3897701A4 (en) * | 2018-12-19 | 2023-01-25 | Cue Biopharma, Inc. | MULTIMERIC T-CELL-MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| JP2023525822A (ja) * | 2020-05-12 | 2023-06-19 | エルジー・ケム・リミテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| JP2023526723A (ja) * | 2020-05-12 | 2023-06-23 | キュー バイオファーマ, インコーポレイテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11739146B2 (en) | 2019-05-20 | 2023-08-29 | Pandion Operations, Inc. | MAdCAM targeted immunotolerance |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| EP4106790A4 (en) * | 2020-02-21 | 2024-02-21 | 3T Biosciences, Inc. | YEAST DISPLAY LIBRARIES, RELATED COMPOSITIONS AND RELATED METHODS OF USE |
| US11981715B2 (en) | 2020-02-21 | 2024-05-14 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a CD39 effector |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| EP4157349A4 (en) * | 2020-05-26 | 2024-07-17 | Cue Biopharma, Inc. | ANTIGEN-PRESENTING POLYPEPTIDE COMPLEXES AND ASSOCIATED METHODS OF USE |
| US12215131B2 (en) | 2019-12-20 | 2025-02-04 | Regeneron Pharmaceuticals, Inc. | IgG Fc-IL2-Rα-IL2 fusions and methods of use thereof |
| EP4157350A4 (en) * | 2020-05-26 | 2025-07-23 | Cue Biopharma Inc | ANTIGEN-PRESENTING POLYPEPTIDE COMPLEXES AND METHODS OF USE THEREOF |
| EP4416175A4 (en) * | 2021-10-12 | 2025-08-13 | Adoc Ssf Llc | COMPOSITIONS AND METHODS FOR ISOLATING T CELL RECEPTORS (TCR) AND CELLS EXPRESSING THEM |
| USRE50550E1 (en) | 2017-12-06 | 2025-08-26 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG10202006338UA (en) * | 2014-06-18 | 2020-08-28 | Albert Einstein College Medicine Inc | Syntac polypeptides and uses thereof |
| CN109475628A (zh) * | 2016-05-18 | 2019-03-15 | 库尔生物制药有限公司 | T细胞调节性多聚体多肽及其使用方法 |
| WO2019051127A1 (en) | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF |
| WO2020132368A1 (en) * | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| WO2022197971A1 (en) * | 2021-03-19 | 2022-09-22 | Cue Biopharma, Inc. | T-cell modulatory polypeptides and methods of use thereof |
| CN117222421A (zh) * | 2021-03-19 | 2023-12-12 | Cue生物制药股份有限公司 | T细胞调节多肽和其使用方法 |
| WO2025101521A1 (en) * | 2023-11-06 | 2025-05-15 | Cue Biopharma, Inc. | Methods for treating hpv16-associated cancers |
Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1548716A (en) | 1924-10-02 | 1925-08-04 | Fournier Santiago Emilien | Process for the manufacture of artificial freestone |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| WO1993009239A1 (en) | 1991-11-08 | 1993-05-13 | Research Corporation Technologies, Inc. | Adeno-associated virus-2 basal vectors |
| WO1993019191A1 (fr) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Adenovirus recombinants defectifs exprimant des cytokines pour traitement antitumoral |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| US6287860B1 (en) | 2000-01-20 | 2001-09-11 | Isis Pharmaceuticals, Inc. | Antisense inhibition of MEKK2 expression |
| WO2002085923A2 (en) | 2001-04-19 | 2002-10-31 | The Scripps Research Institute | In vivo incorporation of unnatural amino acids |
| US7078387B1 (en) | 1998-12-28 | 2006-07-18 | Arch Development Corp. | Efficient and stable in vivo gene transfer to cardiomyocytes using recombinant adeno-associated virus vectors |
| WO2007103515A2 (en) | 2006-03-06 | 2007-09-13 | Amunix, Inc. | Unstructured recombinant polymers and uses thereof |
| US7351797B1 (en) | 2000-09-29 | 2008-04-01 | The Scripps Research Institute | Labeled peptides, and processes and intermediates useful for their preparation |
| WO2009023270A2 (en) | 2007-08-15 | 2009-02-19 | Amunix, Inc. | Compositions and methods for modifying properties of biologically active polypeptides |
| US20100189682A1 (en) | 2005-09-27 | 2010-07-29 | Volker Schellenberger | Biologically active proteins having increased In Vivo and/or In Vitro stability |
| WO2010091122A1 (en) | 2009-02-03 | 2010-08-12 | Amunix, Inc. | Extended recombinant polypeptides and compositions comprising same |
| US20110159023A1 (en) | 2008-08-25 | 2011-06-30 | Solomon Langermann | Pd-1 antagonists and methods for treating infectious disease |
| US20140046030A1 (en) | 2012-06-08 | 2014-02-13 | Sutro Biopharma, Inc. | Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use |
| US20140051836A1 (en) | 2012-06-26 | 2014-02-20 | Sutro Biopharma, Inc. | Modified Fc Proteins Comprising Site-Specific Non-Natural Amino Acid Residues, Conjugates of the Same, Methods of Their Preparation and Methods of Their Use |
| US20150352225A1 (en) | 2014-06-06 | 2015-12-10 | Redwood Bioscience, Inc. | Anti-Her2 Antibody-Maytansine Conjugates and Methods of Use Thereof |
| US9238878B2 (en) | 2009-02-17 | 2016-01-19 | Redwood Bioscience, Inc. | Aldehyde-tagged protein-based drug carriers and methods of use |
| US9310374B2 (en) | 2012-11-16 | 2016-04-12 | Redwood Bioscience, Inc. | Hydrazinyl-indole compounds and methods for producing a conjugate |
| US20160229911A1 (en) | 2012-07-19 | 2016-08-11 | Redwood Bioscience, Inc. | Antibody Specific for CD22 and Methods of Use Thereof |
| US20160347847A1 (en) | 2015-05-07 | 2016-12-01 | Agenus Inc. | Anti-OX40 Antibodies and Methods of Use Thereof |
| US9540438B2 (en) | 2011-01-14 | 2017-01-10 | Redwood Bioscience, Inc. | Aldehyde-tagged immunoglobulin polypeptides and methods of use thereof |
| US20170043033A1 (en) | 2014-04-25 | 2017-02-16 | Rinat Neuroscience Corp. | Antibody-drug conjugates with high drug loading |
| US20170058015A1 (en) | 2014-06-18 | 2017-03-02 | Albert Einstein College Of Medicine, Inc. | Syntac polypeptides and uses thereof |
Family Cites Families (75)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5696234A (en) * | 1994-08-01 | 1997-12-09 | Schering Corporation | Muteins of mammalian cytokine interleukin-13 |
| US6682741B1 (en) | 1998-06-10 | 2004-01-27 | The United States Of America As Represented By The Department Of Health And Human Services | β2 microglobulin fusion proteins and high affinity variants |
| WO2002074331A2 (en) * | 2001-03-19 | 2002-09-26 | Isis Innovation Limited | Mutated mhc molecules for use in immune suppression |
| US8895020B2 (en) | 2002-04-19 | 2014-11-25 | Washington University | Single chain trimers and uses therefor |
| WO2005081716A2 (en) | 2003-11-24 | 2005-09-09 | The Johns Hopkins University | DNA VACCINES TARGETING ANTIGENS OF THE SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS (SARS-CoV) |
| GB0329146D0 (en) | 2003-12-16 | 2004-01-21 | Glaxosmithkline Biolog Sa | Vaccine |
| CA2611946C (en) | 2005-06-20 | 2013-04-16 | Cadila Healthcare Limited | Expression vector and methods of producing high levels of proteins |
| US7521195B1 (en) | 2005-07-21 | 2009-04-21 | Celera Corporation | Lung disease targets and uses thereof |
| US8992937B2 (en) | 2006-08-28 | 2015-03-31 | Washington University | Disulfide trap MHC class I molecules and uses therefor |
| US20110318380A1 (en) | 2008-10-01 | 2011-12-29 | Dako Denmark A/S | MHC Multimers in Cancer Vaccines and Immune Monitoring |
| US20120021484A1 (en) * | 2008-10-22 | 2012-01-26 | Biogen Idec Ma Inc. | Recombinant FcRn and Variants Thereof for Purification of Fc-Containing Fusion Proteins |
| PT2367561E (pt) | 2008-11-30 | 2015-10-23 | Immusant Inc | Composições e métodos para o tratamento da doença celíaca |
| WO2012037551A2 (en) | 2010-09-17 | 2012-03-22 | Irx Therapeutics, Inc. | Primary cell-derived biologic and wt1 synthetic long peptide vaccine |
| US20120141537A1 (en) | 2010-11-18 | 2012-06-07 | Pease Larry R | Enhancing t cell activation using altered mhc-peptide ligands |
| WO2012088446A1 (en) * | 2010-12-22 | 2012-06-28 | Board Of Trustees Of The Leland Stanford Junior University | Superagonists and antagonists of interleukin-2 |
| AU2012222833B2 (en) | 2011-03-03 | 2017-03-16 | Zymeworks Inc. | Multivalent heteromultimer scaffold design and constructs |
| US20140134195A1 (en) | 2011-04-20 | 2014-05-15 | University Of Washington Through Its Center For Commercialization | Beta-2 microglobulin-deficient cells |
| WO2013022091A1 (ja) | 2011-08-11 | 2013-02-14 | 小野薬品工業株式会社 | Pd-1アゴニストからなる自己免疫疾患治療剤 |
| WO2013030620A2 (de) | 2011-08-30 | 2013-03-07 | Jacobs University Bremen Ggmbh | Gen codiert für ein mhc-klasse-i-molekül, plasmid, expressionssystem protein, multimer, reagenz und kit zum analysieren einer t-zellen-frequenz |
| AU2013207669C1 (en) | 2012-01-13 | 2018-05-31 | Memorial Sloan Kettering Cancer Center | Immunogenic WT-1 peptides and methods of use thereof |
| DE18200782T1 (de) | 2012-04-02 | 2021-10-21 | Modernatx, Inc. | Modifizierte polynukleotide zur herstellung von proteinen im zusammenhang mit erkrankungen beim menschen |
| CN105121715B (zh) | 2012-12-11 | 2018-10-26 | 艾伯特叶史瓦大学爱因斯坦医学院 | 高通量受体:配体鉴定方法 |
| SG11201605632SA (en) | 2014-01-21 | 2016-08-30 | Einstein Coll Med | Cellular platform for rapid and comprehensive t-cell immunomonitoring |
| EP3286222A4 (en) | 2015-03-23 | 2018-08-08 | The Johns Hopkins University | Hla-restricted epitopes encoded by somatically mutated genes |
| US10472412B2 (en) | 2015-03-25 | 2019-11-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Bispecific multivalent fusion proteins |
| MA45489A (fr) | 2015-10-22 | 2018-08-29 | Juno Therapeutics Gmbh | Procédés de culture de cellules, kits et appareil associés |
| EP3423108A4 (en) * | 2016-03-02 | 2019-10-02 | Cue Biopharma, Inc. | T CELL MODULATING MULTIPLE POLYPEPTIDES AND METHOD OF USE THEREOF |
| CA3014466A1 (en) | 2016-03-03 | 2017-09-08 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| RS67172B1 (sr) | 2016-03-31 | 2025-09-30 | Biontech Us Inc | Neoantigeni i postupci za njihovu upotrebu |
| KR20240115933A (ko) * | 2016-05-04 | 2024-07-26 | 암젠 인크 | T-조절 세포의 증식을 위한 인터류킨-2 뮤테인 |
| CA3022331A1 (en) | 2016-05-18 | 2017-11-23 | Albert Einstein College Of Medicine, Inc. | Variant pd-l1 polypeptides, t-cell modulatory multimeric polypeptides, and methods of use thereof |
| CN109475628A (zh) | 2016-05-18 | 2019-03-15 | 库尔生物制药有限公司 | T细胞调节性多聚体多肽及其使用方法 |
| DE102016222109A1 (de) | 2016-11-10 | 2018-05-17 | Robert Bosch Gmbh | Brennstoffzellensystem |
| AU2017379900B2 (en) | 2016-12-22 | 2024-12-05 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| WO2018129474A1 (en) | 2017-01-09 | 2018-07-12 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| EP3596118B1 (en) | 2017-03-15 | 2024-08-21 | Cue Biopharma, Inc. | Combination of multimeric fusion polypeptides and immune checkpoint inhibitor for treating hpv-associated cancer |
| EP3595706A1 (en) | 2017-03-17 | 2020-01-22 | Fred Hutchinson Cancer Research Center | Immunomodulatory fusion proteins and uses thereof |
| WO2019051127A1 (en) | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF |
| WO2019051126A1 (en) | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | ANTIGEN PRESENTING POLYPEPTIDES COMPRISING CHEMICAL CONJUGATION SITES AND METHODS OF USE THEREOF |
| IL297361B2 (en) | 2017-09-07 | 2024-07-01 | Cue Biopharma Inc | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| JP2021500855A (ja) | 2017-09-07 | 2021-01-14 | キュー バイオファーマ, インコーポレイテッド | 抗原提示ポリペプチドおよびその使用方法 |
| WO2019139896A1 (en) | 2018-01-09 | 2019-07-18 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| SG11202009761YA (en) | 2018-04-02 | 2020-10-29 | Pact Pharma Inc | Peptide-mhc compacts |
| WO2020132366A2 (en) | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| BR112021011838A2 (pt) | 2018-12-19 | 2021-08-31 | Cue Biopharma, Inc. | Peptídeos multiméricos moduladores de células t e métodos de uso destes |
| WO2020132136A1 (en) | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| WO2020132365A2 (en) | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| WO2020132135A1 (en) | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| WO2020132368A1 (en) | 2018-12-19 | 2020-06-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| TWI856047B (zh) | 2018-12-19 | 2024-09-21 | 美商信號生物製藥公司 | 多聚體t細胞調節多肽及其使用方法 |
| CN113795263A (zh) | 2019-02-20 | 2021-12-14 | 鲁比厄斯治疗法股份有限公司 | 包含可负载抗原呈递多肽的工程化红系细胞及使用方法 |
| EP3935080A4 (en) | 2019-03-06 | 2023-04-05 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| EP3935079A4 (en) | 2019-03-06 | 2023-03-22 | Cue Biopharma, Inc. | T LYMPHOCYTE MODULATOR ANTIGEN PRESENTING POLYPEPTIDES AND METHODS OF USE THEREOF |
| CN118852456A (zh) | 2019-05-29 | 2024-10-29 | Cue生物制药股份有限公司 | 多聚体t细胞调节多肽及其使用方法 |
| EP3986448A4 (en) | 2019-06-19 | 2023-07-12 | Cue Biopharma, Inc. | MULTIMERIC T-CELL-MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| EP4030897A4 (en) | 2019-09-20 | 2023-10-18 | Cue Biopharma, Inc. | T-cell modulatory polypeptides and methods of use thereof |
| US20230265134A1 (en) | 2019-09-30 | 2023-08-24 | Adimab, Llc | Ch1 domain variants engineered for preferential light chain pairing and multispecific antibodies comprising the same |
| JP2023500574A (ja) | 2019-10-23 | 2023-01-10 | キュー バイオファーマ, インコーポレイテッド | T細胞調節性キメラ分子及びその使用方法 |
| AU2020369573A1 (en) | 2019-10-23 | 2022-03-24 | Cue Biopharma, Inc. | Modified cytotoxic T cells and methods of use thereof |
| WO2021195108A1 (en) | 2020-03-24 | 2021-09-30 | Cue Biopharma, Inc. | T cell modulatory polypeptides and methods of use thereof |
| WO2021195411A1 (en) | 2020-03-25 | 2021-09-30 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| EP4149534A4 (en) | 2020-05-12 | 2024-09-04 | Cue Biopharma, Inc. | MULTIMERIC POLYPEPTIDES MODULATING T CELLS AND METHODS OF USE THEREOF |
| WO2021242935A1 (en) | 2020-05-26 | 2021-12-02 | Cue Biopharma, Inc. | Antigen presenting polypeptide complexes and methods of use thereof |
| WO2022015880A2 (en) | 2020-07-14 | 2022-01-20 | Cue Biopharma, Inc. | T-cell modulatory polypeptides with conjugation sites and methods of use thereof |
| WO2022056015A1 (en) | 2020-09-09 | 2022-03-17 | Cue Biopharma, Inc. | Mhc class ii t-cell modulatory multimeric polypeptides and methods of use thereof |
| WO2022056014A1 (en) | 2020-09-09 | 2022-03-17 | Cue Biopharma, Inc. | Mhc class ii t-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (t1d) and methods of use thereof |
| US20230414777A1 (en) | 2020-11-06 | 2023-12-28 | Cue Biopharma, Inc. | Antigen Presenting Polypeptide Complexes and Methods of Use Thereof |
| WO2022099156A2 (en) | 2020-11-06 | 2022-05-12 | Cue Biopharma, Inc. | T-cell modulatory polypeptides with conjugation sites and methods of use thereof |
| WO2022119958A1 (en) | 2020-12-02 | 2022-06-09 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| CN117222421A (zh) | 2021-03-19 | 2023-12-12 | Cue生物制药股份有限公司 | T细胞调节多肽和其使用方法 |
| WO2022197971A1 (en) | 2021-03-19 | 2022-09-22 | Cue Biopharma, Inc. | T-cell modulatory polypeptides and methods of use thereof |
| CA3216278A1 (en) | 2021-04-21 | 2022-10-27 | Iii Ronald D. Seidel | Antigen presenting polypeptide complexes bearing tgf-beta and methods of use thereof |
| WO2022226073A1 (en) | 2021-04-21 | 2022-10-27 | Cue Biopharma, Inc. | Mhc class ii t-cell modulatory polypeptides and methods of use thereof |
| AU2022261908A1 (en) | 2021-04-21 | 2023-10-05 | Cue Biopharma, Inc. | Mhc class ii t-cell modulatory polypeptides for treating type 1 diabetes mellitus (t1d) and methods of use thereof |
| EP4426721A4 (en) | 2021-11-04 | 2025-10-08 | Cue Biopharma Inc | MULTIMERIC T-CELL MODULATORY POLYPEPTIDES AND METHODS OF USE THEREOF |
-
2018
- 2018-09-06 WO PCT/US2018/049803 patent/WO2019051127A1/en not_active Ceased
- 2018-09-06 JP JP2020536495A patent/JP2020534352A/ja active Pending
- 2018-09-06 KR KR1020207009953A patent/KR20200064085A/ko not_active Withdrawn
- 2018-09-06 AU AU2018327224A patent/AU2018327224A1/en not_active Abandoned
- 2018-09-06 TW TW107131342A patent/TW201920249A/zh unknown
- 2018-09-06 CN CN201880071636.1A patent/CN111315768A/zh active Pending
- 2018-09-06 CA CA3074839A patent/CA3074839A1/en active Pending
- 2018-09-06 EP EP18853566.0A patent/EP3679064A4/en active Pending
-
2020
- 2020-03-05 IL IL273091A patent/IL273091A/en unknown
- 2020-03-06 US US16/812,125 patent/US12006348B2/en active Active
-
2024
- 2024-05-06 US US18/656,531 patent/US20240409606A1/en not_active Abandoned
Patent Citations (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1548716A (en) | 1924-10-02 | 1925-08-04 | Fournier Santiago Emilien | Process for the manufacture of artificial freestone |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| WO1993009239A1 (en) | 1991-11-08 | 1993-05-13 | Research Corporation Technologies, Inc. | Adeno-associated virus-2 basal vectors |
| WO1993019191A1 (fr) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Adenovirus recombinants defectifs exprimant des cytokines pour traitement antitumoral |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| US7078387B1 (en) | 1998-12-28 | 2006-07-18 | Arch Development Corp. | Efficient and stable in vivo gene transfer to cardiomyocytes using recombinant adeno-associated virus vectors |
| US6287860B1 (en) | 2000-01-20 | 2001-09-11 | Isis Pharmaceuticals, Inc. | Antisense inhibition of MEKK2 expression |
| US7351797B1 (en) | 2000-09-29 | 2008-04-01 | The Scripps Research Institute | Labeled peptides, and processes and intermediates useful for their preparation |
| WO2002085923A2 (en) | 2001-04-19 | 2002-10-31 | The Scripps Research Institute | In vivo incorporation of unnatural amino acids |
| US20100189682A1 (en) | 2005-09-27 | 2010-07-29 | Volker Schellenberger | Biologically active proteins having increased In Vivo and/or In Vitro stability |
| WO2007103515A2 (en) | 2006-03-06 | 2007-09-13 | Amunix, Inc. | Unstructured recombinant polymers and uses thereof |
| WO2009023270A2 (en) | 2007-08-15 | 2009-02-19 | Amunix, Inc. | Compositions and methods for modifying properties of biologically active polypeptides |
| US20090092582A1 (en) | 2007-08-15 | 2009-04-09 | Oren Bogin | Compositions and methods for modifying properties of biologically active polypeptides |
| US20110159023A1 (en) | 2008-08-25 | 2011-06-30 | Solomon Langermann | Pd-1 antagonists and methods for treating infectious disease |
| WO2010091122A1 (en) | 2009-02-03 | 2010-08-12 | Amunix, Inc. | Extended recombinant polypeptides and compositions comprising same |
| US9238878B2 (en) | 2009-02-17 | 2016-01-19 | Redwood Bioscience, Inc. | Aldehyde-tagged protein-based drug carriers and methods of use |
| US20170166639A1 (en) | 2011-01-14 | 2017-06-15 | Redwood Bioscience, Inc. | Aldehyde-Tagged Immunoglobulin Polypeptides and Methods of Use Thereof |
| US9540438B2 (en) | 2011-01-14 | 2017-01-10 | Redwood Bioscience, Inc. | Aldehyde-tagged immunoglobulin polypeptides and methods of use thereof |
| US20140046030A1 (en) | 2012-06-08 | 2014-02-13 | Sutro Biopharma, Inc. | Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use |
| US20140051836A1 (en) | 2012-06-26 | 2014-02-20 | Sutro Biopharma, Inc. | Modified Fc Proteins Comprising Site-Specific Non-Natural Amino Acid Residues, Conjugates of the Same, Methods of Their Preparation and Methods of Their Use |
| US20160229911A1 (en) | 2012-07-19 | 2016-08-11 | Redwood Bioscience, Inc. | Antibody Specific for CD22 and Methods of Use Thereof |
| US9310374B2 (en) | 2012-11-16 | 2016-04-12 | Redwood Bioscience, Inc. | Hydrazinyl-indole compounds and methods for producing a conjugate |
| US20170043033A1 (en) | 2014-04-25 | 2017-02-16 | Rinat Neuroscience Corp. | Antibody-drug conjugates with high drug loading |
| US20150352225A1 (en) | 2014-06-06 | 2015-12-10 | Redwood Bioscience, Inc. | Anti-Her2 Antibody-Maytansine Conjugates and Methods of Use Thereof |
| US20170058015A1 (en) | 2014-06-18 | 2017-03-02 | Albert Einstein College Of Medicine, Inc. | Syntac polypeptides and uses thereof |
| US20160347847A1 (en) | 2015-05-07 | 2016-12-01 | Agenus Inc. | Anti-OX40 Antibodies and Methods of Use Thereof |
Non-Patent Citations (61)
| Title |
|---|
| "GenBank", Database accession no. XP _001125834 |
| "Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT, WILLIAMS, & WILKINS |
| A. GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, & WILKINS |
| ABDICHE ET AL., J. ANAL. BIOCHEM., vol. 377, 2008, pages 209 |
| ALI ET AL., GENET, vol. 5, no. 591, 1996, pages 594 |
| ALI ET AL., HUM GENE THER, vol. 9, no. 81, 1998, pages 86 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| BADESCU G ET AL., BIOCONJUG CHEM., vol. 25, no. 7, 2014, pages 1198 - 202 |
| BENNETT ET AL., INVEST OPTHALMOL VIS SCI, vol. 38, no. 2857, 1997, pages 2863 |
| BORRAS ET AL., GENE THER, vol. 6, no. 515, 1999, pages 524 |
| BROCCHINI ET AL., ADV. DRUG. DELIVERY REV., vol. 60, 2008, pages 3 - 12 |
| BROMLEY ET AL., ANN REV IMMUNOL., vol. 19, 2001, pages 375 - 96 |
| CHEEVER ET AL., CLIN. CANCER RES., vol. 15, 2009, pages 5323 |
| DENNLER P ET AL., BIOCONJUG CHEM, vol. 25, no. 3, 2014, pages 569 - 78 |
| DESMOND ET AL., ANTIVIRAL THERAPY, vol. 13, 2008, pages 161 |
| FLANNERY ET AL., PNAS, vol. 94, no. 10319, 1997, pages 6921 |
| FLOTTE ET AL., PNAS, vol. 90, 1993, pages 10613 - 10617 |
| GUBENS ET AL., RNA, vol. 16, no. 8, August 2010 (2010-08-01), pages 1660 - 1672 |
| HASSOUNEH ET AL., METHODS ENZYMOL., vol. 502, 2012, pages 215 |
| JEGER, S. ET AL., ANGEW CHEM, vol. 49, 2010, pages 99957 |
| JEWETT, M. C.SWARTZ, J. R., BIOTECHNOL. BIOENG., vol. 86, 2004, pages 188 - 95 |
| JOMARY ET AL., GENE THER, vol. 4, no. 683, 1997, pages 690 |
| KEFALAKES ET AL., HEPATOLOGY, vol. 62, 2015, pages 47 |
| KIM, D. M.SWARTZ, J. R, BIOTECHNOL. BIOENG., vol. 74, 2001, pages 309 - 16 |
| KIM, D. M.SWARTZ, J. R., BIOTECHNOL. BIOENG., vol. 66, 1999, pages 180 - 8 |
| KIM, D. M.SWARTZ, J. R., BIOTECHNOL. PROG., vol. 16, 2000, pages 385 - 90 |
| LAD ET AL., J. BIOMOL. SCREEN., vol. 20, no. 4, 2015, pages 498 - 507 |
| LI ET AL., INVEST OPTHALMOL VIS SCI, vol. 35, no. 2543, 1994, pages 2549 |
| LIDAVIDSON, PNAS, vol. 92, no. 7700, 1995, pages 7704 |
| LUMLEY ET AL., WELLCOME OPEN RES, vol. 1, 2016, pages 9 |
| MATSUI ET AL., ONCOGENE, vol. 5, 1990, pages 249 |
| MCCOMBOWEN, AAPS J., vol. 117, no. 2, pages 339 - 351 |
| MCCOMBSOWEN, AAPS JOURNAL, vol. 17, no. 2, 2015, pages 339 - 351 |
| MEGEED ET AL., ADV DRUG DELIV REV, vol. 54, 2002, pages 1075 |
| MENDELSON ET AL., VIROL, vol. 166, 1988, pages 154 - 165 |
| METHODS IN ENZYMOLOGY, vol. 153, 1987, pages 516 - 544 |
| MIAO ET AL., PLOSONE, vol. 9, 2014, pages e94281 |
| PARHAM ET AL., J. IMMUNOL., vol. 123, 1979, pages 342 |
| RAMOS ET AL., J. IMMUNOTHER., vol. 36, 2013, pages 66 |
| REMINGTON: "The Science and Practice of Pharmacy", 1995, MACK PUBLISHING CO |
| RESSING ET AL., J. IMMUNOL., vol. 154, 1995, pages 5934 |
| RODRIGUEZ ET AL., PNAS, vol. 103, no. 23, 2006, pages 8650 - 8655 |
| ROLLING ET AL., THER, vol. 10, no. 641, 1999, pages 648 |
| SAKAMOTO ET AL., H GENE THER, vol. 5, no. 1088, 1999, pages 1097 |
| SAMULSKI ET AL., J. VIR., vol. 63, 1989, pages 3822 - 3828 |
| SCHELLENBERGER ET AL., NAT BIOTECHNOL., vol. 27, 2009, pages 1186 |
| SCHERAGA, REV. COMPUTATIONAL CHEM., 1992, pages 11173 - 142 |
| See also references of EP3679064A4 |
| SHAHDUNCAN, J. YIS. EXP., vol. 18, 2014, pages e51383 |
| SWARTZ ET AL., METHODS MOL. BIOL., vol. 267, 2004, pages 169 - 82 |
| SZOKA ET AL., ANN. REV. BIOPHYS. BIOENG., vol. 9, 1980, pages 467 |
| TAKAHASHI ET AL., J VIROL, vol. 73, no. 7812, 1999, pages 7816 |
| VALLUZZI ET AL., PHILOS TRANS R SOC LOND B BIOL SCI, vol. 357, 2002, pages 165 |
| VIGNERON ET AL., CANCER IMMUNITY, vol. 13, 2013, pages 15 |
| VIGNERON, BIOMED RES. INT'L, no. 948501, 2015 |
| VOLOSHIN, A. M.SWARTZ, J. R., BIOTECHNOL. BIOENG., vol. 91, 2005, pages 516 - 21 |
| WAGNER ET AL., J. CELL. SCI., vol. 116, 2003, pages 1653 |
| WANG ET AL., COLD SPRING HARBOR PERSPECTIVES IN BIOLOGY, vol. 2, no. 5, 2010, pages a002279 |
| WONG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 2965 |
| Z. HEIN ET AL., JOURNAL OF CELL SCIENCE, vol. 127, 2014, pages 2885 - 2897 |
| ZHANG ET AL., NATURE, vol. 383, 1996, pages 168 |
Cited By (57)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12421287B2 (en) | 2016-12-22 | 2025-09-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12180258B2 (en) | 2016-12-22 | 2024-12-31 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12152061B2 (en) | 2016-12-22 | 2024-11-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12145973B2 (en) | 2016-12-22 | 2024-11-19 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11987610B2 (en) | 2016-12-22 | 2024-05-21 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11739133B2 (en) | 2016-12-22 | 2023-08-29 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US10961310B2 (en) | 2017-03-15 | 2021-03-30 | Pandion Operations, Inc. | Targeted immunotolerance |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11993641B2 (en) | 2017-03-15 | 2024-05-28 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11466068B2 (en) | 2017-05-24 | 2022-10-11 | Pandion Operations, Inc. | Targeted immunotolerance |
| US10676516B2 (en) | 2017-05-24 | 2020-06-09 | Pandion Therapeutics, Inc. | Targeted immunotolerance |
| US11091527B2 (en) | 2017-12-06 | 2021-08-17 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US11965008B2 (en) | 2017-12-06 | 2024-04-23 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US11091526B2 (en) | 2017-12-06 | 2021-08-17 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US11945852B2 (en) | 2017-12-06 | 2024-04-02 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| USRE50550E1 (en) | 2017-12-06 | 2025-08-26 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US11779632B2 (en) | 2017-12-06 | 2023-10-10 | Pandion Operation, Inc. | IL-2 muteins and uses thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| EP3897701A4 (en) * | 2018-12-19 | 2023-01-25 | Cue Biopharma, Inc. | MULTIMERIC T-CELL-MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| WO2020193745A1 (en) * | 2019-03-28 | 2020-10-01 | Immunocore Limited | Binding molecules specfic for hbv envelope protein |
| US11739146B2 (en) | 2019-05-20 | 2023-08-29 | Pandion Operations, Inc. | MAdCAM targeted immunotolerance |
| WO2020243315A1 (en) * | 2019-05-29 | 2020-12-03 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| JP2022534846A (ja) * | 2019-05-29 | 2022-08-04 | キュー バイオファーマ, インコーポレイテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| AU2020282736B2 (en) * | 2019-05-29 | 2025-10-30 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| JP7762068B2 (ja) | 2019-05-29 | 2025-10-29 | キュー バイオファーマ, インコーポレイテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| WO2020257191A1 (en) * | 2019-06-19 | 2020-12-24 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
| CN110684081A (zh) * | 2019-09-02 | 2020-01-14 | 天益健康科学研究院(镇江)有限公司 | 一种编码分泌型多肽氨基酸的重组溶瘤新城疫病毒及其制备方法 |
| CN114423284A (zh) * | 2019-09-20 | 2022-04-29 | 库尔生物制药有限公司 | T细胞调节多肽及其使用方法 |
| WO2021055594A1 (en) * | 2019-09-20 | 2021-03-25 | Cue Biopharma, Inc. | T-cell modulatory polypeptides and methods of use thereof |
| CN114599674A (zh) * | 2019-10-23 | 2022-06-07 | 库尔生物制药有限公司 | T细胞调节嵌合分子及其使用方法 |
| JP2023500574A (ja) * | 2019-10-23 | 2023-01-10 | キュー バイオファーマ, インコーポレイテッド | T細胞調節性キメラ分子及びその使用方法 |
| WO2021081239A1 (en) * | 2019-10-23 | 2021-04-29 | Cue Biopharma, Inc. | T-cell modulatory chimeric molecules and methods of use thereof |
| EP4048689A4 (en) * | 2019-10-23 | 2023-11-01 | Cue Biopharma, Inc. | T-CELL MODULATING CHIMERIC MOLECULES AND METHOD OF USE THEREOF |
| US12215131B2 (en) | 2019-12-20 | 2025-02-04 | Regeneron Pharmaceuticals, Inc. | IgG Fc-IL2-Rα-IL2 fusions and methods of use thereof |
| US11981715B2 (en) | 2020-02-21 | 2024-05-14 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a CD39 effector |
| EP4106790A4 (en) * | 2020-02-21 | 2024-02-21 | 3T Biosciences, Inc. | YEAST DISPLAY LIBRARIES, RELATED COMPOSITIONS AND RELATED METHODS OF USE |
| WO2021195411A1 (en) * | 2020-03-25 | 2021-09-30 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof |
| JP7743428B2 (ja) | 2020-05-12 | 2025-09-24 | キュー バイオファーマ, インコーポレイテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485183B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12257311B2 (en) | 2020-05-12 | 2025-03-25 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| JP2023526723A (ja) * | 2020-05-12 | 2023-06-23 | キュー バイオファーマ, インコーポレイテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| US12485184B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| JP2023525822A (ja) * | 2020-05-12 | 2023-06-19 | エルジー・ケム・リミテッド | 多量体t細胞調節性ポリペプチド及びその使用方法 |
| EP4149953A4 (en) * | 2020-05-12 | 2024-06-26 | Lg Chem, Ltd. | MULTIMER T CELL MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| AU2021271778B2 (en) * | 2020-05-12 | 2025-10-23 | Lg Chem, Ltd. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| EP4157350A4 (en) * | 2020-05-26 | 2025-07-23 | Cue Biopharma Inc | ANTIGEN-PRESENTING POLYPEPTIDE COMPLEXES AND METHODS OF USE THEREOF |
| EP4157349A4 (en) * | 2020-05-26 | 2024-07-17 | Cue Biopharma, Inc. | ANTIGEN-PRESENTING POLYPEPTIDE COMPLEXES AND ASSOCIATED METHODS OF USE |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| WO2022099156A3 (en) * | 2020-11-06 | 2022-06-16 | Cue Biopharma, Inc. | T-cell modulatory polypeptides with conjugation sites and methods of use thereof |
| EP4416175A4 (en) * | 2021-10-12 | 2025-08-13 | Adoc Ssf Llc | COMPOSITIONS AND METHODS FOR ISOLATING T CELL RECEPTORS (TCR) AND CELLS EXPRESSING THEM |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3679064A1 (en) | 2020-07-15 |
| JP2020534352A (ja) | 2020-11-26 |
| TW201920249A (zh) | 2019-06-01 |
| US20200369745A1 (en) | 2020-11-26 |
| CA3074839A1 (en) | 2019-03-14 |
| WO2019051127A9 (en) | 2019-08-29 |
| US12006348B2 (en) | 2024-06-11 |
| AU2018327224A1 (en) | 2020-04-23 |
| EP3679064A4 (en) | 2021-06-02 |
| KR20200064085A (ko) | 2020-06-05 |
| IL273091A (en) | 2020-04-30 |
| US20240409606A1 (en) | 2024-12-12 |
| CN111315768A (zh) | 2020-06-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240409606A1 (en) | T-Cell Modulatory Multimeric Polypeptide with Conjugation Sites and Methods of Use Thereof | |
| US20230064668A1 (en) | Antigen-Presenting Polypeptides with Chemical Conjugation Sites and Methods of Use Thereof | |
| US20250002556A1 (en) | Multimeric t-cell modulatory polypeptides and methods of use thereof | |
| US11702461B2 (en) | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides | |
| US20210393693A1 (en) | T-Cell Modulatory Multimeric Polypeptides with Conjugation Sites and Methods of Use Thereof | |
| US20220008467A1 (en) | T-Cell Modulatory Multimeric Polypeptides with Conjugation Sites and Methods of Use Thereof | |
| US20220079985A1 (en) | T-Cell Modulatory Multimeric Polypeptides with Conjugation Sites and Methods of Use Thereof | |
| US20220135645A1 (en) | Antigen-Presenting Polypeptides with Chemical Conjugation Sites and Methods of Use Thereof | |
| US20240082411A1 (en) | T-Cell Modulatory Polypeptides with Conjugation Sites and Methods of Use Thereof | |
| US20230117521A1 (en) | T-cell modulatory multimeric polypeptides with conjugation sites and methods of use thereof | |
| WO2020180501A1 (en) | T-cell modulatory antigen-presenting polypeptides and methods of use thereof | |
| US20220135644A1 (en) | Antigen-Presenting Polypeptides with Chemical Conjugation Sites and Methods of Use Thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18853566 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 3074839 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020536495 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207009953 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018853566 Country of ref document: EP Effective date: 20200407 |
|
| ENP | Entry into the national phase |
Ref document number: 2018327224 Country of ref document: AU Date of ref document: 20180906 Kind code of ref document: A |