WO2019035672A1 - 아실화 옥신토모듈린 펩타이드 유사체 - Google Patents
아실화 옥신토모듈린 펩타이드 유사체 Download PDFInfo
- Publication number
- WO2019035672A1 WO2019035672A1 PCT/KR2018/009425 KR2018009425W WO2019035672A1 WO 2019035672 A1 WO2019035672 A1 WO 2019035672A1 KR 2018009425 W KR2018009425 W KR 2018009425W WO 2019035672 A1 WO2019035672 A1 WO 2019035672A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- seq
- peptide
- lys
- asp
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 153
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical class C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 title abstract description 4
- 208000008589 Obesity Diseases 0.000 claims abstract description 40
- 235000020824 obesity Nutrition 0.000 claims abstract description 40
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 19
- 238000011282 treatment Methods 0.000 claims abstract description 18
- 229940126214 compound 3 Drugs 0.000 claims description 45
- 150000001875 compounds Chemical class 0.000 claims description 36
- 239000004971 Cross linker Substances 0.000 claims description 30
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 claims description 28
- SEOVTRFCIGRIMH-UHFFFAOYSA-N indole-3-acetic acid Chemical compound C1=CC=C2C(CC(=O)O)=CNC2=C1 SEOVTRFCIGRIMH-UHFFFAOYSA-N 0.000 claims description 25
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 24
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 claims description 21
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 18
- 150000002632 lipids Chemical group 0.000 claims description 17
- 238000000034 method Methods 0.000 claims description 17
- 150000001413 amino acids Chemical group 0.000 claims description 15
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 14
- 229930192334 Auxin Natural products 0.000 claims description 14
- 125000003338 L-glutaminyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C(=O)N([H])[H] 0.000 claims description 14
- 125000000217 alkyl group Chemical group 0.000 claims description 14
- 239000002363 auxin Substances 0.000 claims description 14
- 125000006850 spacer group Chemical group 0.000 claims description 14
- 102000001189 Cyclic Peptides Human genes 0.000 claims description 13
- 108010069514 Cyclic Peptides Proteins 0.000 claims description 13
- 229940024606 amino acid Drugs 0.000 claims description 13
- -1 respectively Natural products 0.000 claims description 13
- 206010033307 Overweight Diseases 0.000 claims description 11
- 150000003951 lactams Chemical group 0.000 claims description 11
- QBWKPGNFQQJGFY-QLFBSQMISA-N 3-[(1r)-1-[(2r,6s)-2,6-dimethylmorpholin-4-yl]ethyl]-n-[6-methyl-3-(1h-pyrazol-4-yl)imidazo[1,2-a]pyrazin-8-yl]-1,2-thiazol-5-amine Chemical compound N1([C@H](C)C2=NSC(NC=3C4=NC=C(N4C=C(C)N=3)C3=CNN=C3)=C2)C[C@H](C)O[C@H](C)C1 QBWKPGNFQQJGFY-QLFBSQMISA-N 0.000 claims description 9
- 229940125846 compound 25 Drugs 0.000 claims description 9
- 125000003277 amino group Chemical group 0.000 claims description 8
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 8
- 125000000524 functional group Chemical group 0.000 claims description 8
- 229910052739 hydrogen Inorganic materials 0.000 claims description 8
- 239000001257 hydrogen Substances 0.000 claims description 8
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims description 8
- 239000000203 mixture Substances 0.000 claims description 8
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 8
- 229920006395 saturated elastomer Polymers 0.000 claims description 8
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 8
- UNILWMWFPHPYOR-KXEYIPSPSA-M 1-[6-[2-[3-[3-[3-[2-[2-[3-[[2-[2-[[(2r)-1-[[2-[[(2r)-1-[3-[2-[2-[3-[[2-(2-amino-2-oxoethoxy)acetyl]amino]propoxy]ethoxy]ethoxy]propylamino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-[(2r)-2,3-di(hexadecanoyloxy)propyl]sulfanyl-1-oxopropan-2-yl Chemical compound O=C1C(SCCC(=O)NCCCOCCOCCOCCCNC(=O)COCC(=O)N[C@@H](CSC[C@@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NCC(=O)N[C@H](CO)C(=O)NCCCOCCOCCOCCCNC(=O)COCC(N)=O)CC(=O)N1CCNC(=O)CCCCCN\1C2=CC=C(S([O-])(=O)=O)C=C2CC/1=C/C=C/C=C/C1=[N+](CC)C2=CC=C(S([O-])(=O)=O)C=C2C1 UNILWMWFPHPYOR-KXEYIPSPSA-M 0.000 claims description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 7
- 125000002252 acyl group Chemical group 0.000 claims description 7
- 125000001183 hydrocarbyl group Chemical group 0.000 claims description 7
- SZUVGFMDDVSKSI-WIFOCOSTSA-N (1s,2s,3s,5r)-1-(carboxymethyl)-3,5-bis[(4-phenoxyphenyl)methyl-propylcarbamoyl]cyclopentane-1,2-dicarboxylic acid Chemical compound O=C([C@@H]1[C@@H]([C@](CC(O)=O)([C@H](C(=O)N(CCC)CC=2C=CC(OC=3C=CC=CC=3)=CC=2)C1)C(O)=O)C(O)=O)N(CCC)CC(C=C1)=CC=C1OC1=CC=CC=C1 SZUVGFMDDVSKSI-WIFOCOSTSA-N 0.000 claims description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 claims description 6
- 125000003118 aryl group Chemical group 0.000 claims description 6
- 150000001732 carboxylic acid derivatives Chemical group 0.000 claims description 6
- 229940126543 compound 14 Drugs 0.000 claims description 6
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 6
- 125000001072 heteroaryl group Chemical group 0.000 claims description 6
- 239000002253 acid Substances 0.000 claims description 5
- 229940125773 compound 10 Drugs 0.000 claims description 5
- ZLVXBBHTMQJRSX-VMGNSXQWSA-N jdtic Chemical compound C1([C@]2(C)CCN(C[C@@H]2C)C[C@H](C(C)C)NC(=O)[C@@H]2NCC3=CC(O)=CC=C3C2)=CC=CC(O)=C1 ZLVXBBHTMQJRSX-VMGNSXQWSA-N 0.000 claims description 5
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 claims description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 claims description 4
- KCBAMQOKOLXLOX-BSZYMOERSA-N CC1=C(SC=N1)C2=CC=C(C=C2)[C@H](C)NC(=O)[C@@H]3C[C@H](CN3C(=O)[C@H](C(C)(C)C)NC(=O)CCCCCCCCCCNCCCONC(=O)C4=C(C(=C(C=C4)F)F)NC5=C(C=C(C=C5)I)F)O Chemical compound CC1=C(SC=N1)C2=CC=C(C=C2)[C@H](C)NC(=O)[C@@H]3C[C@H](CN3C(=O)[C@H](C(C)(C)C)NC(=O)CCCCCCCCCCNCCCONC(=O)C4=C(C(=C(C=C4)F)F)NC5=C(C=C(C=C5)I)F)O KCBAMQOKOLXLOX-BSZYMOERSA-N 0.000 claims description 4
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 4
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 claims description 4
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 claims description 4
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 claims description 4
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 claims description 4
- LNUFLCYMSVYYNW-ZPJMAFJPSA-N [(2r,3r,4s,5r,6r)-2-[(2r,3r,4s,5r,6r)-6-[(2r,3r,4s,5r,6r)-6-[(2r,3r,4s,5r,6r)-6-[[(3s,5s,8r,9s,10s,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-3-yl]oxy]-4,5-disulfo Chemical compound O([C@@H]1[C@@H](COS(O)(=O)=O)O[C@@H]([C@@H]([C@H]1OS(O)(=O)=O)OS(O)(=O)=O)O[C@@H]1[C@@H](COS(O)(=O)=O)O[C@@H]([C@@H]([C@H]1OS(O)(=O)=O)OS(O)(=O)=O)O[C@@H]1[C@@H](COS(O)(=O)=O)O[C@H]([C@@H]([C@H]1OS(O)(=O)=O)OS(O)(=O)=O)O[C@@H]1C[C@@H]2CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)[C@H]1O[C@H](COS(O)(=O)=O)[C@@H](OS(O)(=O)=O)[C@H](OS(O)(=O)=O)[C@H]1OS(O)(=O)=O LNUFLCYMSVYYNW-ZPJMAFJPSA-N 0.000 claims description 4
- SMNRFWMNPDABKZ-WVALLCKVSA-N [[(2R,3S,4R,5S)-5-(2,6-dioxo-3H-pyridin-3-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [[[(2R,3S,4S,5R,6R)-4-fluoro-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl] hydrogen phosphate Chemical compound OC[C@H]1O[C@H](OP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)C2C=CC(=O)NC2=O)[C@H](O)[C@@H](F)[C@@H]1O SMNRFWMNPDABKZ-WVALLCKVSA-N 0.000 claims description 4
- 150000003973 alkyl amines Chemical class 0.000 claims description 4
- 229910052799 carbon Inorganic materials 0.000 claims description 4
- 229940125833 compound 23 Drugs 0.000 claims description 4
- 229940127573 compound 38 Drugs 0.000 claims description 4
- 229920001577 copolymer Polymers 0.000 claims description 4
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 claims description 4
- PIDFDZJZLOTZTM-KHVQSSSXSA-N ombitasvir Chemical compound COC(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)NC1=CC=C([C@H]2N([C@@H](CC2)C=2C=CC(NC(=O)[C@H]3N(CCC3)C(=O)[C@@H](NC(=O)OC)C(C)C)=CC=2)C=2C=CC(=CC=2)C(C)(C)C)C=C1 PIDFDZJZLOTZTM-KHVQSSSXSA-N 0.000 claims description 4
- 229960003104 ornithine Drugs 0.000 claims description 4
- GHYOCDFICYLMRF-UTIIJYGPSA-N (2S,3R)-N-[(2S)-3-(cyclopenten-1-yl)-1-[(2R)-2-methyloxiran-2-yl]-1-oxopropan-2-yl]-3-hydroxy-3-(4-methoxyphenyl)-2-[[(2S)-2-[(2-morpholin-4-ylacetyl)amino]propanoyl]amino]propanamide Chemical compound C1(=CCCC1)C[C@@H](C(=O)[C@@]1(OC1)C)NC([C@H]([C@@H](C1=CC=C(C=C1)OC)O)NC([C@H](C)NC(CN1CCOCC1)=O)=O)=O GHYOCDFICYLMRF-UTIIJYGPSA-N 0.000 claims description 3
- LJOOWESTVASNOG-UFJKPHDISA-N [(1s,3r,4ar,7s,8s,8as)-3-hydroxy-8-[2-[(4r)-4-hydroxy-6-oxooxan-2-yl]ethyl]-7-methyl-1,2,3,4,4a,7,8,8a-octahydronaphthalen-1-yl] (2s)-2-methylbutanoate Chemical compound C([C@H]1[C@@H](C)C=C[C@H]2C[C@@H](O)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)CC1C[C@@H](O)CC(=O)O1 LJOOWESTVASNOG-UFJKPHDISA-N 0.000 claims description 3
- XRWSZZJLZRKHHD-WVWIJVSJSA-N asunaprevir Chemical compound O=C([C@@H]1C[C@H](CN1C(=O)[C@@H](NC(=O)OC(C)(C)C)C(C)(C)C)OC1=NC=C(C2=CC=C(Cl)C=C21)OC)N[C@]1(C(=O)NS(=O)(=O)C2CC2)C[C@H]1C=C XRWSZZJLZRKHHD-WVWIJVSJSA-N 0.000 claims description 3
- 229940125904 compound 1 Drugs 0.000 claims description 3
- 229940125797 compound 12 Drugs 0.000 claims description 3
- 229940125810 compound 20 Drugs 0.000 claims description 3
- 229940125961 compound 24 Drugs 0.000 claims description 3
- 229940127204 compound 29 Drugs 0.000 claims description 3
- JAXFJECJQZDFJS-XHEPKHHKSA-N gtpl8555 Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)N[C@H](B1O[C@@]2(C)[C@H]3C[C@H](C3(C)C)C[C@H]2O1)CCC1=CC=C(F)C=C1 JAXFJECJQZDFJS-XHEPKHHKSA-N 0.000 claims description 3
- 239000000178 monomer Substances 0.000 claims description 3
- 229920001223 polyethylene glycol Polymers 0.000 claims description 3
- 238000011321 prophylaxis Methods 0.000 claims description 3
- AOSZTAHDEDLTLQ-AZKQZHLXSA-N (1S,2S,4R,8S,9S,11S,12R,13S,19S)-6-[(3-chlorophenyl)methyl]-12,19-difluoro-11-hydroxy-8-(2-hydroxyacetyl)-9,13-dimethyl-6-azapentacyclo[10.8.0.02,9.04,8.013,18]icosa-14,17-dien-16-one Chemical compound C([C@@H]1C[C@H]2[C@H]3[C@]([C@]4(C=CC(=O)C=C4[C@@H](F)C3)C)(F)[C@@H](O)C[C@@]2([C@@]1(C1)C(=O)CO)C)N1CC1=CC=CC(Cl)=C1 AOSZTAHDEDLTLQ-AZKQZHLXSA-N 0.000 claims description 2
- ABJSOROVZZKJGI-OCYUSGCXSA-N (1r,2r,4r)-2-(4-bromophenyl)-n-[(4-chlorophenyl)-(2-fluoropyridin-4-yl)methyl]-4-morpholin-4-ylcyclohexane-1-carboxamide Chemical compound C1=NC(F)=CC(C(NC(=O)[C@H]2[C@@H](C[C@@H](CC2)N2CCOCC2)C=2C=CC(Br)=CC=2)C=2C=CC(Cl)=CC=2)=C1 ABJSOROVZZKJGI-OCYUSGCXSA-N 0.000 claims description 2
- GLGNXYJARSMNGJ-VKTIVEEGSA-N (1s,2s,3r,4r)-3-[[5-chloro-2-[(1-ethyl-6-methoxy-2-oxo-4,5-dihydro-3h-1-benzazepin-7-yl)amino]pyrimidin-4-yl]amino]bicyclo[2.2.1]hept-5-ene-2-carboxamide Chemical compound CCN1C(=O)CCCC2=C(OC)C(NC=3N=C(C(=CN=3)Cl)N[C@H]3[C@H]([C@@]4([H])C[C@@]3(C=C4)[H])C(N)=O)=CC=C21 GLGNXYJARSMNGJ-VKTIVEEGSA-N 0.000 claims description 2
- IUSARDYWEPUTPN-OZBXUNDUSA-N (2r)-n-[(2s,3r)-4-[[(4s)-6-(2,2-dimethylpropyl)spiro[3,4-dihydropyrano[2,3-b]pyridine-2,1'-cyclobutane]-4-yl]amino]-3-hydroxy-1-[3-(1,3-thiazol-2-yl)phenyl]butan-2-yl]-2-methoxypropanamide Chemical compound C([C@H](NC(=O)[C@@H](C)OC)[C@H](O)CN[C@@H]1C2=CC(CC(C)(C)C)=CN=C2OC2(CCC2)C1)C(C=1)=CC=CC=1C1=NC=CS1 IUSARDYWEPUTPN-OZBXUNDUSA-N 0.000 claims description 2
- STBLNCCBQMHSRC-BATDWUPUSA-N (2s)-n-[(3s,4s)-5-acetyl-7-cyano-4-methyl-1-[(2-methylnaphthalen-1-yl)methyl]-2-oxo-3,4-dihydro-1,5-benzodiazepin-3-yl]-2-(methylamino)propanamide Chemical compound O=C1[C@@H](NC(=O)[C@H](C)NC)[C@H](C)N(C(C)=O)C2=CC(C#N)=CC=C2N1CC1=C(C)C=CC2=CC=CC=C12 STBLNCCBQMHSRC-BATDWUPUSA-N 0.000 claims description 2
- QFLWZFQWSBQYPS-AWRAUJHKSA-N (3S)-3-[[(2S)-2-[[(2S)-2-[5-[(3aS,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-[1-bis(4-chlorophenoxy)phosphorylbutylamino]-4-oxobutanoic acid Chemical compound CCCC(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CCCCC1SC[C@@H]2NC(=O)N[C@H]12)C(C)C)P(=O)(Oc1ccc(Cl)cc1)Oc1ccc(Cl)cc1 QFLWZFQWSBQYPS-AWRAUJHKSA-N 0.000 claims description 2
- IWZSHWBGHQBIML-ZGGLMWTQSA-N (3S,8S,10R,13S,14S,17S)-17-isoquinolin-7-yl-N,N,10,13-tetramethyl-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-amine Chemical compound CN(C)[C@H]1CC[C@]2(C)C3CC[C@@]4(C)[C@@H](CC[C@@H]4c4ccc5ccncc5c4)[C@@H]3CC=C2C1 IWZSHWBGHQBIML-ZGGLMWTQSA-N 0.000 claims description 2
- KQZLRWGGWXJPOS-NLFPWZOASA-N 1-[(1R)-1-(2,4-dichlorophenyl)ethyl]-6-[(4S,5R)-4-[(2S)-2-(hydroxymethyl)pyrrolidin-1-yl]-5-methylcyclohexen-1-yl]pyrazolo[3,4-b]pyrazine-3-carbonitrile Chemical compound ClC1=C(C=CC(=C1)Cl)[C@@H](C)N1N=C(C=2C1=NC(=CN=2)C1=CC[C@@H]([C@@H](C1)C)N1[C@@H](CCC1)CO)C#N KQZLRWGGWXJPOS-NLFPWZOASA-N 0.000 claims description 2
- WZZBNLYBHUDSHF-DHLKQENFSA-N 1-[(3s,4s)-4-[8-(2-chloro-4-pyrimidin-2-yloxyphenyl)-7-fluoro-2-methylimidazo[4,5-c]quinolin-1-yl]-3-fluoropiperidin-1-yl]-2-hydroxyethanone Chemical compound CC1=NC2=CN=C3C=C(F)C(C=4C(=CC(OC=5N=CC=CN=5)=CC=4)Cl)=CC3=C2N1[C@H]1CCN(C(=O)CO)C[C@@H]1F WZZBNLYBHUDSHF-DHLKQENFSA-N 0.000 claims description 2
- ONBQEOIKXPHGMB-VBSBHUPXSA-N 1-[2-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy-4,6-dihydroxyphenyl]-3-(4-hydroxyphenyl)propan-1-one Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=CC(O)=C1C(=O)CCC1=CC=C(O)C=C1 ONBQEOIKXPHGMB-VBSBHUPXSA-N 0.000 claims description 2
- TVTJUIAKQFIXCE-HUKYDQBMSA-N 2-amino-9-[(2R,3S,4S,5R)-4-fluoro-3-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-prop-2-ynyl-1H-purine-6,8-dione Chemical compound NC=1NC(C=2N(C(N(C=2N=1)[C@@H]1O[C@@H]([C@H]([C@H]1O)F)CO)=O)CC#C)=O TVTJUIAKQFIXCE-HUKYDQBMSA-N 0.000 claims description 2
- 229940126657 Compound 17 Drugs 0.000 claims description 2
- 239000004471 Glycine Substances 0.000 claims description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 2
- 150000004982 aromatic amines Chemical class 0.000 claims description 2
- 150000001576 beta-amino acids Chemical class 0.000 claims description 2
- 210000004899 c-terminal region Anatomy 0.000 claims description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 claims description 2
- 229940125758 compound 15 Drugs 0.000 claims description 2
- 229940126142 compound 16 Drugs 0.000 claims description 2
- 229940125782 compound 2 Drugs 0.000 claims description 2
- 229940125851 compound 27 Drugs 0.000 claims description 2
- 229940125877 compound 31 Drugs 0.000 claims description 2
- 229940125878 compound 36 Drugs 0.000 claims description 2
- 229940125807 compound 37 Drugs 0.000 claims description 2
- 125000005241 heteroarylamino group Chemical group 0.000 claims description 2
- 238000011065 in-situ storage Methods 0.000 claims description 2
- 239000004310 lactic acid Substances 0.000 claims description 2
- 235000014655 lactic acid Nutrition 0.000 claims description 2
- LWMPFIOTEAXAGV-UHFFFAOYSA-N piperidin-1-amine Chemical compound NN1CCCCC1 LWMPFIOTEAXAGV-UHFFFAOYSA-N 0.000 claims description 2
- 150000003140 primary amides Chemical group 0.000 claims description 2
- 229930195734 saturated hydrocarbon Natural products 0.000 claims description 2
- 150000003573 thiols Chemical group 0.000 claims description 2
- 150000002923 oximes Chemical class 0.000 claims 5
- 230000002209 hydrophobic effect Effects 0.000 claims 1
- ABABQFDOYCEIRS-UHFFFAOYSA-N piperidin-2-ylidenemethanone Chemical compound O=C=C1CCCCN1 ABABQFDOYCEIRS-UHFFFAOYSA-N 0.000 claims 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical group C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 claims 1
- 125000000101 thioether group Chemical group 0.000 claims 1
- 206010012601 diabetes mellitus Diseases 0.000 abstract description 33
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 abstract description 23
- 102100040918 Pro-glucagon Human genes 0.000 abstract description 22
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 abstract description 14
- 229960004666 glucagon Drugs 0.000 abstract description 12
- 108060003199 Glucagon Proteins 0.000 abstract description 11
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 8
- 238000001727 in vivo Methods 0.000 abstract description 6
- 208000030159 metabolic disease Diseases 0.000 abstract description 5
- 230000004913 activation Effects 0.000 abstract description 4
- 101800001388 Oxyntomodulin Proteins 0.000 abstract description 3
- 230000009977 dual effect Effects 0.000 abstract description 3
- 102400000319 Oxyntomodulin Human genes 0.000 abstract description 2
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 abstract 1
- 102400000321 Glucagon Human genes 0.000 abstract 1
- 230000000694 effects Effects 0.000 description 95
- 230000004580 weight loss Effects 0.000 description 56
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 36
- 235000021050 feed intake Nutrition 0.000 description 35
- 239000008103 glucose Substances 0.000 description 35
- 210000004369 blood Anatomy 0.000 description 33
- 239000008280 blood Substances 0.000 description 33
- 230000037396 body weight Effects 0.000 description 32
- 102100040890 Glucagon receptor Human genes 0.000 description 22
- 241000699670 Mus sp. Species 0.000 description 22
- 108010063919 Glucagon Receptors Proteins 0.000 description 21
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 21
- 230000001186 cumulative effect Effects 0.000 description 21
- DLSWIYLPEUIQAV-UHFFFAOYSA-N Semaglutide Chemical compound CCC(C)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(O)=O)NC(=O)C(CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CCC(NC(=O)CCCCCCCCCCCCCCCCC(O)=O)C(O)=O)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CCC(N)=O)NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(C)(C)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)O)C(C)C)C(=O)NC(C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O DLSWIYLPEUIQAV-UHFFFAOYSA-N 0.000 description 19
- 108010060325 semaglutide Proteins 0.000 description 19
- 229950011186 semaglutide Drugs 0.000 description 19
- 238000002474 experimental method Methods 0.000 description 17
- 238000011156 evaluation Methods 0.000 description 15
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 15
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 14
- 108010019598 Liraglutide Proteins 0.000 description 14
- 125000003275 alpha amino acid group Chemical group 0.000 description 14
- WWTBZEKOSBFBEM-SPWPXUSOSA-N (2s)-2-[[2-benzyl-3-[hydroxy-[(1r)-2-phenyl-1-(phenylmethoxycarbonylamino)ethyl]phosphoryl]propanoyl]amino]-3-(1h-indol-3-yl)propanoic acid Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)O)C(=O)C(CP(O)(=O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1C=CC=CC=1)CC1=CC=CC=C1 WWTBZEKOSBFBEM-SPWPXUSOSA-N 0.000 description 13
- 229940126208 compound 22 Drugs 0.000 description 13
- 239000012153 distilled water Substances 0.000 description 13
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 13
- 229920000053 polysorbate 80 Polymers 0.000 description 13
- 229960002701 liraglutide Drugs 0.000 description 12
- 102000051325 Glucagon Human genes 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 11
- 230000000052 comparative effect Effects 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 235000005911 diet Nutrition 0.000 description 10
- 230000037213 diet Effects 0.000 description 10
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 8
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 description 8
- 230000010933 acylation Effects 0.000 description 8
- 238000005917 acylation reaction Methods 0.000 description 8
- 239000002904 solvent Substances 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 7
- 235000020925 non fasting Nutrition 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 0 *C(C(CC1)CCC1C(N)=O)=O Chemical compound *C(C(CC1)CCC1C(N)=O)=O 0.000 description 6
- SJRJJKPEHAURKC-UHFFFAOYSA-N N-Methylmorpholine Chemical compound CN1CCOCC1 SJRJJKPEHAURKC-UHFFFAOYSA-N 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000002265 prevention Effects 0.000 description 6
- 230000001603 reducing effect Effects 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- YEKUUBPJRPXMBM-PTCFZACGSA-N (2S)-5-[[(5S)-5-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-6-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-carbamimidamido-1-[[(2S)-1-[[(2S)-5-carbamimidamido-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-carboxy-1-[[(2S)-1-[[2-(carboxymethylamino)-2-oxoethyl]amino]-1-oxopropan-2-yl]amino]-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-6-oxohexyl]amino]-2-(hexadecanoylamino)-5-oxopentanoic acid Chemical compound CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(=O)NCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1c[nH]cn1)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)NCC(O)=O)C(O)=O YEKUUBPJRPXMBM-PTCFZACGSA-N 0.000 description 5
- 238000011740 C57BL/6 mouse Methods 0.000 description 5
- 210000000577 adipose tissue Anatomy 0.000 description 5
- 230000001276 controlling effect Effects 0.000 description 5
- 229940121426 cotadutide Drugs 0.000 description 5
- 108091005205 cotadutide Proteins 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000004060 metabolic process Effects 0.000 description 5
- 125000006239 protecting group Chemical group 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 4
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 235000012631 food intake Nutrition 0.000 description 4
- 230000037406 food intake Effects 0.000 description 4
- 235000009200 high fat diet Nutrition 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000003914 insulin secretion Effects 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 239000013585 weight reducing agent Substances 0.000 description 4
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 108090000331 Firefly luciferases Proteins 0.000 description 3
- 102000017011 Glycated Hemoglobin A Human genes 0.000 description 3
- 102000015779 HDL Lipoproteins Human genes 0.000 description 3
- 108010010234 HDL Lipoproteins Proteins 0.000 description 3
- OPFJDXRVMFKJJO-ZHHKINOHSA-N N-{[3-(2-benzamido-4-methyl-1,3-thiazol-5-yl)-pyrazol-5-yl]carbonyl}-G-dR-G-dD-dD-dD-NH2 Chemical compound S1C(C=2NN=C(C=2)C(=O)NCC(=O)N[C@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC(O)=O)C(N)=O)=C(C)N=C1NC(=O)C1=CC=CC=C1 OPFJDXRVMFKJJO-ZHHKINOHSA-N 0.000 description 3
- 108010052090 Renilla Luciferases Proteins 0.000 description 3
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 3
- 229940126086 compound 21 Drugs 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 150000003626 triacylglycerols Chemical class 0.000 description 3
- UAOUIVVJBYDFKD-XKCDOFEDSA-N (1R,9R,10S,11R,12R,15S,18S,21R)-10,11,21-trihydroxy-8,8-dimethyl-14-methylidene-4-(prop-2-enylamino)-20-oxa-5-thia-3-azahexacyclo[9.7.2.112,15.01,9.02,6.012,18]henicosa-2(6),3-dien-13-one Chemical compound C([C@@H]1[C@@H](O)[C@@]23C(C1=C)=O)C[C@H]2[C@]12C(N=C(NCC=C)S4)=C4CC(C)(C)[C@H]1[C@H](O)[C@]3(O)OC2 UAOUIVVJBYDFKD-XKCDOFEDSA-N 0.000 description 2
- BQXUPNKLZNSUMC-YUQWMIPFSA-N CCN(CCCCCOCC(=O)N[C@H](C(=O)N1C[C@H](O)C[C@H]1C(=O)N[C@@H](C)c1ccc(cc1)-c1scnc1C)C(C)(C)C)CCOc1ccc(cc1)C(=O)c1c(sc2cc(O)ccc12)-c1ccc(O)cc1 Chemical compound CCN(CCCCCOCC(=O)N[C@H](C(=O)N1C[C@H](O)C[C@H]1C(=O)N[C@@H](C)c1ccc(cc1)-c1scnc1C)C(C)(C)C)CCOc1ccc(cc1)C(=O)c1c(sc2cc(O)ccc12)-c1ccc(O)cc1 BQXUPNKLZNSUMC-YUQWMIPFSA-N 0.000 description 2
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 2
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 2
- 229920002527 Glycogen Polymers 0.000 description 2
- RPTUSVTUFVMDQK-UHFFFAOYSA-N Hidralazin Chemical compound C1=CC=C2C(NN)=NN=CC2=C1 RPTUSVTUFVMDQK-UHFFFAOYSA-N 0.000 description 2
- 101000788682 Homo sapiens GATA-type zinc finger protein 1 Proteins 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 208000001145 Metabolic Syndrome Diseases 0.000 description 2
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 2
- 208000006011 Stroke Diseases 0.000 description 2
- 206010047700 Vomiting Diseases 0.000 description 2
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 238000011888 autopsy Methods 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 235000019577 caloric intake Nutrition 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 208000016097 disease of metabolism Diseases 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000032050 esterification Effects 0.000 description 2
- 238000005886 esterification reaction Methods 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 108091005995 glycated hemoglobin Proteins 0.000 description 2
- 229940096919 glycogen Drugs 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- 150000002430 hydrocarbons Chemical class 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- IOMMMLWIABWRKL-WUTDNEBXSA-N nazartinib Chemical compound C1N(C(=O)/C=C/CN(C)C)CCCC[C@H]1N1C2=C(Cl)C=CC=C2N=C1NC(=O)C1=CC=NC(C)=C1 IOMMMLWIABWRKL-WUTDNEBXSA-N 0.000 description 2
- 239000000813 peptide hormone Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 108090000623 proteins and genes Proteins 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 230000008673 vomiting Effects 0.000 description 2
- 230000004584 weight gain Effects 0.000 description 2
- 235000019786 weight gain Nutrition 0.000 description 2
- AFVLVVWMAFSXCK-UHFFFAOYSA-N α-cyano-4-hydroxycinnamic acid Chemical compound OC(=O)C(C#N)=CC1=CC=C(O)C=C1 AFVLVVWMAFSXCK-UHFFFAOYSA-N 0.000 description 2
- ASGMFNBUXDJWJJ-JLCFBVMHSA-N (1R,3R)-3-[[3-bromo-1-[4-(5-methyl-1,3,4-thiadiazol-2-yl)phenyl]pyrazolo[3,4-d]pyrimidin-6-yl]amino]-N,1-dimethylcyclopentane-1-carboxamide Chemical compound BrC1=NN(C2=NC(=NC=C21)N[C@H]1C[C@@](CC1)(C(=O)NC)C)C1=CC=C(C=C1)C=1SC(=NN=1)C ASGMFNBUXDJWJJ-JLCFBVMHSA-N 0.000 description 1
- OYXZPXVCRAAKCM-SANMLTNESA-N (2s)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-(1-tritylimidazol-4-yl)propanoic acid Chemical compound C1=NC(C[C@H](NC(=O)OC(C)(C)C)C(O)=O)=CN1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)C1=CC=CC=C1 OYXZPXVCRAAKCM-SANMLTNESA-N 0.000 description 1
- VXGGBPQPMISJCA-STQMWFEESA-N (2s)-2-[[(2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)propanoyl]amino]propanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O)C3=CC=CC=C3C2=C1 VXGGBPQPMISJCA-STQMWFEESA-N 0.000 description 1
- IMIVWAUMTAIVPJ-XUXIUFHCSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-azaniumyl-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-4-methylpentanoate Chemical compound CC(C)C[C@H]([NH3+])C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@H](C([O-])=O)CC(C)C IMIVWAUMTAIVPJ-XUXIUFHCSA-N 0.000 description 1
- HUWSZNZAROKDRZ-RRLWZMAJSA-N (3r,4r)-3-azaniumyl-5-[[(2s,3r)-1-[(2s)-2,3-dicarboxypyrrolidin-1-yl]-3-methyl-1-oxopentan-2-yl]amino]-5-oxo-4-sulfanylpentane-1-sulfonate Chemical compound OS(=O)(=O)CC[C@@H](N)[C@@H](S)C(=O)N[C@@H]([C@H](C)CC)C(=O)N1CCC(C(O)=O)[C@H]1C(O)=O HUWSZNZAROKDRZ-RRLWZMAJSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- YSUIQYOGTINQIN-UZFYAQMZSA-N 2-amino-9-[(1S,6R,8R,9S,10R,15R,17R,18R)-8-(6-aminopurin-9-yl)-9,18-difluoro-3,12-dihydroxy-3,12-bis(sulfanylidene)-2,4,7,11,13,16-hexaoxa-3lambda5,12lambda5-diphosphatricyclo[13.2.1.06,10]octadecan-17-yl]-1H-purin-6-one Chemical compound NC1=NC2=C(N=CN2[C@@H]2O[C@@H]3COP(S)(=O)O[C@@H]4[C@@H](COP(S)(=O)O[C@@H]2[C@@H]3F)O[C@H]([C@H]4F)N2C=NC3=C2N=CN=C3N)C(=O)N1 YSUIQYOGTINQIN-UZFYAQMZSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 208000004611 Abdominal Obesity Diseases 0.000 description 1
- 206010000060 Abdominal distension Diseases 0.000 description 1
- 241000220479 Acacia Species 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 206010065941 Central obesity Diseases 0.000 description 1
- 229940126639 Compound 33 Drugs 0.000 description 1
- 229940127007 Compound 39 Drugs 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 208000032928 Dyslipidaemia Diseases 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 1
- 108010011459 Exenatide Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229940123232 Glucagon receptor agonist Drugs 0.000 description 1
- 108010014663 Glycated Hemoglobin A Proteins 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 101500028775 Homo sapiens Glucagon Proteins 0.000 description 1
- 101001040075 Homo sapiens Glucagon receptor Proteins 0.000 description 1
- 101001015516 Homo sapiens Glucagon-like peptide 1 receptor Proteins 0.000 description 1
- KTGFOCFYOZQVRJ-ZKWXMUAHSA-N Ile-Glu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O KTGFOCFYOZQVRJ-ZKWXMUAHSA-N 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 208000017170 Lipid metabolism disease Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 102000035554 Proglucagon Human genes 0.000 description 1
- 108010058003 Proglucagon Proteins 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- PNUZDKCDAWUEGK-CYZMBNFOSA-N Sitafloxacin Chemical compound C([C@H]1N)N(C=2C(=C3C(C(C(C(O)=O)=CN3[C@H]3[C@H](C3)F)=O)=CC=2F)Cl)CC11CC1 PNUZDKCDAWUEGK-CYZMBNFOSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- OGWAVGNOAMXIIM-UHFFFAOYSA-N albiglutide Chemical compound O=C(O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(N)CC=1(N=CNC=1))CCC(=O)O)C(O)C)CC2(=CC=CC=C2))C(O)C)CO)CC(=O)O)C(C)C)CO)CO)CC3(=CC=C(O)C=C3))CC(C)C)CCC(=O)O)CCC(=O)N)C)C)CCCCN)CCC(=O)O)CC4(=CC=CC=C4))C(CC)C)C)CC=6(C5(=C(C=CC=C5)NC=6)))CC(C)C)C(C)C)CCCCN)CCCNC(=N)N OGWAVGNOAMXIIM-UHFFFAOYSA-N 0.000 description 1
- 229960004733 albiglutide Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 150000001371 alpha-amino acids Chemical class 0.000 description 1
- 235000008206 alpha-amino acids Nutrition 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 230000004596 appetite loss Effects 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 230000003143 atherosclerotic effect Effects 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 229940126540 compound 41 Drugs 0.000 description 1
- 229940125898 compound 5 Drugs 0.000 description 1
- 238000011970 concomitant therapy Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 230000000857 drug effect Effects 0.000 description 1
- 229960005175 dulaglutide Drugs 0.000 description 1
- 108010005794 dulaglutide Proteins 0.000 description 1
- 238000005265 energy consumption Methods 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 229960001519 exenatide Drugs 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 208000010706 fatty liver disease Diseases 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 208000020694 gallbladder disease Diseases 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000009229 glucose formation Effects 0.000 description 1
- 230000010030 glucose lowering effect Effects 0.000 description 1
- 230000004153 glucose metabolism Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 229960002474 hydralazine Drugs 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 208000006575 hypertriglyceridemia Diseases 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 150000002596 lactones Chemical group 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- RENRQMCACQEWFC-UGKGYDQZSA-N lnp023 Chemical compound C1([C@H]2N(CC=3C=4C=CNC=4C(C)=CC=3OC)CC[C@@H](C2)OCC)=CC=C(C(O)=O)C=C1 RENRQMCACQEWFC-UGKGYDQZSA-N 0.000 description 1
- 208000019017 loss of appetite Diseases 0.000 description 1
- 235000021266 loss of appetite Nutrition 0.000 description 1
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 230000006371 metabolic abnormality Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000013365 molecular weight analysis method Methods 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- CMWYAOXYQATXSI-UHFFFAOYSA-N n,n-dimethylformamide;piperidine Chemical compound CN(C)C=O.C1CCNCC1 CMWYAOXYQATXSI-UHFFFAOYSA-N 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 230000003880 negative regulation of appetite Effects 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 125000004430 oxygen atom Chemical group O* 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 230000037081 physical activity Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000007943 positive regulation of appetite Effects 0.000 description 1
- 230000000291 postprandial effect Effects 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- MCJGNVYPOGVAJF-UHFFFAOYSA-N quinolin-8-ol Chemical compound C1=CN=C2C(O)=CC=CC2=C1 MCJGNVYPOGVAJF-UHFFFAOYSA-N 0.000 description 1
- 108700027806 rGLP-1 Proteins 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 230000036186 satiety Effects 0.000 description 1
- 235000019627 satiety Nutrition 0.000 description 1
- 229940118080 saxenda Drugs 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 201000002859 sleep apnea Diseases 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 231100000240 steatosis hepatitis Toxicity 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 125000004434 sulfur atom Chemical group 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- HNKJADCVZUBCPG-UHFFFAOYSA-N thioanisole Chemical compound CSC1=CC=CC=C1 HNKJADCVZUBCPG-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229940007428 victoza Drugs 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- the present invention relates to a pharmaceutical composition which can be used for the prophylaxis or treatment of oxytocmodulin peptide analogues and non-insulin dependent diabetes mellitus including obesity, overweight, or concomitant therapies.
- Metabolic Disease is a disease caused by metabolic abnormalities such as glucose, fat, and protein. It is mainly caused by abnormalities of glucose and fat metabolism, cancer, diabetes, bone metabolic diseases, fatty liver, obesity and cardiovascular diseases. Collectively. The criteria for the diagnosis of metabolic diseases according to the International Diabetes Federation (IDF), published in 2001, in the US National Cholesterol Education Program (NCEP) adult treatment panel III (ATP III) As follows.
- the worldwide prevalence of obesity has more than doubled between 1980 and 2014, and in 2014, 39% of adults over age 18 (38% of men and 40% of women) , 13% (male 11%, female 15%) were obese.
- the main causes of obesity and overweight are energy inequalities between caloric intake and consumption, which result in a decrease in physical activity due to high fat, high-energy diet, modern social work, changes in transportation, It is considered a risk factor.
- the prevalence of diabetes also increased rapidly from 4.7% in 1980 to 8.5% in 2015 among adults over 18 years of age. Diabetes mellitus prevalence is growing more rapidly in middle-income and low-income countries and is a major cause of blindness, kidney failure, heart attack, and stroke.
- Glucagon is a hormone produced by the alpha cells of the pancreas. It plays an important role in increasing blood sugar by decomposing glycogen stored in the liver and glucose synthesis in the liver. When the stored glycogen is depleted, glucagon causes the liver and kidney to synthesize glucose, It is known that appetite suppression and decomposition of stored triglycerides into fatty acids have an effect on weight loss by increasing energy metabolism (Diabetes.co.uk., Global Diabetes Community, Anim Sci. 9): 1090-1098).
- GLP-1 Glucagon-like peptide-1
- GLP-1 is one of the glucagon derivatives and is a peptide hormone that plays a role in reducing blood sugar. It is secreted by the L-cells of the small intestine and has a half-life of less than 2 minutes. When the secretion is increased by glucose, it induces insulin secretion in pancreatic beta cells, ultimately controlling blood glucose and improving beta cell function . It also has the function of inhibiting glucagon secretion, inhibiting gastric emptying, and reducing food intake (Physiol Rev. 2007; 87 (4): 1409-1439).
- Liraglutide is a human GLP-1 derivative that is injected once a day as a treatment for the development of type 2 diabetes and obesity indications.
- Liraglutide is a persistent GLP-1 receptor agonist that binds to the same receptor as endogenous GLP-1 to promote glucose-dependent insulin secretion, thereby regulating blood sugar, reducing appetite, inhibiting weight gain and lowering triglycerides. Victoza for obesity and Saxenda for obesity (Expert Rev Cardiovasc Ther. 2015; 13 (7): 753-767).
- Exenatide Lixisenatie, albiglutide and dulaglutide have been developed for the treatment of diabetes.
- side effects of these GLP-1 receptor agonists have been reported to include nausea, vomiting and loss of appetite, headache and constipation, and the occurrence of abdominal distension (Korean J Med. 2014; 87 (1): 9-13).
- Oxytomodulin is a peptide derived from proglucagon, a precursor of glucagon. It is composed of 37 amino acid peptides containing the complete 29 amino acid sequence of glucagon. It has a double action binding to both GLP-1 and glucagon receptors Respectively. This effect of oxytomodulin is known to be superior to that of selective GLP-1 receptor agonists, and the risk of hyperglycemia due to glucose uptake due to glucagon receptor activation is also increased The insulin secretion by the GLP-1 receptor has been reported to be able to regulate blood glucose. Oxytomodulin has been reported to improve feed intake, weight loss and energy expenditure and glucose metabolism in nonclinical studies (Diabetes.
- a DPP-IV resistant oxytomodulin derivative capable of selectively binding GLP-1 and glucagon receptors in a balanced manner to overcome the adverse effects of each hormone peptide for a prolonged period of action of oxytomodulin in pharmacological and therapeutic aspects (Diabetes. 2009; 58 (10): 2258-2266), the development of leading substances in various companies such as Merck, Zealand, Medimmune, It is in progress.
- the present invention provides a method for producing a compound of the present invention, which comprises: (1) providing resistance to DPP-IV; (2) optimizing metabolic stability by acylation; (3) synthesizing GLP-1 and glucagon receptors
- the present invention relates to a therapeutic pharmaceutical composition for use in the treatment of diabetes accompanied by obesity or obesity through the development of auxin to modulin peptide analogues.
- an oxytocmodulin analog and a pharmaceutical composition comprising the same, which can be used in the prevention or treatment of conditions caused or characterized by obesity or overweight, or non-insulin dependent diabetes accompanied by them, by providing a tomodulin peptide analogue will be.
- the present invention provides a novel peptide comprising an amino acid sequence of the following formula I, which is an oxytomodulin peptide analogue.
- X 1 is Ser or Aib (aminoisobutyric acid);
- X 2 is Asp or Z
- X 3 is Tyr or Z
- X 4 is Ser or Z
- X 5 is Lys or Z
- X 6 is Tyr or Z
- X 7 is Leu or Z
- X 8 is Asp or Z
- X 9 is Ser, Aib (aminoisobutyric acid) or Z;
- X 10 is Gln or Z
- X 11 is Met or Leu
- X 12 is Asn or Arg
- X 13 is Thr or Ala
- X 14 is Lys or Z
- X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
- X < 16 > is Z or absent when X < 15 > is present;
- the C-terminal amino acid may optionally be amidated
- X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14 or X 16 is Z;
- Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z < 1 & gt ;, Z & lt ; 1 > is the following structural formula (1)
- Z 2 is the following structural formula (3) or (4).
- " oxyntomodulin " in the present invention means a peptide made from pre-glucagon, which is a precursor of glucagon, and the native oxytomodulin means an amino acid sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO.1) .
- Z 1 which is one of the constituents of Z, is a copolymer having a polymeric portion as polyethylene glycol, a monomer having ethylene glycol, ethanolamine, lactic acid, or a polyamino acid copolymer having glycine and serine as monomers
- the poly-amino acid may be the amino acid sequence of GGSGSG (SEQ ID NO. 52), and the compound of the present invention may have two or more repeating units of the polymeric moiety.
- Z 1 may have at one end any moiety of the above-described oxynthomodulin peptide analog or a functional group for attachment to its side chain.
- an acyl group which in this case may be attached in the form of an amide bond to the amino group of the side chain
- Z 1 may have a functional group for bonding to the spacer at one end.
- an amino group in which case it may be attached in the form of an amide bond to the carboxyl group of the spacer
- Z 1 is preferably water-soluble and thus may be amphipathic or hydrophilic.
- the spacer is an L- glutamic acid residues
- the carboxylic acid is ⁇ - polymeric part of Z 1 and covalent bonds
- ⁇ - amino group may be part of the lipophilic lipid
- Z 2 is a covalent bond, at least two repeating units Lt; / RTI >
- the lipid moiety of Z 2 is directly conjugated to the spacer, the spacer is conjugated directly to the polymeric moiety, and the polymeric moiety is linked to the X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14, or X 16 , and preferably the junction Lys may be introduced as an enabling amino acid residue.
- Z 2 is a peptide derivative comprising a C 14 -C 20 saturated hydrocarbon chain, wherein the terminal carbon of the hydrocarbon chain is in a carboxylic acid form, a primary amide form, or a carboxylic acid form covalently linked to any single amino acid.
- the hydrocarbon chain may be branched or straight.
- the functional group necessary for attaching the hydrocarbon chain to the spacer forms a part of the lipid moiety mentioned above and may include an acyl group, a sulfonyl group, an N atom, an O atom, an S atom, and the like.
- the spacer attachment can be via an ester, a sulfonyl ester, a thioester, an amide or a sulfonamide.
- the hydrocarbon chain is bonded to the amino group of the spacer in the form of an amide bond through an acyl group, and thus the hydrocarbon chain may be part of the form of an alkanoyl group in particular.
- the lipophilic lipid moiety binds to albumin in the blood stream, thereby preventing the compound of the present invention from reacting as a substrate for various degrading enzymes in the bloodstream, thereby improving its in vivo half-life ≪ / RTI >
- one or more amino acid side chains in an oxytomodulin peptide analogue are conjugated to a lipophilic lipid moiety through a polymeric moiety and a spacer, such chemical modification being dependent on the in vivo solubility and / or hydrophobicity of the oxytocmodulin peptide derivative of the present invention It is possible to induce a pharmacologically favorable effect such as increasing half-life and / or increasing bioavailability.
- novel peptide comprising the amino acid sequence of the above Formula I can be prepared by substituting Aib for the Ser residue present at the 2-position of the native type auxin tomodulin.
- a compound as given in the embodiments of the present invention auxin Sat module Lin peptide analogs as if Aib is introduced into X 1 position, to have greater resistance to dipeptidyl peptidase IV as compared to auxin Sat module lean natural It is considered.
- the oxytocmodulin peptide analogues of the present invention have improved in vivo stability compared to the native oxytomodulin.
- the acylated oxytomodulin peptide analogue according to the present invention can be obtained by substituting Leu for the Met residue at position 27 of the native oxytomodulin and substituting Leu for the Asn residue at position 28 with Arg time to can be prepared substituting a Thr residue present in the Ala position, to an example of embodiments compound 12 for (SEQ ID NO. 13), X 11 position Leu, the X 12 position Arg, X 13 position With Ala.
- the oxytocmodulin peptide derivative preferred in the present invention is a novel peptide comprising the amino acid sequence of the following formula (I-1).
- X 1 is Ser or Aib (aminoisobutyric acid);
- X 3 is Tyr or Z
- X 9 is Ser, Aib or Z
- X 10 is Gln or Z
- X 11 is Met or Leu
- X 12 is Asn or Arg
- X 13 is Thr or Ala
- X 14 is Lys or Z
- X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
- X 16 is Z or absent when X 15 is present, the C-terminal can be amidated
- Embodiments comprising the peptide analog of Formula I above include Compound 1 (SEQ ID NO. 2), Compound 2 (SEQ ID NO. 3), Compound 3 (SEQ ID NO. 4), Compound 4 (SEQ ID NO. 5), Compound 5 (SEQ ID NO. 6), Compound 6 (SEQ ID NO. 7), Compound 7 (SEQ ID NO. 8), Compound 8 (SEQ ID NO. 10), Compound 10 (SEQ ID NO. 11), Compound 11 (SEQ ID NO. 12), Compound 12 (SEQ ID NO. 13), Compound 13 (SEQ ID NO. 14), Compound 15 (SEQ ID NO. 16), Compound 16 (SEQ ID NO. 17), Compound 17 (SEQ ID NO. 18), Compound 18 (SEQ ID NO.
- the oxytocmodulin peptide analogue of formula (I) according to the present invention may include one or more intramolecular crosslinks in the amino acid sequence, that is, X 9 and X 10 may be linked by an intramolecular bond (lactamation, di- linkers to form cyclic peptides.
- X 17 is Ser or Aib (Aminoisobutric acid);
- X 18 is Z
- X 19 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
- X 20 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
- X 19 and X 20 can form a cyclic peptide through an intramolecular bond or a cross linker, wherein the cyclic peptide has a lactam ring formed by an amide bond between two residues, or a di-sulfide bond between two residues A peptide with a cross-linked ring formed by a cross-linker bond between the formed di-sulfide ring or two residues;
- the C-terminal amino acid may be amidated in situ
- Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z < 1 & gt ;, Z & lt ; 1 > is the following structural formula (1)
- Z 2 is the following structural formula (3) or (4).
- Bond in the molecule of X 19 and X 20 is X 19 and X 20 each Asp (or Glu) and Lys (or Orn) when the or each Lys (or Orn) and Asp (or Glu) when a bond in the lactam ring formation molecular ;
- An intramolecular di-sulfide ring forming bond when X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively;
- X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively, the cross linker is bonded to the thiol functional group of both Cys (or Hcy) side chains to form a ring, C 1 -C 6 straight or branched chain alkyl, C 3 -C 8 saturated or unsaturated cycloalkyl, C 6 -C 10 aryl, or C 5 -C 12 heteroaryl or fused heterocyclic aryl,
- R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
- the cross linker forms a ring with the amide bond to the carboxyl group of both Asp (or Glu) side chains, Di-amino C 1 -C 6 straight or branched chain alkyl, di-amino C 3 -C 8 saturated or unsaturated cycloalkyl, aminopiperidine, piperazine, di-amino C 6 -C 10 aryl, or di-amino C 5 -C 12 heteroaryl or fused heterocyclic aryl,
- R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
- R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
- the cross linker is the carboxyl group of the Asp
- the amine group of the side chain of Lys (or Orn) is connected to the carboxyl group of the cross linker by an amide bond to form a ring, and the cross linker ) May be selected from the group consisting of alpha amino acids (Gly, VaI, Leu, Ile, etc.), beta amino acids, carbonyl C 1 -C 6 linear or branched alkylamines, carbonyl C 3 -C 8 saturated or unsaturated alkylamines, , Aminobenzoyl, carbonyl C 6 -C 10 arylamine or carbonyl C 5 -C 12 heteroarylamine or fused heterocyclic arylamine, preferably
- R is hydrogen or C 1 -C 6 linear or branched alkyl.
- Examples of embodiments that include peptide analogs of Formula II that may have one or more intramolecular bridging within the amino acid sequence of Formula I include Compound 14 (SEQ ID NO. 15), Compound 19 (SEQ ID NO. 20), Compound 20 (SEQ ID NO. 21), compound 21 (SEQ ID NO. 22), compound 22 (SEQ ID NO. 23), compound 23 (SEQ ID NO. 26), Compound 27 (SEQ ID NO. 28), Compound 28 (SEQ ID NO. 29), Compound 29 (SEQ ID NO. (SEQ ID NO. 32), Compound 32 (SEQ ID NO. 33), Compound 33 (SEQ ID NO. 34), Compound 34 (SEQ ID NO. (SEQ ID NO. 37), compound 37 (SEQ ID NO. 38), compound 38 (SEQ ID NO.
- the cross-linking of the peptide of formula (II) may be carried out by chemical covalent bonding between any two functional groups in a residue or side chain of two arbitrary amino acids separated by three amino acids in the sequence of formula (I) Lt; / RTI >
- the amino acid side chains of the X 19 residue and the X 20 residue are cross-linked while forming a lactone ring, lactam ring or di-sulfide ring, and the amino acid side chain of the X 19 residue and the X 20 residue is cross- linker may be formed by forming a ring through the connection of the linker.
- novel peptide comprising the amino acid sequence of the above formula (II) can be obtained by substituting Cys or Hcy for the Ser residue present at position 16 of the natural aroma oxytomodulin and replacing the Gln residue at position 20 with Cys or Hcy (SEQ ID NO. 29) in the following embodiments, substituting Cys at position X 19 and Cys at position X 20 to form a di-sulfide ring in the molecule. to form a di-sulfide ring.
- acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Cys or Hcy for the Ser residue present at position 16 of the natural incoicotomodulin and substituting Cys or Gln for the Gln residue at position 20 (SEQ ID NO: 23) in the following embodiments, the X 19 position may be replaced by Cys, X may be replaced with Cys, 20 position to Cys and then connecting the two residues with a cross linker to form a ring.
- acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 27), substituting Asp for the position of X 19 and Lys for the position of X 20 in the case of Compound 26 (SEQ ID NO. 27) in the following embodiments, (SEQ ID NO. 25), compound 20 (SEQ ID NO. 21), compound 24 (SEQ ID NO. 25) , Compound 25 (SEQ ID NO. 26) can be prepared by replacing the X 19 position with Glu and the X 20 position with Lys to form a lactam ring in the molecule.
- acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 38), compound 38 (SEQ ID NO. 39) in the following embodiments, and the like can be produced by forming a ring by linking two residues with a cross linker after substitution with Orn.
- SEQ ID NO. 34 Compound 34 (SEQ ID NO. 34), and Compound 34 (SEQ ID NO. 34) can be prepared by substituting Asp for the position of X 19 and Lys for the position of X 20 and then connecting the two residues using a cross linker.
- the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or (SEQ ID NO. 22) in the following embodiments, the X 19 position is replaced with Lys, the X 20 position is replaced with Glu, and the molecule (27) (SEQ ID NO. 28) can be prepared by substituting Lys at position X 19 and Asp at position X 20 to form a lactam ring in the molecule.
- the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or Glu, and then connecting the two residues using a cross linker to form a ring.
- Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin
- the Gln residue at position 20 for Asp or Glu for connecting the two residues using a cross linker to form a ring.
- the X 19 position is substituted with Lys, X 20 position with Glu and then connecting the two residues with a cross linker to form a ring.
- acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Asp or GIu for the Ser residue present at position 16 of the natural flavor oxin tosomandrin, converting the Gln residue at position 20 to Asp (SEQ ID NO. 24), compound 29 (SEQ ID NO. 30) in the following embodiments, and the like.
- Compound 30 (SEQ ID NO: 31) can be prepared by replacing the X 19 position with Glu and the X 20 position with Glu, and then connecting the two residues with a cross linker to form a ring.
- the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for replacing the Gln residue at position 20 with Lys or Orn and then connecting two residues using a cross linker to form a ring.
- Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin
- the Gln residue at position 20 with Lys or Orn
- the X 19 position is substituted with Lys, X 20 position with Lys and then connecting the two residues with a cross linker to form a ring.
- Such intramolecular crosslinking is believed to stabilize the alpha helical structure of the peptide to increase its selectivity or pharmacological efficacy at the GLP-1 receptor and / or glucagon receptor (ACS Chem Biol. 2016; 11: 324-328).
- auxin to moduline peptide analogs of the present invention can be chemically modified.
- each amino acid residue of the peptide can be directly linked to various spacers or linkers, and each residue can undergo chemical reactions such as alkylation, disulfide bond formation, metal complexation, amidation, esterification, oxidation, It can be transformed into a corresponding chemical product.
- any carboxy terminal or amino terminal present in the auxin tomodulin peptide analogue structure of the present invention can be analogized through esterification, amidation, acylation, and the like.
- the oxytomodulin peptide analog of the present invention may be provided as an acid addition salt of any amine group present in its structure or as a carboxylate salt of any carboxyl group or an alkali addition salt thereof.
- the present invention also relates to a pharmaceutical composition for preventing and treating obesity or overweight and accompanying diabetes comprising the peptide analogue as an active ingredient and a pharmaceutically acceptable excipient.
- " prevention " of the present invention means all actions that inhibit or delay the onset of the desired disease.
- " treatment " of the present invention means any action that alleviates, alleviates, or alleviates the symptoms of the disease that has occurred.
- the peptide analogs of the present invention exhibit both the effect of GLP-1 on food intake and the effect of glucagon on fat metabolism and energy consumption as dual agonists for the glucagon receptor and GLP-1 receptor,
- a pharmaceutical composition for the prevention and treatment of obesity or overweight and accompanying diabetes comprising a peptide analogue can induce a medically beneficial effect in the control of body weight through the combined effect of excessive accumulation of fat and inhibition of food intake have.
- the peptide analog of the present invention and the pharmaceutical composition containing the same can be used for prevention or treatment of diabetes accompanied by obesity by reducing blood sugar. It can be used to treat type 2 diabetes, especially non-insulin dependent diabetes mellitus with obesity.
- the pharmaceutical composition comprising the peptide analog of the present invention is one of the glucagon derivatives, and has a high activity on the GLP-1 receptor which plays a role in reducing blood glucose, and is ultimately useful for controlling blood glucose .
- the pharmaceutical compositions comprising the peptide analogs of the present invention are useful for the treatment and prevention of obesity, pathological obesity, preoperative obesity, obesity related inflammation, obesity related gallbladder disease, obesity induced sleep apnea, obesity associated diabetes, As a direct or indirect treatment of any condition caused or characterized by, or in combination with, other related agents.
- the pharmaceutical compositions containing the peptide analogs of the present invention may be used for the treatment of conditions which may result from or be associated with weight gain, such as metabolic syndrome, hypertension, atherosclerotic dyslipidemia, atherosclerosis, arteriosclerosis, Heart disease, or stroke, or may be co-administered with other related agents.
- " administration " means introducing a substance for therapeutic use into a patient in an appropriate manner, and the pharmaceutical composition containing the peptide analog of the present invention can be administered to a patient in a variety of ways May be administered via various routes in the form of a formulation. Intraperitoneal, intravenous, intramuscular, subcutaneous, intradermal, oral, topical, intranasal, intrapulmonary, rectal, and the like, but the formulation and administration method is not limited.
- compositions comprising the oxytomodulin peptide analogs of the present invention may comprise a pharmaceutically acceptable carrier.
- the pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizing agent, a dispersing agent, a stabilizer, a suspending agent, a colorant, a perfume or the like in the case of oral administration.
- a solubilizing agent, an isotonic agent, a stabilizing agent, etc. may be used in combination.
- a base, an excipient, a lubricant, a preservative, etc. may be used in various ways.
- Examples of carriers, excipients and diluents that can be used in the formulation of the oxytomodulin peptide analog of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin , Calcium phosphate, calcium silicate, cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil.
- compositions containing the oxytomodulin peptide analogs of the present invention can be prepared in various manners by mixing with the carriers described above.
- oral administration may be in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc.
- unit dosage ampoules or multiple dosage forms may be prepared.
- it can be formulated into solutions, suspensions, tablets, pills, capsules, sustained release formulations and the like.
- the dosage or dose according to the present invention varies depending on the patient's body weight, age, sex, health condition, diet, excretion rate and severity of the disease, and the dose is 0.001 mg / kg to 500 mg / kg.
- the present invention provides novel acylated oxytomodulin peptide analogs wherein the peptide analogs of the present invention have greater activity against both the GLP-1 receptor and the glucagon receptor than the native oxytomodulin.
- the present invention shows a higher biological activity as a glucagon receptor agonist compared to the GLP-1 receptor.
- the present invention provides a pharmaceutical composition comprising a novel acylated auxin tomodulin peptide analogue, which is useful primarily in the prevention or treatment of conditions caused or characterized by obesity or overweight, and further, May also be used for the purpose of preventing or treating the accompanying non-insulin dependent diabetes mellitus.
- FIG. 1 is a graph showing the effect of the acylated oxytomodulin analogues of the present invention on the single- Fig.
- FIG. 2 is a graph showing the results of evaluating the effects of acylated oxytomodulin peptide analogues of the present invention on the reduction of weight loss for one week in a mouse.
- FIG. 2a is a graph showing weight loss results and
- FIG. 2b is a graph showing cumulative feed intake results.
- FIG. 3 is a graph showing the result of 5-day repeated weight loss effect evaluation of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 3 a is a graph showing weight loss results and FIG. 3 b is a graph showing cumulative feed intake results.
- FIG. 4 is a graph showing the result of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 4A is a graph showing weight loss results and FIG. 4B is a graph showing cumulative feed intake results.
- FIG. 5 is a graph showing the results of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 5A is a graph showing weight loss results and FIG. 5B is a graph showing cumulative feed intake results.
- FIG. 6 is a graph showing the result of evaluating the effect of acylated oxytomodulin peptide analogue of the present invention on the reduction of weight loss for one week in a mouse.
- FIG. 6A is a graph showing weight loss results and
- FIG. 6B is a graph showing cumulative feed intake results.
- FIG. 7 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the weight reduction effect for two weeks in a mouse, wherein FIGS. 7A and 7C are weight loss results, and FIG. FIG. 7D is a graph showing cumulative feed intake results of acylated auxin tomodulin peptide analogues shown in FIG. 7C. FIG. 7D is a graph showing cumulative feed intake results of actual oxyntomodulin peptide analogues.
- FIG. 8 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the reduction of weight loss for two weeks in a mouse.
- FIG. 8A is a graph showing weight loss results
- FIG. 8B is a graph showing cumulative feed intake results.
- FIG. 9 is a graph showing the result of 5-day repeated weight loss effect evaluation in mice of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 9A is a graph showing weight loss results and FIG. 9B is a graph showing cumulative feed intake results.
- FIG. 10 is a graph showing the result of weight loss reduction effect evaluation of the acylated oxytomodulin peptide analogue according to the present invention for 4 weeks in a mouse, wherein FIG. 10A is a weight loss result, FIG. 10B is a body fat reduction result, Fig.
- FIG. 11 is a graph showing the results of assaying the potency of acylated oxytomodulin peptide analogues in the mouse according to the present invention.
- FIG. 12 is a graph showing the results of evaluating the blood glucose-modulating effect of the acylated oxytomodulin peptide analogue according to the present invention for 6 weeks in a mouse, wherein FIG. 12A is a final non-fasting blood glucose result, and FIG. Graph.
- FIG. 13 is a graph showing the results of evaluating the effect of acylated auxin tomodulin peptide analogue according to the present invention on the blood glucose control effect for four weeks in a mouse, wherein FIG. 13A is a time- FIG.
- amino acid-containing peptides and regular peptide sequences of the invention can be synthesized and purchased through commercialized peptide synthesis companies, such as the American peptide company in the United States or Bachem in the United States, or Anygen in Korea.
- an acylated oxytomodulin peptide analog was synthesized using a symphomy X (synthetic scale: 0.1 mmol) model of an automatic synthesizer, protein technologies, Inc.,
- the structures of Compound 1 (SEQ ID NO. 2) to Compound 38 (SEQ ID NO. 39), which are modulin peptide analogues, are shown in Table 1 and Table 2.
- the specific synthesis procedure is as follows.
- the K (Lys) side synthesis is coupled using Fmoc-K (dde) -OH and the last H (His) is coupled using Boc-His (trt) -OH. After removal of the protected dde using 2% hydralazine, PEG2, rE, C18, C18 diacid, etc. are coupled.
- the lactam ring synthesis is carried out using amino acids incorporated with Glu (Oall) and Lys (Alloc), followed by lactam coupling using excess HBTU and DIPEA after removal of the protecting group.
- the di-sulfide ring is coupled using a ser amino acid incorporated as a protecting group, followed by removal of the protecting group, followed by di-sulfide bonding.
- Coupling is performed using an amino acid incorporated with an appropriate protecting group at a position where a cross linker is to be introduced, and a linker and a two amino acid bond are performed using an amide coupling reagent or the like after removing the protecting group.
- an oximostomulin peptide analogue having structural similarity was synthesized by the method of Example 1.
- the following compounds 39 are nonacylated oxytomodulin peptide analogs
- compounds 40 and 41 are oximodomaine peptide analogs with different acylation positions
- compounds 42 to 46 are different oximounderin peptide analogs with acylated ends
- Compound 47 is a nonacylated oxytomodulin peptide analogue having a ring structure, which is disclosed in Korean Laid-Open Patent Publication No. 2012-139579.
- the structures of the synthesized oxynomodulin peptide analogues of the compounds 39 to 47 are shown in Tables 3 and 4.
- cyclic adenosine monophosphate which is elevated by transiently overexpressing human GLP-1 or glucagon receptors in cells by activating receptors of the present invention, activates the cyclic adenosine monophosphate reactive promoter (CRE)
- CRE cyclic adenosine monophosphate reactive promoter
- GLP-1 and glucagon were used for evaluation.
- GLP-1 agonist was approved as a diabetic drug, Liraglutide, Semaglutide, and oxytocmodulin peptide analogue, and MEDI0382 (Diabetes, Obesity and Metabolism 2016; 18: 1176-1190, Lancet 2018; 391: 2607-2618) And the peptides of the above compounds 39 to 47 were synthesized, and these were compared as a comparative example.
- Cells were transfected with Chinese hamster ovary (CHO-K1) human GLP-1 or glucagon expression vector (Origene) to induce firefly luciferase or renilla luciferase expression (Lipofectiamine Plus reagent, Invitrogen) with the plasmid DNAs of the transfected cells. After 3 hours of transfection, the cells were exchanged with nutrient medium ( ⁇ -MEM) containing 10% fetal bovine serum (FBS). On the next day, the cells were exchanged with ⁇ -MEM medium containing the analog of the present invention and 0.1% bovine serum albumin (BSA).
- ⁇ -MEM nutrient medium
- FBS fetal bovine serum
- the activity of the receptor is determined by conducting multiple concentration assessments of the analogs of the present invention to determine the relative activity (%) for the GLP-1 or glucagon maximal effects of the analogs of the invention to determine the concentration (EC 50 )
- the values calculated using nonlinear regression analysis are shown in Table 5.
- the acylation auxin Sat module compound the lean analogs are endogenous hormones auxin Sat module is lean than GLP-1 and the activity of the EC 50 value is significantly lower GLP-1 and glucagon receptors for glucagon receptor Great according to the invention Able to know.
- MEDI0382 which is a clinical analogue of auxin tomodulin, the activity against GLP-1 receptor was superior and GLP-1 receptor -1 receptor were similar.
- Compound 3 an acylated auxin tomodulin peptide analogue according to the present invention, was found to greatly increase the activity against GLP-1 and glucagon receptors when compared to Compound 39 of the comparative example, which is a nonacylated oxytomodulin peptide analogue , Indicating that the acylation of auxin to modulin peptide analogs has a significant effect on the increase in activity.
- the compound 40 of the comparative example which was acylated at the position of X 2 and the compound 41 of the comparative example which was acylated at the position of X 14 were the compound 3 according to the present invention which was acylated at the positions of X 3 , X 9 and X 10 , Compared with compounds 15 and 16, it was found that the activity against GLP-1 and glucagon receptors was greatly reduced. Thus, it is estimated that the position of acylation with respect to auxin tomodulin peptide analogue greatly affects the activity.
- acylated compounds 3, 10, 17 and 18 according to the present invention each having 1 to 4 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups as the polymeric part of Z 1
- 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups There was no difference in in vitro activity according to the number of 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups, and both GLP-1 and glucagon receptor activities were excellent.
- Comparative Example Compound 47 showed lower activity on the glucagon receptor than Compound 14 according to the present invention, which has the same type of lactam ring structure in the molecule, Acylation of the lean peptide analogue leads to increased activity.
- the compound 28 having an intramolecular bond with di-sulfide has a higher affinity for GLP-1 and a glucagon receptor than the other acylated auxin tomodulin cyclic peptide analog 22
- the activity was low, indicating that the intramolecular ring size of the acylated oxytomodulin cyclic peptide analogue has an effect on activity.
- acylated oxytomodulin peptide analogues according to the present invention, a diet containing high fat was fed to male mice (C57BL / 6 mice) and mice fed with obesity were fed high fat diets Were used to evaluate the body weight before and after the experiment.
- Compound 3 according to the present invention was prepared so as to have a dose of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then injected into mice in a single subcutaneous injection. Thereafter, body weight and feed intake were measured once a day, Respectively.
- acylated oxytomodulin peptide analogue In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the therapeutic effect of diabetes / obesity on the market, a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before exercise.
- Compound 3 was prepared to have a concentration of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide, a commercially available diabetic / kg, and then subcutaneously injected once a day for a total of 6 days as shown in Table 6.
- the body weight and feed intake were measured once a day at a constant time to compare the efficacy of the acylated oxytomodulin analogues with respect to liraglutide. From the seventh day, the administration was stopped and the recovery of body weight was confirmed. 2b.
- the cumulative feed intake of the compound of the present invention (100 nmol / kg) was not significantly different from that of the compound 3 and Liraglutide, the weight of Liraglutide decreased by about 12.2% About 24.6% of body weight was decreased.
- the dose of Compound 3 was 300 nmol / kg, it was found that the body weight was reduced by about 37.8%.
- the acylated auxin tomodulin peptide analogue of the present invention was twice as excellent as Liraglutide And had a lower body weight than the vehicle control group after discontinuation of the treatment.
- acylated auxin tomodulin peptide analogues In order to confirm the maximum weight loss effect of acylated auxin tomodulin peptide analogues according to the present invention, a diet containing high fat was fed to a male mice (Wistar rats) fed with high fat diet, The mice were divided into groups according to body weight before the experiment and evaluated.
- Compound 3 in the examples of the present invention was subcutaneously injected into distilled water containing 0.01% Tween 80 at a dose of 100 nmol / kg or 300 nmol / kg for 4 days, as shown in Table 7, once a day for a total of 4 days.
- the body weight and feed intake were measured once a day at a constant time to confirm the effect of weight loss over time on the initial body weight. The administration was stopped from the fifth day and the recovery of body weight was confirmed, and the results are shown in FIGS. 3A and 3B.
- acylated oxytomodulin peptide analogue In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the commercially available diabetes therapeutic agent, a diet containing high fat was fed to male mice (C57BL / 6 mouse) Were used to evaluate obesity-induced rats.
- Compound 3 was prepared so as to have a dose of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, a commercially available drug for diabetes, was added to the same solvent to prepare 100 nmol / And subcutaneously injected once every 3 days as described in Table 8 and evaluated for a total of 10 days.
- the body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of acylated oxytomodulin peptide analogues to semaglutide, and the results are shown in FIGS. 4A and 4B.
- Compound 18 showed an excellent weight loss effect similar to Compound 3 at the same dose, while Compound 13 had no significant effect on body weight.
- Compound 13 showed about 10 times more insensitivity to Compound 3 than in Compound 3, and its structural importance was confirmed by confirming the disappearance of the weight loss effect according to the end structure of the dianionic group in an animal experiment.
- a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before the experiment.
- Compounds 3 and 21 to 25 according to the present invention were prepared so as to have a volume of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then subcutaneously injected at intervals of 3 days as shown in Table 11 and evaluated for a total of 2 weeks .
- the body weight and feed intake were measured once a day at a constant time to compare the effects of the compounds 21 to 25 on weight loss, and the results are shown in FIGS. 7a to 7d.
- mice were fed a high-fat diet (C57BL / 6 mouse)
- the rats were divided into groups according to body weight before the experiment.
- Compound 3 and Compound 22 according to the present invention were prepared in distilled water containing 0.01% Tween 80 so as to have a volume of 30 nmol / kg or 100 nmol / kg, and subcutaneously injected at intervals of 3 days as shown in Table 12, Lt; / RTI >
- the body weight and feed intake were measured once a day at a constant time to compare the weight loss effect of Compound 3 with Compound 22, and the results are shown in FIGS. 8A and 8B.
- the compound 22 showed a higher cumulative feed intake than the compound 3 at the same dose, while the 10 nmol / kg dose of the compound 22 showed a feed intake of the vehicle control level, but a 7.5% weight loss effect was observed .
- the weight loss efficacy was similar to that of the same dose group of Compound 3 even though the feeds were higher. This shows that Compound 22 is more influenced by the drug efficacy due to the glucagon receptor activating ability as compared to Compound 3.
- Compound 3 was prepared in a concentration of 30 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide (commercially available as a therapeutic agent for diabetes / obesity) and MEDI0382 (as a comparative example) were dissolved in the same solvent at 30 nmol / kg, and then subcutaneously injected once a day for a total of 4 days as shown in Table 13.
- the body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of analogues to Liraglutide and MEDI0382, and the results are shown in FIGS. 9A and 9B.
- Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every three days as described in Table 14 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at a constant time, body fat was measured at 4 weeks before the autopsy, and the body weight and the body fat reducing effect of the oxytocmodulin peptide analogue of the present invention were compared to that of semaglutide. 10C.
- This experiment evaluated the effect of the acylated auxin tomodulin peptide analogue according to the present invention on the glucose tolerance improving effect of the male mice (C57BL / 6 mouse) as a means of improving postprandial blood glucose controlling ability.
- the experimental mice were fasted overnight, and Compound 3, Compound 22 or Compound 25 according to the present invention was prepared in distilled water containing 0.01% Tween 80 and subcutaneously injected 30 minutes before glucose administration.
- the glucose solution was orally administered 30 minutes after the oxhistone modulin peptide analogue injection, and the whole blood was measured through the vein at the designated time immediately before the drug injection and the glucose solution administration and for 2 hours after the glucose solution administration.
- the peptide analogs showed a significant and dose-dependent decrease in blood glucose AUC at a dose of 30 nmol / kg or more.
- Compound 25 showed significant potency resistance improvement effects in all evaluated dose groups and 3 times The excellent antitumor effect was observed.
- mice Male mice (db / db mouse) were divided into two groups according to the pre-experiment blood glucose, glycated hemoglobin and body weight The groups were separated and evaluated.
- Compound 3 according to the present invention was prepared so as to have a concentration of 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was prepared in the same solvent so as to have a 100 nmol / kg capacity.
- the mice were subcutaneously injected once every 3 days and evaluated for a total of 6 weeks.
- Figs. 12A and 12B After 24 hours of drug administration once a week, non-fasting blood glucose, body weight and feed intake were measured, and at 3 weeks, 5 weeks and 6 weeks, hemoglobin was measured to determine the effect of the oxytocmodulin peptide analogue of the present invention against semaglutide The results are shown in Figs. 12A and 12B.
- Compound 3 according to the present invention exhibited the same or lower efficacy than Semaglutide at the same dose (100 nmol / kg).
- the final non-fasting blood glucose level of the control group was 581 mg / dL, while the final non-fasting blood glucose level of the control substance, Semaglutide, was 342 mg / dL, and the final unfasted blood glucose level of Compound 3 was 274 mg / Significant inhibition of blood glucose elevation was observed.
- the final value of vehicle glycated hemoglobin increased by 5.15% point compared with the initial value, but increased by 2.65% point in the semaglutide administration group and 1.73% point in the compound 3 administration group.
- acylated oxytomodulin peptide analogs according to the present invention have excellent anticancer effects on the delayed onset of diabetes compared to semaglutide.
- Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every 3 days as shown in Table 16 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at constant time, and non - fasting blood glucose was measured 24 hours after administration at intervals of about 10 days.
- the HbA1c was measured at 4th week before the autopsy, and the effect of the oxynitomulin peptide analogue according to the present invention on the blood glucose control was compared with that of semaglutide. The results are shown in FIGS. 13A and 13B.
- the compound 3 and compound 22 according to the present invention administered at the same dose showed an excellent blood glucose control effect and a glycosylated hemoglobin elevation inhibitory effect similar to those of semaglutide.
- the oxytocmodulin peptide analogue according to the present invention has the effect of controlling the blood glucose as well as the weight reduction shown in the ⁇ Experimental Example 11>.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims (26)
- 하기 화학식 Ⅰ의 아미노산 서열을 포함하는 옥신토모듈린 펩타이드 유사체.<화학식 Ⅰ>His-X1-Gln-Gly-Thr-Phe-Thr-Ser-X2-X3-X4-X5-X6-X7-X8-X9-Arg-Arg-Ala-X10-Asp-Phe-Val-Gln-Trp-Leu-X11-X12-X13-X14-X15-X16 (SEQ ID NO.49)상기 식에서,X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X2는 Asp 또는 Z이며;X3는 Tyr 또는 Z이며;X4는 Ser 또는 Z이며;X5는 Lys 또는 Z이며;X6은 Tyr 또는 Z이며;X7은 Leu 또는 Z이며;X8은 Asp 또는 Z이며;X9는 Ser, Aib(aminoisobutyric acid) 또는 Z이며;X10은 Gln 또는 Z이며;X11은 Met 또는 Leu이며;X12은 Asn 또는 Arg이며;X13은 Thr 또는 Ala이며;X14은 Lys 또는 Z이며;X15는 RNRNNIA(SEQ ID NO.51)이거나 존재하지 않으며;X16은 X15가 존재할 경우, Z이거나 존재하지 않으며;C-말단 아미노산은 임의로 아미드화될 수 있으며;여기서 X2, X3, X4, X5, X6, X7, X8, X9, X10, X14 또는 X16 중 적어도 하나가 Z이며;Z는 작용화된 Lys으로서 그 측쇄에 중합체성 부분과 스페이서의 접합체인 Z1과 친유성 리피드 부분인 Z2가 접합된 형태이며, 여기서 Z1은 아실 작용기를 통하여 Lys 측쇄와 직접적으로 접합되고 Z2는 Z1을 통해 Lys 측쇄에 접합되며, Z1은 하기 구조식 (1) 또는 (2)이며, Z2는 하기 구조식 (3) 또는 (4)이다.
- 제 1 항에 있어서, X1 위치가 Aib인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, X11 위치가 Leu, X12 위치가 Arg, X13 위치가 Ala인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, X10 위치가 Gln 또는 Lys, X11 또는 X12 위치가 각각 Leu, Arg 중에서 선택되는 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, 상기 스페이서가 L-글루타민산 잔기로서 그 γ-카복실산에는 중합체성 부분이 공유결합되고, α-아미노기에는 친유성 리피드 부분이 공유결합되는 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 1 항 에 있어서, 상기 중합체성 부분이 폴리에틸렌 글리콜(PEG), 단량체로서 에틸렌 글리콜, 에탄올아민 및 락틱산을 갖는 공중합체 또는 글라이신 및 세린을 갖는 폴리-아미노산 공중합체인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, 상기 Z가 구조식 (1) 또는 (2)의 Z1을 갖는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, 상기 친유성 리피드 부분 Z2는 탄소 원자 수가 C14~C20인 포화 탄화수소 쇄를 포함하고, 이 탄화수소 쇄의 말단 탄소가 카복실산 형태, 일차 아미드 형태 또는 임의의 단일 아미노산과 공유결합으로 연결된 카복실산 형태인 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, 상기 Z가 구조식 (3) 또는 (4)의 Z2를 갖는 옥신토모듈린 펩타이드 유사체.
- 제 1 항에 있어서, 하기 화학식 Ⅰ-1의 아미노산 서열을 포함하는 옥신토모듈린 펩타이드 유사체.<화학식 Ⅰ-1>HX1QGTFTSDX3SKYLDX9RRAX10DFVQWLX11X12X13X14X15X16 (SEQ ID NO.50)상기 식에서X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X3은 Tyr 또는 Z;X9은 Ser, Aib 또는 Z;X10은 Gln 또는 Z이며;X11는 Met 또는 Leu;X12는 Asn 또는 Arg;X13는 Thr 또는 Ala;X14은 Lys 또는 Z;X15은 RNRNNIA(SEQ ID NO. 51)이거나 존재하지 않으며;X16은 X15이 존재할 경우, Z이거나 존재하지 않으며, C-terminal 은 아미드화 될 수 있고,Z은 상기 화학식 Ⅰ에서 정의한 바와 같다.
- 제 10 항에 있어서, 상기 펩타이드 유사체는 화합물 1(SEQ ID NO. 2), 화합물 2(SEQ ID NO. 3), 화합물 3(SEQ ID NO. 4), 화합물 4(SEQ ID NO. 5), 화합물 5(SEQ ID NO. 6), 화합물 6(SEQ ID NO. 7), 화합물 7(SEQ ID NO. 8), 화합물 8(SEQ ID NO. 9), 화합물 9(SEQ ID NO. 10), 화합물 10(SEQ ID NO. 11), 화합물 11(SEQ ID NO. 12), 화합물 12(SEQ ID NO. 13), 화합물 13(SEQ ID NO. 14), 화합물 15(SEQ ID NO. 16), 화합물 16(SEQ ID NO. 17), 화합물 17(SEQ ID NO. 18), 또는 화합물 18(SEQ ID NO. 19)인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 하기 화학식 Ⅱ의 아미노산 서열을 포함하며, 아미노산 서열 내에 분자내 가교를 갖는 옥신토모듈린 펩타이드 유사체.<화학식 Ⅱ>His-X17-Gln-Gly-Thr-Phe-Thr-Ser-Asp-X18-Ser-Lys-Tyr-Leu-Asp-X19-Arg-Arg-Ala-X20-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys (SEQ ID NO.53)상기식에서,X17은 Ser 또는 Aib (Aminoisobutric acid)이고;X18은 Z이며;X19는 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X20은 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X19와 X20은 분자내 결합 또는 가교제 (cross linker)를 통하여 cyclic 펩타이드를 형성하며, 이때, cyclic 펩타이드는 두 잔기 사이에 아미드결합으로 형성된 락탐 링 또는 두 잔기 사이에 di-sulfide 결합으로 형성된 di-sulfide 링 또는 두 잔기 사이에 가교제 (cross linker) 결합으로 형성된 cross-linked 링을 가진 펩타이드이며;C-말단 아미노산은 임으로 아미드화 될 수 있으며;Z은 상기 화학식 Ⅰ에서 정의한 바와 같다.
- 제 12 항에 있어서, X19와 X20의 분자내 결합은 X19와 X20이 각각 Asp 또는 Glu와 Lys 또는 Orn이거나, 각각 Lys 또는 Orn와 Asp 또는 Glu 일 때, 분자내 락탐 링 형성 결합이거나; X19와 X20이 각각 Cys 또는 Hcy와 Cys 또는 Hcy 일 때, 분자내 di-sulfide 링 형성 결합인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 13 항에 있어서, X19와 X20이 각각 Cys 또는 Hcy와 Cys 또는 Hcy 일 때, 가교제(cross linker)는 양쪽 Cys 또는 Hcy 측쇄의 티올(thiol) 작용기에 결합되어 링을 형성하며, 이때 가교제는 C1-C6 직쇄 또는 분지쇄 알킬, C3-C8 포화 또는 불포화 사이클로알킬, C6-C10 아릴, 또는 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 12 항에 있어서, X19와 X20이 각각 Asp 또는 Glu와 Asp 또는 Glu 일 때, 가교제(cross linker)는 양쪽 Asp 또는 Glu 측쇄의 카르복실기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-아미노 C1-C6 직쇄 또는 분지쇄 알킬, 디-아미노 C3-C8 포화 또는 불포화 사이클로알킬, 아미노 피페리딘, 피페라진, 디-아미노 C6-C10 아릴, 또는 디-아미노 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 12 항에 있어서, X19와 X20이 각각 Lys 또는 Orn와 Lys 또는 Orn 일 때, 가교제(cross linker)는 양쪽 Lys 또는 Orn 측쇄의 아민기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-카르보닐 C1-C6 직쇄 또는 분지쇄 알킬, 디-카르보닐 C3-C8 포화 또는 불포화 사이클로알킬, 디-카르보닐 C6-C10 아릴 또는 디-카르보닐 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 12 항에 있어서, X19와 X20이 각각 Asp 또는 Glu와 Lys 또는 Orn 일 때, 또는 각각 Lys 또는 Orn와 Asp 또는 Glu 일 때, 가교제(cross linker)는 Asp 또는 Glu 측쇄의 카르복실기와 가교제(cross linker)의 아민 작용기와 아미드결합으로 연결되며, Lys 또는 Orn 측쇄의 아민기에는 가교제(cross linker)의 카르복실 작용기와 아미드결합으로 연결되어 링을 형성하며, 이때 가교제(cross linker)는 Gly, Val, Leu, Ile 중에서 선택되는 알파아미노산, 베타 아미노산, 카르보닐 C1-C6 직쇄 또는 분지쇄 알킬아민, 카르보닐 C3-C8 포화 또는 불포화 알킬아민, 카르보닐 피페리딘, 아미노 벤조일, 카르보닐 C6-C10 아릴아민 또는 카르보닐 C5-C12 헤테로 아릴아민 또는 융합된 헤테로사이클릭 아릴아민인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
- 제 12 항에 있어서, 상기 펩타이드 유사체는 화합물 14(SEQ ID NO. 15), 화합물 19(SEQ ID NO. 20), 화합물 20(SEQ ID NO. 21), 화합물 21(SEQ ID NO. 22), 화합물 22(SEQ ID NO. 23), 화합물 23(SEQ ID NO. 24), 화합물 24(SEQ ID NO. 25), 화합물 25(SEQ ID NO. 26), 화합물 27(SEQ ID NO. 28), 화합물 28(SEQ ID NO. 29), 화합물 29(SEQ ID NO. 30), 화합물 30(SEQ ID NO. 31), 화합물 31(SEQ ID NO. 32), 화합물 32(SEQ ID NO. 33), 화합물 33(SEQ ID NO. 34), 화합물 34(SEQ ID NO. 35), 화합물 35(SEQ ID NO. 36), 화합물 36(SEQ ID NO. 37), 화합물 37(SEQ ID NO. 38), 화합물 38(SEQ ID NO. 39)인 것을 특징으로 하는 펩타이드 유사체.
- 제 1 항 내지 제 11 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료용 약학조성물.
- 제 1 항 내지 제 11 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중을 동반하는 비 인슐린 의존성 당뇨병 치료 또는 예방용 약학조성물.
- 제 12 항 내지 제 22 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료용 약학조성물.
- 제 12 항 내지 제 22 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중을 동반하는 비 인슐린 의존성 당뇨병 치료 또는 예방용 약학조성물.
Priority Applications (24)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201880053473.4A CN111094331B (zh) | 2017-08-16 | 2018-08-16 | 酰化胃泌酸调节素肽类似物 |
EP22170622.9A EP4079757A1 (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
JP2020508489A JP7211659B2 (ja) | 2017-08-16 | 2018-08-16 | アシル化オキシントモジュリンペプチド類似体 |
RU2020108518A RU2752787C1 (ru) | 2017-08-16 | 2018-08-16 | Пептидный аналог ацилированного оксинтомодулина |
IL272606A IL272606B1 (en) | 2017-08-16 | 2018-08-16 | Acyl-converted peptide oxyntomodulin analogue, pharmaceutical preparation containing it and its uses |
PL18846196.6T PL3670529T3 (pl) | 2017-08-16 | 2018-08-16 | Acylowany analog peptydowy oksyntomoduliny |
BR112020003319-7A BR112020003319A2 (pt) | 2017-08-16 | 2018-08-16 | análogo de peptídeo de oxintomodulina acilada |
CA3073011A CA3073011C (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
HRP20240371TT HRP20240371T1 (hr) | 2017-08-16 | 2018-08-16 | Peptidni analog aciliranog oksintomodulina |
CN202410003809.3A CN117603337A (zh) | 2017-08-16 | 2018-08-16 | 酰化胃泌酸调节素肽类似物 |
RS20240329A RS65414B1 (sr) | 2017-08-16 | 2018-08-16 | Peptidni analog acilovanog oksintomodulina |
US16/638,970 US11236142B2 (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
MX2020001761A MX2020001761A (es) | 2017-08-16 | 2018-08-16 | Analogo de peptido de oxintomodulina acilado. |
CN202310958807.5A CN116854804A (zh) | 2017-08-16 | 2018-08-16 | 酰化胃泌酸调节素肽类似物 |
SG11202001283PA SG11202001283PA (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
AU2018318672A AU2018318672B2 (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
NZ761754A NZ761754B2 (en) | 2018-08-16 | Acylated oxyntomodulin peptide analog | |
ES18846196T ES2973986T3 (es) | 2017-08-16 | 2018-08-16 | Análogo peptídico acilado de oxintomodulina |
EP18846196.6A EP3670529B1 (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
PH12020500338A PH12020500338A1 (en) | 2017-08-16 | 2020-02-14 | Acylated oxyntomodulin peptide analog |
SA520411366A SA520411366B1 (ar) | 2017-08-16 | 2020-02-16 | نظير ببتيد أوكسينتو موديولين معالج بأسيل |
SA522432563A SA522432563B1 (ar) | 2017-08-16 | 2020-02-16 | نظير ببتيد أوكسينتو موديولين معالج بأسيل |
US17/410,697 US11713344B2 (en) | 2017-08-16 | 2021-08-24 | Acylated oxyntomodulin peptide analog |
JP2021175902A JP7443315B2 (ja) | 2017-08-16 | 2021-10-27 | アシル化オキシントモジュリンペプチド類似体 |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2017-0103798 | 2017-08-16 | ||
KR20170103798 | 2017-08-16 | ||
KR1020180095717A KR102230363B1 (ko) | 2017-08-16 | 2018-08-16 | 아실화 옥신토모듈린 펩타이드 유사체 |
KR10-2018-0095717 | 2018-08-16 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/638,970 A-371-Of-International US11236142B2 (en) | 2017-08-16 | 2018-08-16 | Acylated oxyntomodulin peptide analog |
US17/410,697 Division US11713344B2 (en) | 2017-08-16 | 2021-08-24 | Acylated oxyntomodulin peptide analog |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2019035672A1 true WO2019035672A1 (ko) | 2019-02-21 |
Family
ID=65361996
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2018/009425 WO2019035672A1 (ko) | 2017-08-16 | 2018-08-16 | 아실화 옥신토모듈린 펩타이드 유사체 |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2019035672A1 (ko) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2799327C1 (ru) * | 2020-04-29 | 2023-07-04 | Тон-А Ст Ко., Лтд. | Двойной агонист рецепторов глюкагоноподобного пептида-1 и глюкагона длительного действия |
JP2023533413A (ja) * | 2020-04-29 | 2023-08-03 | ドン-ア エスティ カンパニー リミテッド | 長時間作用型glp-1およびグルカゴン受容体デュアルアゴニスト |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20120139579A (ko) | 2011-06-17 | 2012-12-27 | 한미사이언스 주식회사 | 옥신토모듈린과 면역글로불린 단편을 포함하는 결합체 및 그의 용도 |
WO2016049190A1 (en) * | 2014-09-24 | 2016-03-31 | Indiana University Research And Technology Corporation | Incretin-insulin conjugates |
-
2018
- 2018-08-16 WO PCT/KR2018/009425 patent/WO2019035672A1/ko active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20120139579A (ko) | 2011-06-17 | 2012-12-27 | 한미사이언스 주식회사 | 옥신토모듈린과 면역글로불린 단편을 포함하는 결합체 및 그의 용도 |
WO2016049190A1 (en) * | 2014-09-24 | 2016-03-31 | Indiana University Research And Technology Corporation | Incretin-insulin conjugates |
Non-Patent Citations (17)
Title |
---|
ACS CHEM BIOL., vol. 11, 2016, pages 324 - 328 |
ANIM SCI J., vol. 87, no. 9, 2016, pages 1090 - 1098 |
DIABETES, OBESITY AND METABOLISM, vol. 18, 2016, pages 1176 - 1190 |
DIABETES, vol. 54, 2005, pages 2390 - 2395 |
DIABETES, vol. 58, no. 10, 2009, pages 2258 - 2266 |
DIABETES, vol. 62, no. 1, 2013, pages A48 |
EXPERT REV CARDIOVASC THER., vol. 13, no. 7, 2015, pages 753 - 767 |
J BIOL CHEM., vol. 278, 2002, pages 22418 - 22423 |
J CLIN ENDOCRINOL METAB., vol. 88, 2003, pages 4696 - 4701 |
KOREAN J MED., vol. 87, no. 1, 2014, pages 9 - 13 |
LANCET, vol. 391, 2018, pages 2607 - 2618 |
MIRANDA, L. P. ET AL.: "Design and Synthesis of Conformationally Constrained Glucagon-like Peptide-1 Derivatives with Increased Plasma Stability and Prolonged in Vivo Activity", JOURNAL OF MEDICINAL CHEMISTRY, vol. 51, 2008, pages 2758 - 2765, XP007909689, DOI: doi:10.1021/jm701522b * |
MOLECULAR METABOLISM, vol. 2, 2013, pages 468 - 479 |
MOLECULAR METABOLISM., vol. 3, 2014, pages 241 - 251 |
MURAGE, E. N. ET AL.: "Search for a-helical Propensity in the Receptor-bound Conformation of Glucagon-like Peptide-1", BIOORGANIC & MEDICINAL CHEMISTRY, vol. 16, 2008, pages 10106 - 10112, XP025691312, DOI: doi:10.1016/j.bmc.2008.10.006 * |
PHYSIOL REV., vol. 87, no. 4, 2007, pages 1409 - 1439 |
SWEDBERG, J. E. ET AL.: "Cyclic Alpha-conotoxin Peptidomimetic Chimeras as Potent GLP-1R Agonists", EUROPEAN JOURNAL OF MEDICINAL CHEMISTRY, vol. 103, 2015, pages 175 - 184, XP029295239, DOI: doi:10.1016/j.ejmech.2015.08.046 * |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2799327C1 (ru) * | 2020-04-29 | 2023-07-04 | Тон-А Ст Ко., Лтд. | Двойной агонист рецепторов глюкагоноподобного пептида-1 и глюкагона длительного действия |
JP2023533413A (ja) * | 2020-04-29 | 2023-08-03 | ドン-ア エスティ カンパニー リミテッド | 長時間作用型glp-1およびグルカゴン受容体デュアルアゴニスト |
JP7440663B2 (ja) | 2020-04-29 | 2024-02-28 | ドン-ア エスティ カンパニー リミテッド | 長時間作用型glp-1およびグルカゴン受容体デュアルアゴニスト |
EP4144757A4 (en) * | 2020-04-29 | 2024-05-29 | Dong-A ST Co., Ltd. | LONG-ACTING DUAL GLP-1 AND GLUCAGON RECEPTOR AGONIST |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2017116205A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체 | |
WO2012173422A9 (en) | A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof | |
WO2018056764A1 (ko) | 인슐린 수용체와의 결합력이 감소된, 인슐린 아날로그 및 이의 용도 | |
WO2020130749A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물 | |
WO2019066586A1 (ko) | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 | |
WO2017116207A1 (ko) | Fgf21 아날로그, fgf21 결합체, 및 이의 용도 | |
WO2018174668A2 (ko) | 인슐린 수용체와의 결합력이 감소된 인슐린 아날로그의 결합체 및 이의 용도 | |
WO2019066570A1 (ko) | 지속형 단쇄 인슐린 아날로그 및 이의 결합체 | |
WO2022211537A1 (ko) | 신규한 면역 활성 인터루킨 2 아날로그 결합체 및 이의 제조 방법 | |
WO2022015082A1 (ko) | 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도 | |
EP1756156B1 (en) | Selective vpac2 receptor peptide agonists | |
WO2020214013A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도 | |
WO2021066600A1 (ko) | 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도 | |
WO2020263063A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도 | |
WO2019035672A1 (ko) | 아실화 옥신토모듈린 펩타이드 유사체 | |
WO2023106845A1 (ko) | 신규한 아디포넥틴 아날로그 및 결합체 | |
WO2020130751A1 (ko) | 인슐린 및 글루카곤을 포함하는 약학 조성물 | |
WO2022216129A1 (ko) | 글루카곤 유도체를 포함하는 만성 신장 질환 예방 또는 치료용 약학 조성물 | |
WO2022015115A1 (ko) | 3중 작용성 지속형 결합체 또는 3중 작용제를 포함하는 조합물의 치료학적 용도 | |
WO2021215801A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법 | |
WO2021133087A1 (ko) | Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물 | |
WO2020242268A1 (ko) | 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 | |
WO2021107519A1 (en) | Biotin moiety-conjugated polypeptide and pharmaceutical composition for oral administration comprising the same | |
WO2021194228A1 (ko) | 암의 예방 또는 치료용 약학적 조성물 | |
WO2024080824A1 (ko) | 신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18846196 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 3073011 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2020508489 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2018318672 Country of ref document: AU Date of ref document: 20180816 Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020003319 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 2018846196 Country of ref document: EP Effective date: 20200316 |
|
ENP | Entry into the national phase |
Ref document number: 112020003319 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200217 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 520411366 Country of ref document: SA |
|
WWE | Wipo information: entry into national phase |
Ref document number: P-2024/0329 Country of ref document: RS |