WO2024080824A1 - 신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물 - Google Patents

신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물 Download PDF

Info

Publication number
WO2024080824A1
WO2024080824A1 PCT/KR2023/015820 KR2023015820W WO2024080824A1 WO 2024080824 A1 WO2024080824 A1 WO 2024080824A1 KR 2023015820 W KR2023015820 W KR 2023015820W WO 2024080824 A1 WO2024080824 A1 WO 2024080824A1
Authority
WO
WIPO (PCT)
Prior art keywords
glp
receptor antagonist
antagonist analog
analog
acylated
Prior art date
Application number
PCT/KR2023/015820
Other languages
English (en)
French (fr)
Inventor
김은정
박초롱
최재혁
김원기
예병진
임현주
신민경
Original Assignee
한미약품 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한미약품 주식회사 filed Critical 한미약품 주식회사
Publication of WO2024080824A1 publication Critical patent/WO2024080824A1/ko

Links

Images

Definitions

  • the present invention relates to a pharmaceutical composition for preventing or treating congenital hyperinsulinism or hypoglycemia, comprising a GLP-1 receptor antagonist analog or an acylated GLP-1 receptor antagonist analog conjugate.
  • Hypoglycemia refers to a condition in which blood sugar level is lower than the normal standard (60 to 120 mg/dl on an empty stomach, 140 mg/dl or less 2 hours after a meal). Hypoglycemia usually occurs when blood sugar level is 50 mg/dl or less. It is judged that
  • Hypoglycemia may occur if oral hypoglycemic agents or insulin are administered in excessive amounts, if the fasting state is maintained for a long time, or if the amount of activity or exercise is excessive. Hypoglycemia may also occur due to factors such as severe physical disease, deficiency of hormones such as adrenal cortical hormone or glucagon, insulin-producing pancreatic tumor, autoimmune disease related to insulin, gastrectomy patient, or hereditary carbohydrate metabolic enzyme abnormality. there is.
  • congenital hyperinsulinism is one of the most common causes of severe and persistent hypoglycemia in newborns and children. Insulin is a hormone that regulates blood sugar levels in the human body, and plays a role in lowering blood sugar levels when blood sugar levels rise due to food intake, etc.
  • congenital hyperinsulinism it is unable to play this regulating role and secretes insulin from the pancreas regardless of blood sugar levels. As a result, patients suffer from hypoglycemia.
  • hypoglycemia occurs due to hypoglycemia or congenital hyperinsulinism
  • brain cells are unable to maintain glucose, ketones, and lactose, which are mainly used, and energy supply from proteins or fats in the body is blocked, resulting in damage to brain cells. It can lead to spasticity, learning disabilities, cerebral palsy, blindness, and even death.
  • hypoglycemia may occur temporarily due to excessive insulin secretion, and hypoglycemia may also occur in infants experiencing fetal distress.
  • the cause of abnormal insulin secretion is not clear, but in these cases, improvement occurs within a few days to several months.
  • Temporary hypoglycemia may occur in mothers with diabetes who have poor blood sugar control, but it does not recur once breastfeeding progresses well and hypoglycemia disappears.
  • Another cause is persistent hyperinsulinism due to several genetic defects.
  • LAGB laparoscopic adjustable gastric banding
  • RYGB Roux-en-Y gastric bypass
  • BPD biliopancreatic diversion
  • GLP-1 receptor antagonists are drugs administered for the purpose of increasing appetite (KR 10-2001-0089563 A), and a representative example is exendin-3 (9-39) (Indraneel Banerjee, Mark J. Dunne, in Encyclopedia of Endocrine Diseases (Second Edition), 2019), it has been reported that administration of exendin-3(9-39) suppresses insulin secretion and is effective in treating acute hypoglycemia (Calabria AC, Li C, Gallagher PR, Stanley CA, De Leon DD. exendin-(9-39) elevates fasting blood glucose levels in congenital hyperinsulinism due to inactivating mutations in the ATP-sensitive K+ channel. :10.2337/db12-0166).
  • One object of the present invention is to provide a GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate.
  • Another object of the present invention is to provide a use of the GLP-1 receptor antagonist analog, acylated GLP-1 receptor antagonist analog conjugate, or composition containing the same for the prevention or treatment of congenital hyperinsulinism or hypoglycemia.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating congenital hyperinsulinism or hypoglycemia, comprising the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate.
  • Another object of the present invention is to provide a method for preventing or treating congenital hyperinsulinism or hypoglycemia, comprising administering the pharmaceutical composition to a subject in need.
  • Another object of the present invention is to provide a drug for the prevention or treatment of congenital hyperinsulinism or hypoglycemia, comprising the GLP-1 receptor antagonist analog, acylated GLP-1 receptor antagonist analog conjugate, or a composition containing the same. It provides a purpose for doing so.
  • the GLP-1 receptor antagonist analog conjugate and the acylated GLP-1 receptor antagonist analog conjugate of the present invention can act as an antagonist by acting on the GLP-1 receptor, thereby providing a preventive or therapeutic effect on congenital hyperinsulinism or hypoglycemia. You can have
  • Figure 1 is a diagram showing the results of measuring the blood sugar level over time of the acylated GLP-1 receptor antagonist analog conjugate (SEQ ID NO: 17) according to the present invention.
  • Figure 2 shows the results of measuring blood sugar levels in sleeve gastrectomy rats following administration of the acylated GLP-1 receptor antagonist analog conjugate (SEQ ID NO: 17) according to the present invention.
  • Figure 3 shows the results of measuring the level of plasma insulin in sleeve gastrectomy rats following administration of the acylated GLP-1 receptor antagonist analog conjugate (SEQ ID NO: 17) according to the present invention.
  • One aspect of the invention is a novel GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog.
  • the GLP-1 receptor antagonist analog is characterized by being represented by the following general formula 1:
  • X1 is threonine, or absent
  • X2 is phenylalanine or absent
  • X3 is threonine, or absent
  • X4 is serine, or absent
  • X5 is aspartic acid or absent
  • X6 is leucine, valine, or absent
  • X7 is serine, or absent
  • X8 is alanine, lysine, serine, or absent
  • X9 is glutamine or tyrosine
  • X10 is methionine, or leucine
  • X13 is glutamic acid, or glutamine
  • X15 is alanine or valine
  • X17 is leucine, or glutamic acid
  • X20 is glutamic acid, or alanine
  • X23 is lysine, valine, or an acylated amino acid
  • X24 is asparagine, lysine, or an acylated amino acid
  • X36 is cysteine, lysine, acylated amino acid, or absent;
  • the GLP-1 receptor antagonist analog is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • X5 is aspartic acid
  • X6 is leucine, valine
  • X7 is serine
  • X8 is lysine or serine
  • X15 is valine
  • X23 is lysine or valine
  • X24 is characterized as being asparagine or lysine.
  • the GLP-1 receptor antagonist analog is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • X5 is aspartic acid
  • X6 is leucine
  • X7 is serine
  • X8 is serine
  • X9 is tyrosine
  • X10 is leucine
  • X13 is glutamic acid
  • X15 is valine
  • X17 is leucine
  • X20 is glutamic acid
  • X23 is lysine
  • X24 is asparagine
  • X36 is characterized as lysine or an acylated amino acid.
  • acylated amino acid is any one of the amino acids represented by K(1) to K(4) below:
  • the linker is characterized in that it contains AEEA ((2-(2-aminoethoxy)ethoxy)acetic acid).
  • the linker is characterized in that ⁇ Glu-(AEEA) 2 .
  • the linker includes 0 to 3 AEEAs, and 0 to 3 gamma-Glutamates are connected to the AEEAs.
  • GLP-1 receptor antagonist analog is acylated with a C1-C30 straight or branched chain acyl group containing one or two carboxylic acids.
  • acyl group is a C4 to C30 fatty acid or dicarboxylic acid.
  • the GLP-1 receptor antagonist analog is characterized in that the amino acid or lysine residue located at the C-terminus is acylated.
  • the GLP-1 receptor antagonist analog is characterized in that it comprises any one sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs: 1 to 22.
  • GLP-1 receptor antagonist analog comprises any one sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs: 3, 7 to 12, 21, and 22. do.
  • the GLP-1 receptor antagonist analog is characterized in that it comprises any one sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs: 17, 19, 21, and 22.
  • Another aspect of the present invention is a pharmaceutical composition for preventing or treating congenital hyperinsulinism or hypoglycemia, comprising a pharmaceutically effective amount of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog.
  • the pharmaceutical composition is characterized by further comprising a pharmaceutically acceptable carrier.
  • the pharmaceutical composition is characterized by increasing the blood sugar level of a subject when administered.
  • hypoglycemia is Postbariatric Hypoglycemia (PBH).
  • composition according to any one of the preceding embodiments, wherein the hypoglycemia after obesity is caused by bariatric surgery.
  • Another aspect of the present invention is the use of the GLP-1 receptor antagonist analog, the acylated GLP-1 receptor antagonist analog, or a composition containing the same for the prevention or treatment of congenital hyperinsulinism or hypoglycemia.
  • Another aspect of the present invention is to provide a medicament for the prevention or treatment of congenital hyperinsulinism or hypoglycemia using the GLP-1 receptor antagonist analog, acylated GLP-1 receptor antagonist analog, or composition containing the same. This is the purpose.
  • amino acids abbreviated herein are described according to the IUPAC-IUB nomenclature.
  • One aspect of the present invention is a GLP-1 receptor antagonist analog or an acylated conjugate of the GLP-1 receptor antagonist analog.
  • GLP-1 is a hormone secreted from the small intestine when stimulated by food intake. It promotes insulin secretion from the pancreas and inhibits the secretion of glucagon, helping to lower blood sugar levels. In addition, it acts as a satiety factor and plays a role in reducing food intake by slowing down the digestive process of the stomach and delaying the gastric transit time of food digestion.
  • exendin-4 a GLP-1 receptor agonist
  • Native GLP-1 has the following sequence (SEQ ID NO: 23):
  • GLP-1 receptor antagonist refers to a substance that acts on the GLP-1 receptor and inhibits or weakens the activity of GLP-1.
  • Known GLP-1 receptor antagonists include exendin-3(9-39) (Montrose-Rafizaden et al., 1997, J.Biol.Chem. 272(34):21201-21206).
  • Exendin-3(9-39) has the following sequence (SEQ ID NO: 24):
  • GLP-1 receptor antagonist analog refers to a substance that exhibits an antagonistic effect on the GLP-1 receptor (GLP-1R). However, it is not limited thereto, but is a peptide that has one or more differences in amino acid sequence compared to native GLP-1, and includes substitution, addition, deletion, or modification of some sequences. It may be modified from the native GLP-1 sequence through a modification method or a combination of these methods.
  • the GLP-1 receptor antagonist analog may be non-naturally occurring.
  • these modifications for preparing the GLP-1 receptor antagonist analog include modification using L-type or D-type amino acids, and/or non-natural amino acids; and/or modifying the native sequence by modifying the native sequence, e.g., modification of side chain functional groups, intramolecular covalent bonding, e.g., inter-side chain ring formation, methylation, acylation, ubiquitination, phosphorylation, aminohexation, biotinylation, etc. Includes everything that is done.
  • the modification includes all substitutions with non-natural compounds.
  • the GLP-1 receptor antagonist analog may be one in which one or more amino acids are added to the amino and/or carboxy terminus of native GLP-1, but is not limited thereto.
  • the substituted or added amino acids may include the 20 amino acids commonly observed in human proteins as well as atypical or non-naturally occurring amino acids.
  • Commercial sources of atypical amino acids include Sigma-Aldrich, ChemPep and Genzyme pharmaceuticals. Peptides containing these amino acids and canonical peptide sequences can be synthesized and purchased through commercial peptide synthesis companies, such as American Peptide Company or Bachem in the United States, or Anygen in Korea.
  • the GLP-1 receptor antagonist analog of the present invention may be a GLP-1 receptor antagonist analog expressed by the following general formula 1, but is not limited thereto:
  • X1 is threonine, or absent
  • X2 is phenylalanine or absent
  • X3 is threonine, or absent
  • X4 is serine, or absent
  • X5 is aspartic acid or absent
  • X6 is leucine, valine, or absent
  • X7 is serine, or absent
  • X8 is alanine, lysine, serine, or absent
  • X9 is glutamine or tyrosine
  • X10 is methionine, or leucine
  • X13 is glutamic acid, or glutamine
  • X15 is alanine or valine
  • X17 is leucine, or glutamic acid
  • X20 is glutamic acid, or alanine
  • X23 is lysine, valine, or an acylated amino acid
  • X24 is asparagine, lysine, or an acylated amino acid
  • X36 is cysteine, lysine, acylated amino acid, or absent;
  • the GLP-1 receptor antagonist analog is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • X5 is aspartic acid
  • X6 is leucine, valine
  • X7 is serine
  • X8 is lysine or serine
  • X15 is valine
  • X23 is lysine or valine
  • X24 may be, but is not limited to, asparagine or lysine.
  • the GLP-1 receptor antagonist analog may include any one sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 1 to 3, 5, 7 to 12, and 17 to 22, and more specifically, SEQ ID NO: 3. , may include any one sequence selected from the group consisting of amino acid sequences 7 to 12, 21, and 22, but is not limited thereto.
  • the GLP-1 receptor antagonist analog is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • X5 is aspartic acid
  • X6 is leucine
  • X7 is serine
  • X8 is serine
  • X9 is tyrosine
  • X10 is leucine
  • X13 is glutamic acid
  • X15 is valine
  • X17 is leucine
  • X20 is glutamic acid
  • X23 is lysine
  • X24 is asparagine
  • X36 may be, but is not limited to, lysine, or an acylated amino acid.
  • the GLP-1 receptor antagonist analog may have the structure of any one of the following (i) to (iv), but is not limited thereto:
  • the GLP-1 receptor antagonist analog may include any one sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 17, 19, 21, and 22, but is not limited thereto.
  • the GLP-1 receptor antagonist analog containing the amino acid sequence of SEQ ID NO: 17 may have the following structure, but is not limited thereto:
  • the GLP-1 receptor antagonist analog containing the amino acid sequence of SEQ ID NO: 19 may have the following structure, but is not limited thereto:
  • the GLP-1 receptor antagonist analog containing the amino acid sequence of SEQ ID NO: 21 may have the following structure, but is not limited thereto:
  • the GLP-1 receptor antagonist analog containing the amino acid sequence of SEQ ID NO: 22 may have the following structure, but is not limited thereto:
  • the GLP-1 receptor antagonist analog may be an acylated GLP-1 receptor antagonist analog conjugate to which an acyl group is bound, but is not limited thereto.
  • GLP-1 receptor antagonist analog may refer to either acylated or non-acylated GLP-1 receptor antagonist analog.
  • Acylation is known as a method to improve the pharmacokinetic and pharmacodynamic properties of peptide drugs.
  • peptide drugs there is a problem that it is difficult to exert medicinal effects due to enzyme decomposition in the body. Accordingly, by blocking the enzyme action site through acylation of the peptide, which attaches a fatty acid to the peptide, the stability of the peptide drug can be increased and the half-life can be increased.
  • the GLP-1 receptor antagonist analogs of the present invention may be in acylated form to increase half-life.
  • acylated GLP-1 receptor antagonist analog conjugate In the present invention, it may be used interchangeably with “acylated GLP-1 receptor antagonist analog conjugate”, “acylated GLP-1 receptor antagonist analog”, “acylated analog”, or “conjugate”.
  • the acylated GLP-1 receptor antagonist analog conjugate of the present invention may have an acyl group attached to the amino acid through a linker, and the linker may contain AEEA ((2-(2-aminoethoxy)ethoxy)acetic acid). and, more specifically, ⁇ Glutamate may be additionally linked, but is not limited thereto.
  • An example of a specific linker may be ( ⁇ Glu) m -(AEEA) n , where m and n may each independently be an integer of 0, 1, 2, 3, or more, but is not limited thereto.
  • the acyl group can be bound to the amine group, hydroxy group, thiol group, carboxyl group, etc. of the amino acid of the GLP-1 receptor antagonist analog through the amine group, hydroxy group, thiol group, etc. of the linker, but the acyl group can be bound to the GLP-1 receptor antagonist analog.
  • the linker may be covalently bonded to an acyl group, and may be linked to the acyl group in 1, 2, 3, or more repetitions, but is not limited thereto.
  • the acyl group used in the acylation may be a carbon chain of any length and may be linear or branched.
  • the chains may include linear aliphatic chains, branched aliphatic chains, chains containing cyclic alkyl moieties, hydrophobic natural products such as steroids, aralkyl chains, or alkyl chains containing acyl moieties. there is.
  • the acylated GLP-1 receptor antagonist analog is acylated with a C1-C30 straight or branched chain acyl group containing one or more, two or more, specifically one or two carboxylic acids.
  • the acyl group may be a fatty acid or dicarboxylic acid, specifically a C4 to C30 fatty acid or dicarboxylic acid, but is not limited thereto.
  • it may be a fatty acid or dicarboxylic acid of C16, C18, C20, C22, C24, C26, C28, or C30.
  • acyl groups include bile acids such as cholic acid, chenodeoxycholic acid, deoxycholic acid, lithocholic acid, taurocholic acid, glycocholic acid, and cholesterol acid, succinic acid or succinic acid derivatives, maleic acid, or maleic acid derivatives. , but is not limited to this.
  • the acylated GLP-1 receptor antagonist analog of the present invention may be prepared by attaching an acyl group to the GLP-1 receptor antagonist analog by a method known in the art, or by synthesizing a peptide using an acylated amino acid. , but is not limited to this.
  • the acylated GLP-1 receptor antagonist analog may be in the form of an acyl group directly attached to an amino acid residue of the GLP-1 receptor antagonist analog.
  • an acyl group may be attached through an ester, thioester, or amide bond, but is not limited thereto.
  • the acylated GLP-1 receptor antagonist analog may be one in which amino acid residues having an amine, hydroxyl, or thiol group are acylated.
  • the acylated GLP-1 receptor antagonist analog may be acylated on an amino acid or lysine residue located at the C-terminus, but is not limited thereto.
  • the acylated amino acid of the acylated GLP-1 receptor antagonist analog may include, but is not limited to, any one of the amino acids represented by K(1) to K(4) below:
  • the acylated GLP-1 receptor antagonist analog conjugate of the present invention may contain an acylated amino acid at positions 8, 23, 24, or 36, but is not limited thereto.
  • the GLP-1 receptor antagonist analog according to the present invention includes any one of the amino acid sequences of SEQ ID NOs: 1 to 22, specifically an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 22 (essentially ), but is not limited to this.
  • the GLP-1 receptor antagonist analog includes any one of the amino acid sequences of SEQ ID NOs: 1 to 12, and specifically (essentially) consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 12. It may be, but is not limited to this.
  • the GLP-1 receptor antagonist analog includes any one sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs: 3, 7 to 12, 21, and 22, specifically SEQ ID NOs: 3, 7 to 22. It may (essentially) consist of an amino acid sequence selected from the group consisting of 12, 21, and 22, but is not limited thereto.
  • the GLP-1 receptor antagonist analog includes any one sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs: 17, 19, 21, and 22, specifically SEQ ID NOs: 17, 19, 21, and 22, but is not limited thereto.
  • the acylated GLP-1 receptor antagonist analog conjugate according to the present invention includes any one of the sequences of SEQ ID NOs: 13 to 22, specifically selected from the group consisting of SEQ ID NOs: 13 to 22. It may (essentially) consist of an amino acid sequence, but is not limited thereto.
  • the GLP-1 receptor antagonist analog of the present invention has the amino acid sequence of SEQ ID NO: 1 to 22 and 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81% , 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98 %, or may contain an amino acid sequence having more than 99% homology or identity, but is not limited thereto, as long as it can exert an antagonistic effect by acting on the GLP-1 receptor.
  • the term 'homology' or 'identity' refers to the degree to which two given amino acid sequences or base sequences are related to each other and can be expressed as a percentage.
  • Sequence homology or identity of conserved polypeptides is determined by standard alignment algorithms, which may be used with default gap penalties established by the program used. Substantially homologous or identical sequences are generally capable of hybridizing to all or part of a sequence under moderate or high stringent conditions. It is obvious that hybridization also includes hybridization with a polynucleotide containing a common codon or a codon taking codon degeneracy into account.
  • Whether any two peptide sequences have homology, similarity, or identity can be determined, for example, by Pearson et al (1988) [Proc. Natl. Acad. Sci. USA 85]: It can be determined using a known computer algorithm such as the "FASTA” program using default parameters as in 2444. Or, as performed in the Needleman program in the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16: 276-277) (version 5.0.0 or later), It can be determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453).
  • GAP program is defined as the total number of symbols in the shorter of the two sequences divided by the number of similarly aligned symbols (i.e., nucleotides or amino acids).
  • the default parameters for the GAP program are (1) a binary comparison matrix (containing values 1 for identity and 0 for non-identity) and Schwartz and Dayhoff, eds., Atlas Of Protein Sequence And Structure, National Biomedical Research Foundation, pp.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention has about 1% or more activity (100%) compared to the activity (100%) of exendin-3 (9-39), a known GLP-1 receptor antagonist. , more than 10%, more than 30%, more than 50%, more than 70%, more than 80%, more than 90%, more than 100%, more than 150%, more than 200%, more than 250%, more than 300%, or more than 350%. It may represent.
  • the term "about” is a range that includes ⁇ 0.5, ⁇ 0.4, ⁇ 0.3, ⁇ 0.2, ⁇ 0.1, etc., and includes all values in a range that are equivalent or similar to the value following the term "about.” Not limited.
  • the activity of such a GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate can be measured by methods known in the art and is not limited to a specific method.
  • the antagonistic action of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog of the present invention can be analyzed by measuring the concentration of cAMP, the production of which is inhibited by the GLP-1 receptor antagonist analog.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate according to the present invention may be one in which the N-terminus and/or C-terminus of the peptide are unmodified, but it is not modified from protein cleavage enzymes in vivo.
  • forms in which the N-terminus and/or C-terminus thereof are chemically modified or protected with an organic group, or in which amino acids are added to the peptide terminus, etc. are modified are also included within the scope of the present invention.
  • the N- and C-termini are charged, so to remove these charges, the N-terminus is acetylated and/or the C-terminus is amidated. It can be done, but is not particularly limited thereto.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate according to the present invention may be amidated at the C-terminus, or may be amidated at the C-terminus and acylated at the same time. It is not limited to this.
  • the description or claims of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate according to the present invention refers to the analog or conjugate as well as the analog. It also applies to a category that includes both salts of the conjugate (e.g., pharmaceutically acceptable salts of the peptide), or solvates thereof. Accordingly, the contents of the specification also apply to the specific salt, the specific solvate, and the specific solvate of the specific salt.
  • This salt form may be, for example, a form using any pharmaceutically acceptable salt.
  • the type of salt is not particularly limited. However, it is desirable to be in a form that is safe and effective for individuals, such as mammals, but is not particularly limited thereto.
  • pharmaceutically acceptable refers to a substance that can be effectively used for the desired purpose without causing excessive toxicity, irritation, or allergic reactions, within the scope of medical judgment.
  • the term “pharmaceutically acceptable salt” includes salts derived from pharmaceutically acceptable inorganic acids, organic acids, or bases.
  • suitable acids include hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, perchloric acid, fumaric acid, maleic acid, phosphoric acid, glycolic acid, lactic acid, salicylic acid, succinic acid, toluene-p-sulfonic acid, tartaric acid, acetic acid, citric acid, methanesulfonic acid, and formic acid.
  • Salts derived from suitable bases may include alkali metals such as sodium and potassium, alkaline earth metals such as magnesium, and ammonium.
  • solvate used in the present invention refers to a complex in which the peptide, conjugate, or salt thereof according to the present invention forms a complex with a solvent molecule.
  • analog of the present invention can be synthesized by methods well known in the field, for example, using an automatic peptide synthesizer, and can also be produced by genetic engineering technology.
  • analogs of the invention can be prepared by standard synthetic methods, recombinant expression systems, or any other art methods. Accordingly, the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate according to the present invention can be synthesized by a number of methods, including, for example, methods including:
  • Another embodiment of the present invention provides a composition comprising the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate is as described above.
  • the composition may be a pharmaceutical composition, and more specifically, the composition may be used for the prevention or treatment of congenital hyperinsulinism or hypoglycemia.
  • a specific aspect of the present invention is a pharmaceutical composition for treating or preventing congenital hyperinsulinism or hypoglycemia, comprising a pharmaceutically effective amount of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate.
  • Including the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate in a pharmaceutically effective amount provides the desired pharmacological activity (e.g., prevention, improvement or treatment of congenital hyperinsulinism or hypoglycemia). It refers to the level that can be obtained, and may also refer to a pharmaceutically acceptable level at which toxicity or side effects do not occur or are minimal in the administered subject, but is not limited thereto. Such a pharmaceutically effective amount can be determined by comprehensively considering the number of administrations, patient, dosage form, etc.
  • prevention refers to suppressing the development of a desired disease, such as congenital hyperinsulinism or hypoglycemia, by administering the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or a composition containing them. or any act of delaying, and "treatment” refers to the disease for which the administration of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or a composition containing them, such as congenital hyperinsulinism or It refers to any action that improves or benefits the symptoms of hypoglycemia.
  • the term "administration" means introducing a predetermined substance into a patient by any appropriate method, and the route of administration of the composition is not particularly limited thereto, but is any general route by which the composition can reach the target in vivo. It can be administered through, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc. .
  • Congenital hyperinsulinism of the present invention is one of the diseases that cause severe and persistent hypoglycemia in newborns and children. It can be caused by temporary increase in insulin secretion in low birth weight babies or in babies born to diabetic mothers, or abnormal function of pancreatic cells due to genetic mutation.
  • Hypoglycemia of the present invention refers to a condition in which the blood sugar level is lower than that of a normal person. It usually refers to when blood sugar is below 50 mg/dl, but is not particularly limited thereto.
  • the hypoglycemia includes both acute hypoglycemia and chronic hypoglycemia.
  • hypoglycemia Symptoms of hypoglycemia include weakness, tremors, pallor, cold sweat, dizziness, excitement, anxiety, heart palpitations, hunger, headache, and fatigue. If hypoglycemia persists for a long time, convulsions or seizures may occur, and shock may occur and loss of consciousness may occur.
  • the hypoglycemia may be post-obesity hypoglycemia (PBH), and more specifically, may be hypoglycemia caused by bariatric surgery, but is not limited thereto.
  • PHB post-obesity hypoglycemia
  • “Hypoglycemia after obesity” or “hypoglycemia due to bariatric surgery” of the present invention refers to hypoglycemia experienced by patients after bariatric surgery such as sleeve gastrectomy, duodenal bypass, and Roux-Y gastric bypass, and is caused by dumping syndrome, one of the complications. It may also occur.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention has an antagonistic action on the GLP-1 receptor, thereby increasing the blood sugar level in the body and/or reducing the secretion of insulin, thereby causing congenital hyperinsulinism or It may have a preventive or therapeutic effect on hypoglycemia, but is not limited thereto.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, excipient, or diluent.
  • pharmaceutically acceptable means a sufficient amount to produce a therapeutic effect and not to cause side effects, and refers to the type of disease, the patient's age, weight, health, gender, and the patient's sensitivity to the drug. , can be easily determined by a person skilled in the art according to factors well known in the medical field, such as administration route, administration method, administration frequency, treatment period, combination, or drugs used simultaneously.
  • the pharmaceutical composition containing the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention may further include a pharmaceutically acceptable carrier.
  • the carrier is not particularly limited thereto, but for oral administration, binders, lubricants, disintegrants, excipients, solubilizers, dispersants, stabilizers, suspending agents, colorants, flavorings, etc. may be used.
  • buffers, Preservatives, analgesics, solubilizers, isotonic agents, stabilizers, etc. can be mixed and used, and for topical administration, bases, excipients, lubricants, preservatives, etc. can be used.
  • the formulation of the composition of the present invention can be prepared in various ways by mixing it with a pharmaceutically acceptable carrier as described above.
  • a pharmaceutically acceptable carrier for example, for oral administration, it can be manufactured in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, it can be manufactured in the form of unit dosage ampoules or multiple dosage forms.
  • it can be formulated as a solution, suspension, tablet, pill, capsule, sustained-release preparation, etc.
  • examples of carriers, excipients and diluents suitable for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, Microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or mineral oil may be used.
  • fillers, anti-coagulants, lubricants, wetting agents, fragrances, preservatives, etc. may be additionally included.
  • the pharmaceutical composition of the present invention is any one selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, oral solutions, emulsions, syrups, sterilized aqueous solutions, non-aqueous solvents, freeze-dried preparations, and suppositories. It may have a formulation of .
  • composition is formulated into a unit dosage form suitable for administration into the patient's body, specifically a preparation useful for the administration of peptide medicines, according to a method commonly used in the pharmaceutical field, and is administered as commonly used in the art.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate can be used by mixing with various pharmaceutically acceptable carriers, such as physiological saline or organic solvents, to increase stability or absorption.
  • various pharmaceutically acceptable carriers such as physiological saline or organic solvents.
  • carbohydrates such as glucose, sucrose or dextran, antioxidants such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers can be used as drugs.
  • the dosage and frequency of administration of the pharmaceutical composition of the present invention are determined depending on the type of drug that is the active ingredient, along with various related factors such as the disease to be treated, the route of administration, the patient's age, gender and weight, and the severity of the disease.
  • the pharmaceutical composition of the present invention may contain the ingredients (active ingredients) in an amount of 0.01 to 99% by weight to volume.
  • the total effective amount of the composition of the present invention can be administered to a patient in a single dose, or can be administered by a fractionated treatment protocol in which multiple doses are administered over a long period of time.
  • the pharmaceutical composition of the present invention may vary the content of the active ingredient depending on the severity of the disease.
  • a preferred total dose of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention may be about 0.3 to 0.9 mg per kg of patient body weight per day.
  • the dosage is the mass value of the GLP-1 receptor antagonist analog; Alternatively, it may be determined based on the mass value excluding the mass of the fatty acid portion of the GLP-1 receptor antagonist analog of the acylated GLP-1 receptor antagonist analog conjugate, that is, the sum of the masses of only the polypeptide portions.
  • the dosage of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate depends not only on the administration route and number of treatments of the pharmaceutical composition, but also on the patient's age, weight, health status, gender, severity of the disease, diet, and Since the effective dosage for a patient is determined by considering various factors such as excretion rate, taking this into consideration, a person with ordinary knowledge in the art can determine the appropriate effective dosage according to the specific use of the composition of the present invention. There will be.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route, and administration method as long as it exhibits the effects of the present invention.
  • the pharmaceutical composition of the present invention may have excellent in vivo persistence and potency, and may require a lower number and frequency of administration than other drugs, but is not particularly limited thereto.
  • Another embodiment of the present invention is to treat congenital hyperinsulinism or hypoglycemia, comprising administering the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or a composition containing the same, to a subject.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, composition containing the same, congenital hyperinsulinism, hypoglycemia, prevention, and treatment are as described above.
  • the subject is an entity suspected of having congenital hyperinsulinism or hypoglycemia
  • the subject suspected of congenital hyperinsulinism or hypoglycemia is a mammal, including humans, rats, livestock, etc., that have or may develop the disease.
  • subjects that can be treated with the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention, or the composition containing the same are included without limitation.
  • a pharmaceutical composition containing the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate of the present invention to a subject suspected of having congenital hyperinsulinism or hypoglycemia, the subject can be efficiently treated.
  • Congenital hyperinsulinism or hypoglycemia is as described above.
  • the method of the present invention may include administering a pharmaceutical composition containing a peptide in a pharmaceutically effective amount.
  • the appropriate total daily amount can be determined by the treating physician within the scope of sound medical judgment, and can be administered once or in several divided doses.
  • the specific therapeutically effective amount for a particular patient depends on the type and degree of response to be achieved, the specific composition, including whether other agents are used as the case may be, the patient's age, weight, and general health status, It is desirable to apply it differently depending on various factors including gender and diet, administration time, administration route and secretion rate of the composition, treatment period, drugs used together or simultaneously with the specific composition, and similar factors well known in the medical field.
  • the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or a composition containing the same can be administered through a general route that can reach the target in vivo, and the administration route Can be, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc.
  • Another embodiment of the present invention provides a use of the GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or the composition, for the prevention or treatment of congenital hyperinsulinism or hypoglycemia.
  • the GLP-1 receptor antagonist analog, the acylated GLP-1 receptor antagonist analog conjugate, the composition, congenital hyperinsulinism, and hypoglycemia are as described above.
  • Another embodiment of the present invention is a GLP-1 receptor antagonist analog or acylated GLP-1 receptor antagonist analog conjugate, or the composition is used as a drug (or pharmaceutical composition) for the prevention or treatment of congenital hyperinsulinism or hypoglycemia. It is provided for use in the manufacture of.
  • the GLP-1 receptor antagonist analog, the acylated GLP-1 receptor antagonist analog conjugate, the composition, congenital hyperinsulinism, and hypoglycemia are as described above.
  • the synthesis of the GLP-1R antagonist analog was performed using an automatic peptide synthesizer (Symphony X, Gyros Protein Tech.) using solid-phase synthesis. Rink amide resin was used for amidation of the C-terminus. Each amino acid was synthesized in order from C-terminus to N-terminus.
  • Fmoc (9H-fluoren-9-ylmethoxycarbonyl) protected amino acid, (4 equivalents compared to peptide-resin), HOBt (1-hydroxybenzotriazole, 4 equivalents compared to peptide-resin), DIC ( Amino acids were sequentially combined using diisopropylcarbodiimide (8 equivalents compared to peptide-resin).
  • acylated GLP-1R antagonist analog conjugate was synthesized in the same manner as above using acylated amino acids K(1) to (4).
  • the Fmoc protecting group was removed by adding 8 mL of 20% piperidine/DMF (2 x 5 minutes) to the reaction vessel containing the resin in the automatic synthesizer. To remove remaining impurities, each process was washed with 12 mL of DMF (6 x 10 seconds). After synthesis was completed, the N-terminus was acetylated with 6 mL of 34% Acetic anhydride/DMF and 3.5 mL of 14% N,N-diisopropyl/DMF. Protecting groups that were not removed were also deprotected when the peptide was cleaved from the resin.
  • K(1) to (4) mean that the amino acid corresponding to the position is an acylated amino acid having the above structure.
  • the synthesized GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate were purified using reverse phase chromatography.
  • the purity of the synthesized peptide was confirmed using an analytical liquid chromatogram (RP-HPLC), and if it was over 90%, it was judged to be usable for experimentation.
  • RP-HPLC analytical liquid chromatogram
  • the molecular weight and information of the peptide were confirmed using liquid chromatogram/mass spectrometry (LC/MS).
  • the synthesized peptide was stored at -20°C until used in the experiment.
  • GLP-1 receptor (GLP-1R) antagonist analogue and acylated GLP-1 receptor (GLP-1R) antagonist analog conjugate in vitro active check
  • a method of measuring cell activity in vitro was used using a cell line transformed with human GLP-1R (hGLP-1R). .
  • hGLP-1R human GLP-1R
  • Each of the above cell lines was transformed into CHO (Chinese hamster ovary) to express human GLP-1R, and is suitable for measuring the activity of GLP-1R antagonists.
  • GLP-1R antagonist analog To measure the activity of GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate, human GLP-1 was diluted three times from 9000 pM to 0.15 pM. To confirm antagonism, a comparative substance [Exendin-3 (9-39) amide (Tocris Bioscience, UK, Cat No. 2081), SEQ ID NO. 24], GLP-1R antagonist analogue was added to the plate to which 0.1 nM of GLP-1 was added. (SEQ ID NOs: 1 to 12), and acylated GLP-1R antagonist analog conjugates (SEQ ID NOs: 13 to 22) were serially diluted from 9000 nM to 0.15 nM in three folds.
  • the CHO cells expressing the human GLP-1R were cultured in a 384-well plate for 24 hours, the culture medium was removed, and 10 ⁇ L of each serially diluted material was added to the plate and incubated at room temperature for 30 minutes. Then, 5 ⁇ L of Eu-cAMP tracer was added, followed by 5 ⁇ L of buffer containing cAMP antibody, and reacted at room temperature for 60 minutes. The cell lysate upon completion of the reaction was applied to the LANCE Ultra cAMP kit (PerkinElmer, USA) to determine the degree to which cAMP production was inhibited by the GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate at the half maximum inhibitory concentration. After calculating the (IC 50 ) values, they were compared. As a result, the relative activity compared to the comparative material is shown in Table 2 below.
  • the GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate of the present invention prepared in Example 1 act on the human GLP-1 receptor (GLP-1R) and have an antagonistic effect on the GLP-1 receptor. It was confirmed that it can be done.
  • a method of measuring cell activity in vitro using human (hGLP-1R) or mouse (mGLP-1R) GLP-1R transfected cell lines is used. did. Each of the above cell lines was transformed into CHO (Chinese hamster ovary) to express human and mouse GLP-1R, respectively, and is suitable for measuring the activity of GLP-1R antagonists.
  • acylated GLP-1R antagonist analog conjugate human GLP-1 was diluted three times from 9000 pM to 0.15 pM.
  • a comparative substance [Exendin-3 (9-39) amide (Tocris Bioscience, UK, Cat No. 2081), SEQ ID NO. 24] and acylated GLP-1 were added to a plate containing 0.1 nM of GLP-1.
  • 1R antagonist analog conjugates (SEQ ID NOs: 17, 19, 21, 22) were serially diluted in triplicate from 9000 nM to 0.15 nM.
  • acylated GLP-1R antagonist analog conjugates of SEQ ID NOs: 17, 19, 21, and 22 used in this example each have the structures (i) to (iv) below:
  • the analog conjugates were prepared by diluting them in a buffer containing 1% human serum albumin and mouse serum albumin. After culturing the CHO cells expressing the human GLP-1R and mouse GLP-1R in a 384-well plate for 24 hours, the culture medium was removed, and 10 ⁇ L of each serially diluted material was added to the plate and incubated at room temperature for 30 minutes. Cultured. Then, 5 ⁇ L of Eu-cAMP tracer was added, followed by 5 ⁇ L of buffer containing cAMP antibody, and reacted at room temperature for 60 minutes.
  • the cell lysate upon completion of the reaction was applied to the LANCE Ultra cAMP kit (PerkinElmer, USA) to determine the degree to which cAMP production was inhibited by the GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate at the half maximum inhibitory concentration. After calculating the (IC 50 ) values, they were compared. As a result, the relative activity compared to the comparative material is shown in Table 3 below.
  • Relative activity ratios of acylated GLP-1R antagonist analog conjugates In vitro activity (%) compared to comparative material hGLP-1R/CHO cell line mGLP-1R/CHO cell line sequence number Albumin-free conditions 1% human serum albumin condition Albumin-free conditions 1% mouse serum albumin condition Comparative material (SEQ ID NO: 24) 100 100 100 100 SEQ ID NO: 17 91.8 4.3 50.1 9.2 SEQ ID NO: 19 33.6 2.4 12.6 3.2 SEQ ID NO: 21 380.1 29.4 95.7 27.0 SEQ ID NO: 22 251.9 11.5 162.7 32.7
  • the GLP-1R antagonist analog and acylated GLP-1R antagonist analog conjugate prepared in Example 1 can act on both human and mouse GLP-1R receptors to produce antagonism, and in particular, as specified in Table 3, they act as antagonists.
  • SEQ ID Nos. 21 and 22 with C16 fatty acids have superior activity compared to comparative substances, and SEQ ID No. 17 with C18 fatty acids and SEQ ID No. 19 with C20 fatty acids. The titer could be confirmed.
  • mice C57BL/6N mice were used as an animal model. The experiment was performed on 8-week-old male mice. During the study, mice were housed in groups of 5 and had free access to drinking water. Lights were turned off from 6 PM to 6 AM.
  • test groups were group 1: excipient (subcutaneous administration)-control group (vehicle), group 2: Exendin-3 (9-39) 3690 ⁇ g/kg (1095.0 nmol/kg, subcutaneous administration), group 3: GLP-1R antagonist analog.
  • Conjugate SEQ ID NO: 17) 3690 ⁇ g/kg (1061.9 nmol/kg, subcutaneous administration)
  • Group 4 GLP-1R antagonist analog conjugate (SEQ ID NO: 17) 7380 ⁇ g/kg (2123.8 nmol/kg, subcutaneous administration).
  • Drug administration was completed 24 hours before the oral glucose tolerance test (OGTT) for Groups 1, 3, and 4, and 30 minutes before the oral glucose tolerance test (OGTT) for Group 2.
  • the dosage is a value expressed based on the total mass of the acylated GLP-1 receptor antagonist analog conjugate minus the mass of the fatty acid portion, that is, the sum of the masses of only the polypeptide portions.
  • the GLP-1R antagonist analog conjugate of SEQ ID NO: 17 increased blood glucose levels in the body compared to the control group at all administered doses (FIG. 1). This suggests that the GLP-1R antagonist analog or acylated GLP-1R antagonist analog conjugate according to the present invention may have a therapeutic effect on congenital hyperinsulinism due to its blood sugar control ability.
  • Example 5 Blood glucose control effect of GLP-1 receptor (GLP-1R) antagonist analog conjugate (SEQ ID NO: 17) in a rat model of postbariatric hypoglycemia (PBH) induced by vertical sleeve gastrectomy (VSG) check
  • a PBH rat model was created by performing sham operation or VSG surgery on SD rats. The rats consumed a high fat diet (HFD) for 19 weeks, and 10 rats were randomly grouped and divided into two groups (excipient control group and GLP-1R antagonist analog conjugate administration group). A mixed meal tolerance test (MMTT) was performed 4 hours after subcutaneous administration of 3720 ⁇ g/kg (1070.5 nmol/kg) of excipient and GLP-1R antagonist analog conjugate (SEQ ID NO: 17).
  • HFD high fat diet
  • MMTT mixed meal tolerance test
  • MMTT was performed in all groups by orally administering 2 mL of mixed formula (Ensure Plus ® , Abbott, USA) at a time after a 5-hour fast, and then taking blood samples continuously at intervals of 0, 15, 30, 45, Blood sugar levels were measured (GDoctor, Allmedicus Co., Korea) at 60 and 120 minutes.
  • Statistical treatment was compared between the VSG rat vehicle group (control group) and the test group using one-way ANOVA (* ⁇ ***p ⁇ 0.05 ⁇ 0.001).
  • the dosage is a value expressed based on the total mass of the acylated GLP-1 receptor antagonist analog conjugate minus the mass of the fatty acid portion, that is, the sum of the masses of only the polypeptide portions.
  • the GLP-1 receptor analogue and acylated GLP-1 receptor analogue prepared in the present invention function as an antagonistic agonist for the GLP-1 receptor, and based on this activity, it was confirmed that the It was confirmed that it can be used as a useful treatment for insulinism and hypoglycemia, especially post-obesity hypoglycemia.

Abstract

본 발명은 신규한 GLP-1 수용체 길항제 아날로그 및 아실화된 GLP-1 수용체 아날로그, 및 이들의 선천성 고인슐린증 또는 저혈당증에 대한 예방 또는 치료 용도에 관한 것이다.

Description

신규한 GLP-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물
본 발명은 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물에 관한 것이다.
저혈당증(hypoglycemia)은 정상인 기준 (공복의 경우 60~120㎎/㎗, 식사 2시간 후의 혈당은 140㎎/㎗ 이하)에 비해 낮은 혈당인 상태를 의미하는데, 보통 혈당이 50mg/dl 이하일 때 저혈당인 것으로 판단한다.
경구용 혈당 강하제나 인슐린을 과량 투여하는 경우, 공복 상태가 오래 유지될 경우, 활동량이나 운동량이 과할 경우 저혈당이 발생할 수 있다. 또는 중증의 신체적 질환, 부신 피질 호르몬이나 글루카곤 등의 호르몬 결핍, 인슐린 생성 췌장 종양, 인슐린에 대한 자가면역 질환이 있는 경우, 위절제술 환자, 유전성 탄수화물 대사효소 이상 질환 등의 요인에 의해서도 저혈당이 발생할 수 있다.
한편, 선천성 고인슐린증(congenital hyperinsulinism, CHI)은 신생아와 소아에서 발생하는 심각하고 지속적인 저혈당을 일으키는 가장 흔한 원인 질환 중 하나이다. 인슐린은 인체 내에서 혈당을 조절하는 호르몬으로, 음식물 섭취 등으로 혈당이 상승할 경우 혈당을 낮추는 역할을 하는데 선천성 고인슐린증 환자에서는 이러한 조절 역할을 하지 못하고 혈당에 관계없이 췌장에서 인슐린을 분비한다. 그 결과 환자들은 저혈당에 빠지게 된다.
저혈당증 또는 선천성 고인슐린증으로 인한 저혈당이 발생하면 뇌세포가 주로 사용하는 포도당, 케톤, 젖당 등을 유지하지 못하며, 체내의 단백질이나 지방으로부터의 에너지 공급을 차단하여 뇌세포의 손상을 입게 되고 그 결과 경련질환, 학습장애, 뇌성마비, 실명, 심하게는 사망에도 이르게 된다.
상기 저혈당은 일시적으로 과다한 인슐린 분비로 인해 일어날 수 있고, 또한 태아절박가사 (fetal distress)를 겪은 영아에서도 저혈당이 발생할 수 있다. 인슐린 이상 분비의 원인은 뚜렷하지 않지만 이런 경우에는 며칠에서 몇 달 내에 호전이 된다. 당뇨가 있던 산모에게서 당 조절이 잘 되지 않을 경우에도 일과성으로 저혈당이 발생할 수 있으나 수유가 잘 진행되어 저혈당이 사라지면 다시 재발하지는 않는다. 또 다른 원인에는 몇 가지 유전적 결함에 따른 지속성 고인슐린증이 있다. 유전적 결함에 의한 고인슐린증의 원인으로는 11p15.1 염색체에 있는 SUR 또는 Kir6.2 유전자의 돌연변이, 7p15-p13 염색체에 있는 GK (glucokinase) 유전자 돌연변이로 GK 활성도가 증가, GDH (Glutamate dehydrogenase) 유전자 돌연변이로 GDH가 활성화 되고 이로 인하여 베타 섬세포 내 ATP가 증가한다는 등의 연구가 보고되었다.
또한, 고도비만과 비만에 따른 합병증의 치료를 위해 수행되는 비만대사수술은 복강경 조절형 위밴드술(laparoscopic adjustable gastric banding, LAGB), 루와이 위우회술(Roux-en-Y gastric bypass, RYGB), 위 소매 절제술(sleeve gastrectomy, SG), 담도췌장 우회술(biliopancreatic diversion, BPD)로 구분되는데, 비만대사수술의 합병증으로 덤핑증후군(dumping syndrome)에 의한 저혈당증이 보고되고 있다.
GLP-1 수용체 길항제는 식욕 증진 등의 목적으로 투여되는 약제로(KR 10-2001-0089563 A), 대표적으로 엑센딘-3(9-39)가 있으며 (Indraneel Banerjee, Mark J. Dunne, in Encyclopedia of Endocrine Diseases (Second Edition), 2019), 엑센딘-3(9-39) 투여 시 인슐린 분비가 억제되고 급성 저혈당의 치료 효과가 보고된 바 있다 (Calabria AC, Li C, Gallagher PR, Stanley CA, De Leon DD. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital hyperinsulinism owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012;61(10):2585-2591. doi:10.2337/db12-0166).
아직 GLP-1 수용체 길항제를 이용한 선천성 고인슐린증과 저혈당 치료제의 개발은 미비한 상태이며, 효과적인 치료제 개발이 요구된다.
본 발명의 하나의 목적은 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 GLP-1 수용체 길항제 아날로그, 아실화된 GLP-1 수용체 길항제 아날로그 결합체 또는 이를 포함하는 조성물의 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료 용도를 제공하는 것이다.
본 발명의 다른 하나의 목적은 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 포함하는 선천성 고인슐린증 또는 저혈당증 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 약학적 조성물을 필요로 하는 개체에 투여하는 단계를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료 방법을 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 GLP-1 수용체 길항제 아날로그, 아실화된 GLP-1 수용체 길항제 아날로그 결합체 또는 이를 포함하는 조성물을 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료를 위한 약제를 제공하기 위한 용도를 제공하는 것이다.
본 발명의 GLP-1 수용체 길항제 아날로그 결합체 및 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 GLP-1 수용체에 작용하여 길항제로서 기능할 수 있으며, 이를 통해 선천성 고인슐린증 또는 저혈당증에 대한 예방 또는 치료 효과를 가질 수 있다.
도 1은 본 발명에 따른 아실화된 GLP-1 수용체 길항제 아날로그 결합체(서열번호 17)의 시간에 따른 혈당 수준을 측정한 결과를 나타낸 도이다.
도 2는 본 발명에 따른 아실화된 GLP-1 수용체 길항제 아날로그 결합체(서열번호 17)의 투여에 따른 위소매절제술 랫드에서 혈당 수준을 측정한 결과를 나타낸 도이다.
도 3은 본 발명에 따른 아실화된 GLP-1 수용체 길항제 아날로그 결합체(서열번호 17)의 투여에 따른 위소매절제술 랫드에서 혈장 인슐린의 수준을 측정한 결과를 나타낸 도이다.
본 발명의 하나의 양태는 신규한 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그이다.
하나의 구체예로서, 상기 GLP-1 수용체 길항제 아날로그는 하기 일반식 1로 표시되는 것을 특징으로 한다:
X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-E-E-X13-A-X15-R-X17-F-I-X20-W-L-X23-X24-G-G-P-S-S-G-A-P-P-P-S-X36(일반식 1, 서열번호 25)
상기 일반식 1에서,
X1은 트레오닌, 또는 부존재하고;
X2는 페닐알라닌, 또는 부존재하고;
X3은 트레오닌, 또는 부존재하고;
X4는 세린, 또는 부존재하고;
X5는 아스파르트산 또는 부존재하고;
X6은 류신, 발린, 또는 부존재하고;
X7은 세린, 또는 부존재하고;
X8은 알라닌, 라이신, 세린, 또는 부존재하고;
X9는 글루타민 또는 티로신이고;
X10은 메티오닌, 또는 류신이고;
X13은 글루탐산, 또는 글루타민이고;
X15는 알라닌, 또는 발린이고;
X17은 류신, 또는 글루탐산이고;
X20은 글루탐산, 또는 알라닌이고;
X23은 라이신, 발린, 또는 아실화된 아미노산이고;
X24는 아스파라긴, 라이신, 또는 아실화된 아미노산이고;
X36은 시스테인, 라이신, 아실화된 아미노산, 또는 부존재하고;
상기 -은 펩타이드 결합을 나타냄.
다른 구체예로서, 상기 GLP-1 수용체 길항제 아날로그는
상기 일반식 1에서,
X5는 아스파르트산이고;
X6은 류신, 발린이고;
X7은 세린이고;
X8은 라이신, 또는 세린이고;
X15는 발린이고;
X23은 라이신, 또는 발린이고;
X24는 아스파라긴, 또는 라이신인 것을 특징으로 한다.
또 다른 구체예로서, 상기 GLP-1 수용체 길항제 아날로그는
상기 일반식 1에서,
X1 내지 X4는 부존재하고;
X5는 아스파르트산이고;
X6은 류신이고;
X7은 세린이고;
X8은 세린이고;
X9는 티로신이고;
X10은 류신이고;
X13은 글루탐산이고;
X15는 발린이고;
X17은 류신이고;
X20은 글루탐산이고;
X23은 라이신이고;
X24는 아스파라긴이고;
X36은 라이신, 또는 아실화된 아미노산인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 아실화된 아미노산은 하기 K(1) 내지 K(4)로 표시되는 아미노산 중 어느 하나인 것을 특징으로 한다:
[K(1)] C20diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000001
[K(2)] C18diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000002
[K(3)] C16acid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000003
[K(4)] C16diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000004
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 아날로그는 하나 이상의 아미노산에 직접 또는 링커를 통해 아실기가 부착된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 링커는 AEEA ((2-(2-aminoethoxy)ethoxy)acetic acid)를 포함하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 링커는 γGlu-(AEEA)2인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 링커는 AEEA를 0 내지 3개 포함하고, 상기 AEEA에 gamma-Glutamate가 0 내지 3개 연결되는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단이 아미드화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 1개 또는 2개의 카복실산을 포함한 C1-C30 직쇄 또는 분지쇄 아실기로 아실화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 아실기는 C4 내지 C30 지방산 또는 다이카복실산인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단에 위치한 아미노산 또는 라이신 잔기에 아실화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단이 아미드화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 3, 7 내지 12, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 17, 19, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 아날로그로서, 상기 GLP-1 수용체 길항제 아날로그는 하기 (i) 내지 (iv) 중 어느 하나의 구조를 갖는 것을 특징으로 한다:
(i)
Figure PCTKR2023015820-appb-img-000005
(ii)
Figure PCTKR2023015820-appb-img-000006
(iii)
Figure PCTKR2023015820-appb-img-000007
(iv)
Figure PCTKR2023015820-appb-img-000008
.
본 발명의 다른 하나의 양태는 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그를 약학적 유효량으로 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물이다.
하나의 구체예로서, 상기 약학적 조성물은 약학적으로 허용 가능한 담체를 추가로 포함하는 것을 특징으로 한다.
다른 구체예로서, 상기 약학적 조성물은 투여시 개체의 혈당 수준을 높이는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 약학적 조성물로서, 상기 약학적 조성물은 투여시 개체의 인슐린의 분비를 감소시키는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 약학적 조성물로서, 상기 저혈당증은 비만 후 저혈당증 (Postbariatric Hypoglycemia, PBH)인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 약학적 조성물로서, 상기 비만 후 저혈당증은 비만대사 수술 (bariatric surgery)에 의한 것을 특징으로 한다.
본 발명의 또 다른 하나의 양태는 상기 GLP-1 수용체 길항제 아날로그, 아실화된 GLP-1 수용체 길항제 아날로그, 또는 이를 포함하는 조성물의 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료 용도 이다.
본 발명의 또 다른 하나의 양태는 상기 GLP-1 수용체 길항제 아날로그, 아실화된 GLP-1 수용체 길항제 아날로그, 또는 이를 포함하는 조성물의 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료를 위한 약제를 제공하기 위한 용도 이다.
본 발명을 실시하기 위한 구체적인 내용을 설명하면 다음과 같다. 한편, 본원에서 개시된 각각의 설명 및 실시 형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본원에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술되는 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 할 수 없다.
본 명세서 전반을 통하여, 천연적으로 존재하는 아미노산에 대한 통상의 1문자 및 3문자 코드가 사용될 뿐만 아니라 Aib (2-아미노이소부티르산, 2-aminoisobutyric acid), Sar (N-methylglycine), 알파-메틸-글루탐산 (α-methyl-glutamic acid) 등과 같은 다른 아미노산에 대해 일반적으로 허용되는 3문자 코드가 사용된다. 또한 본 명세서에서 약어로 언급된 아미노산은 IUPAC-IUB 명명법에 따라 기재되었다.
알라닌 A 아르기닌 R
아스파라긴 N 아스파르트산D
시스테인 C 글루탐산 E
글루타민 Q 글리신 G
히스티딘 H 이소류신 I
류신 L 라이신 K
메티오닌 M 페닐알라닌 F
프롤린 P 세린 S
트레오닌 T 트립토판 W
티로신 Y 발린 V
본 발명의 하나의 양태는 GLP-1 수용체 길항제 아날로그 또는 상기 GLP-1 수용체 길항제 아날로그가 아실화된 결합체이다.
GLP-1은 음식물 섭취에 자극을 받아 소장에서 분비되는 호르몬으로 췌장에서의 인슐린 분비를 촉진하고 글루카곤의 분비를 억제하여 혈당 농도를 낮추는 작용을 돕는다. 또한, 포만 인자로 작용하여 위장의 소화작용을 늦추고 음식 소화물의 위장 통과시간을 지연시켜 음식물 섭취를 줄이는 역할을 지닌다.
상기와 같은 GLP-1의 혈당 조절 및 체중감소 효과를 이용하여 당뇨 및 비만 치료제의 개발이 진행되고 있으며, 대표적인 예로, GLP-1 수용체 항진제(agonist)인 엑센딘-4 (exendin-4)가 알려져 있다.
천연형 GLP-1은 다음과 같은 서열을 갖는다 (서열번호 23):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
본 발명에서, “GLP-1 수용체 길항제(antagonist)”는 GLP-1 수용체에 작용하여 GLP-1의 활성을 억제 또는 약화시키는 물질을 의미한다. 알려진 GLP-1 수용체 길항제로는 엑센딘-3(9-39)이 있다 (Montrose-Rafizaden et al., 1997,　J.Biol.Chem.　272(34):21201-21206).
엑센딘-3(9-39)는 다음과 같은 서열을 갖는다 (서열번호 24):
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
본 발명에서, “GLP-1 수용체 길항제 아날로그” 또는 “아날로그”는 GLP-1 수용체(GLP-1R)에 대한 길항 작용을 나타내는 물질을 의미한다. 이에 제한되지 않으나, 천연형 GLP-1과 비교하여 아미노산 서열에 하나 이상의 차이가 있는 펩타이드로서, 일부 서열의 치환(substitution), 추가(addition), 제거(deletion) 및 수식(modification) 중 어느 하나의 변형 방법 또는 이러한 방법들의 조합을 통하여 천연형 GLP-1 서열에서 변형된 것일 수 있다. 상기 GLP-1 수용체 길항제 아날로그는 천연적으로 존재하지 않는(non-naturally occurring) 것일 수 있다.
또한, 상기 GLP-1 수용체 길항제 아날로그의 제조를 위한 이러한 변형은 L-형 혹은 D-형 아미노산, 및/또는 비-천연형 아미노산을 이용한 변형; 및/또는 천연형 서열을 개질, 예를 들어 측쇄 작용기의 변형, 분자 내 공유결합, 예컨대, 측쇄 간 고리 형성, 메틸화, 아실화, 유비퀴틴화, 인산화, 아미노헥산화, 바이오틴화 등과 같이 개질함으로써 변형하는 것을 모두 포함한다. 또한, 상기 변형은 비 천연형 화합물로의 치환을 모두 포함한다.
또한, 상기 GLP-1 수용체 길항제 아날로그는 천연형 GLP-1의 아미노 및/또는 카르복시 말단에 하나 또는 그 이상의 아미노산이 추가된 것일 수 있으나, 이에 제한되지 않는다.
상기 치환되거나 추가되는 아미노산은 인간 단백질에서 통상적으로 관찰되는 20개의 아미노산뿐만 아니라 비정형 또는 비-자연적 발생 아미노산을 사용할 수 있다. 비정형 아미노산의 상업적 출처에는 Sigma-Aldrich, ChemPep과 Genzyme pharmaceuticals가 포함된다. 이러한 아미노산이 포함된 펩타이드와 정형적인 펩타이드 서열은 상업화된 펩타이드 합성 회사, 예를 들어 미국의 American peptide company나 Bachem, 또는 한국의 Anygen을 통해 합성 및 구매 가능하다.
하나의 구체적인 양태로서, 본 발명의 GLP-1 수용체 길항제 아날로그는 하기 일반식 1로 표시되는 GLP-1 수용체 길항제 아날로그(GLP-1 receptor antagonist analogs)일 수 있으나, 이에 제한되지 않는다:
X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-E-E-X13-A-X15-R-X17-F-I-X20-W-L-X23-X24-G-G-P-S-S-G-A-P-P-P-S-X36(일반식 1, 서열번호 25)
상기 일반식 1에서,
X1은 트레오닌, 또는 부존재하고;
X2는 페닐알라닌, 또는 부존재하고;
X3은 트레오닌, 또는 부존재하고;
X4는 세린, 또는 부존재하고;
X5는 아스파르트산 또는 부존재하고;
X6은 류신, 발린, 또는 부존재하고;
X7은 세린, 또는 부존재하고;
X8은 알라닌, 라이신, 세린, 또는 부존재하고;
X9는 글루타민 또는 티로신이고;
X10은 메티오닌, 또는 류신이고;
X13은 글루탐산, 또는 글루타민이고;
X15는 알라닌, 또는 발린이고;
X17은 류신, 또는 글루탐산이고;
X20은 글루탐산, 또는 알라닌이고;
X23은 라이신, 발린, 또는 아실화된 아미노산이고;
X24는 아스파라긴, 라이신, 또는 아실화된 아미노산이고;
X36은 시스테인, 라이신, 아실화된 아미노산, 또는 부존재하고;
상기 -은 펩타이드 결합을 나타냄.
하나의 구체예에서, 상기 GLP-1 수용체 길항제 아날로그는
상기 일반식 1에서,
X5는 아스파르트산이고;
X6은 류신, 발린이고;
X7은 세린이고;
X8은 라이신, 또는 세린이고;
X15는 발린이고;
X23은 라이신, 또는 발린이고;
X24는 아스파라긴, 또는 라이신일 수 있으나, 이에 제한되지 않는다.
상기 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 3, 5, 7 내지 12 및 17 내지 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것일 수 있고, 보다 구체적으로, 서열번호 3, 7 내지 12, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
다른 구체예에서, 상기 GLP-1 수용체 길항제 아날로그는
상기 일반식 1에서,
X1 내지 X4는 부존재하고;
X5는 아스파르트산이고;
X6은 류신이고;
X7은 세린이고;
X8은 세린이고;
X9는 티로신이고;
X10은 류신이고;
X13은 글루탐산이고;
X15는 발린이고;
X17은 류신이고;
X20은 글루탐산이고;
X23은 라이신이고;
X24는 아스파라긴이고;
X36은 라이신, 또는 아실화된 아미노산일 수 있으나, 이에 제한되지 않는다.
다른 구체예에서, 상기 GLP-1 수용체 길항제 아날로그는 하기 (i) 내지 (iv) 중 어느 하나의 구조를 갖는 것일 수 있으나, 이에 제한되지 않는다:
(i)
Figure PCTKR2023015820-appb-img-000009
(ii)
Figure PCTKR2023015820-appb-img-000010
(iii)
Figure PCTKR2023015820-appb-img-000011
(iv)
Figure PCTKR2023015820-appb-img-000012
.
또는, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 17, 19, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
한 구체예에서, 상기 서열번호 17의 아미노산 서열을 포함하는 GLP-1 수용체 길항제 아날로그는 하기의 구조를 갖는 것일 수 있으나, 이에 제한되지 않는다:
Figure PCTKR2023015820-appb-img-000013
.
한 구체예에서, 상기 서열번호 19의 아미노산 서열을 포함하는 GLP-1 수용체 길항제 아날로그는 하기의 구조를 갖는 것일 수 있으나, 이에 제한되지 않는다:
Figure PCTKR2023015820-appb-img-000014
.
한 구체예에서, 상기 서열번호 21의 아미노산 서열을 포함하는 GLP-1 수용체 길항제 아날로그는 하기의 구조를 갖는 것일 수 있으나, 이에 제한되지 않는다:
Figure PCTKR2023015820-appb-img-000015
.
한 구체예에서, 상기 서열번호 22의 아미노산 서열을 포함하는 GLP-1 수용체 길항제 아날로그는 하기의 구조를 갖는 것일 수 있으나, 이에 제한되지 않는다:
Figure PCTKR2023015820-appb-img-000016
.
본 발명에서, 상기 GLP-1 수용체 길항제 아날로그는 아실기가 결합한, 아실화된 GLP-1 수용체 길항제 아날로그 결합체일 수 있으나, 이에 제한되지 않는다. 본 발명에서 GLP-1 수용체 길항제 아날로그는 아실화되거나, 또는 아실화되지 않은 GLP-1 수용체 길항제 아날로그를 모두 의미할 수 있다.
아실화(acylation)는 펩타이드　약물의 약동학적 및 약력학적 특성을 개선하기 위한 방법으로 알려져 있다. 펩타이드 약물의 경우, 체내 효소 분해로 인해 약효를 발휘하기 어려운 문제점이 있다. 이에, 지방산을 펩타이드에 부착시키는 펩타이드의 아실화를 통해 효소 작용 부위를 차단함으로써 펩타이드 약물의 안정성을 높이고 반감기를 증가시킬 수 있다. 본 발명의 목적상, 본 발명의 GLP-1 수용체 길항제 아날로그는 반감기 증가를 위해 아실화된 형태일 수 있다.
본 발명에서, “아실화된 GLP-1 수용체 길항제 아날로그 결합체”, “아실화된 GLP-1 수용체 길항제 아날로그”, “아실화된 아날로그”, 또는 “결합체”와 혼용될 수 있다.
본 발명의 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 아미노산에 링커를 통해 아실기를 부착한 것일 수 있고, 상기 링커는 AEEA ((2-(2-aminoethoxy)ethoxy)acetic acid)를 포함하는 것일 수 있고, 더 구체적으로 γGlutamate가 추가로 연결되는 것일 수 있으나, 이에 제한되지 않는다. 구체적인 링커의 예로, (γGlu)m-(AEEA)n을 들 수 있고, 상기 m 및 n은 각각 독립적으로 0, 1, 2, 3, 또는 그 이상의 정수 일 수 있으나, 이에 제한되지 않는다.
상기 링커의 아민기, 히드록시기, 티올기 등을 통해 GLP-1 수용체 길항제 아날로그의 아미노산의 아민기, 히드록시기, 티올기, 카르복실기 등에 아실기를 결합시킬 수 있으나, 아실기를 GLP-1 수용체 길항제 아날로그에 결합시켜 아날로그의 구조적 안정성 및 반감기 증가에 기여할 수 있다면, 특별한 종류나 길이에 제한되지 않는다. 또한, 상기 링커는 아실기에 공유적으로 결합될 수 있고, 1, 2, 3, 또는 그 이상 반복되어 아실기와 연결될 수 있으나, 이에 제한되지 않는다.
상기 아실화에 이용되는 아실기는 임의의 길이를 갖는 탄소쇄일 수 있고, 선형 또는 분지쇄형일 수 있다. 구체적으로, 상기 쇄는 선형 지방족 쇄, 분지형 지방족 쇄, 사이클릭 알킬 모이어티를 함유하는 쇄, 소수성 천연 생성물, 예컨대, 스테로이드, 아르알킬 쇄, 또는 아실 모이어티를 함유하는 알킬 쇄를 포함할 수 있다.
한 구체적인 실시예로, 상기 아실화된 GLP-1 수용체 길항제 아날로그는 1개 이상, 2개 이상, 구체적으로는 1개 또는 2개의 카복실산을 포함하는 C1-C30 직쇄 또는 분지쇄 아실기로 아실화된 것일 수 있고, 한 예로, 상기 아실기는 지방산 또는 다이카복실산, 구체적으로는 C4 내지 C30 지방산 또는 다이카복실산일 수 있으나, 이에 제한되지 않는다. 보다 구체적인 예로, C16, C18, C20, C22, C24, C26, C28, 또는 C30의 지방산 또는 다이카복실산일 수 있다. 다른 예의 아실기로는 콜산, 케노데옥시콜산, 데옥시콜산, 리토콜산, 타우로콜산, 글리코콜산, 콜레스테롤산 등의 담즙산, 숙신산 또는 숙신산 유도체, 말레산, 또는 말레산 유도체 등을 들 수 있으나, 이에 제한되지 않는다.
본 발명의 아실화된 GLP-1 수용체 길항제 아날로그는 당업계의 공지된 방법으로 아실기가 GLP-1 수용체 길항제 아날로그에 부착된 것이거나, 아실화된 아미노산을 사용하여 펩타이드를 합성하여 제조된 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서, 아실화된 GLP-1 수용체 길항제 아날로그는 GLP-1 수용체 길항제 아날로그의 아미노산 잔기에 직접 아실기가 부착된 형태일 수 있다. 예를 들어, 에스테르, 티오에스테르, 또는 아미드 결합을 통해 아실기가 부착된 것일 수 있으나, 이에 제한되지 않는다. 구체적으로, 아실화된 GLP-1 수용체 길항제 아날로그는 아민, 히드록실, 또는 티올기를 갖는 아미노산 잔기에 아실화가 이루어진 것일 수 있다. 예를 들어, 상기 아실화된 GLP-1 수용체 길항제 아날로그는 C-말단에 위치한 아미노산 또는 라이신 잔기에 아실화된 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서, 아실화된 GLP-1 수용체 길항제 아날로그의 아실화된 아미노산은 하기 K(1) 내지 K(4)로 표시되는 아미노산 중 어느 하나를 포함하는 것일 수 있으나, 이에 제한되지 않는다:
[K(1)] C20diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000017
[K(2)] C18diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000018
[K(3)] C16acid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000019
[K(4)] C16diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000020
.
본 발명의 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 8번, 23번, 24번 또는 36번 위치에 아실화된 아미노산을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
구체적인 양태로서, 본 발명에 따른 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 22의 아미노산 서열 중 어느 하나의 서열을 포함하는 것, 구체적으로 서열번호 1 내지 22로 이루어진 군에서 선택된 아미노산 서열로 (필수적으로) 구성된 것 일 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 12의 아미노산 서열 중 어느 하나의 서열을 포함하는 것, 구체적으로 서열번호 1 내지 12로 이루어진 군에서 선택된 아미노산 서열로 (필수적으로) 구성된 것 일 수 있으나, 이에 제한되지 않는다.
보다 구체적으로, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 3, 7 내지 12, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것, 구체적으로 서열번호 3, 7 내지 12, 21, 및 22로 이루어진 군에서 선택된 아미노산 서열로 (필수적으로) 구성된 것 일 수 있으나, 이에 제한되지 않는다.
더욱 구체적으로, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 17, 19, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것, 구체적으로 서열번호 17, 19, 21, 및 22로 이루어진 군에서 선택된 아미노산 서열로 (필수적으로) 구성된 것 일 수 있으나, 이에 제한되지 않는다.
다른 하나의 구체적인 양태로서, 본 발명에 따른 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 서열번호 13 내지 22 중 중 어느 하나의 서열을 포함하는 것, 구체적으로 서열번호 13 내지 22로 이루어진 군에서 선택된 아미노산 서열로 (필수적으로) 구성된 것 일 수 있으나, 이에 제한되지 않는다.
본원에서 '특정 서열번호로 구성되는 펩타이드'라고 기재되어 있다 하더라도, 해당 서열번호의 아미노산 서열로 이루어진 펩타이드와 동일 혹은 상응하는 활성을 가지는 경우라면 해당 서열번호의 아미노산 서열 앞뒤의 무의미한 서열 추가 또는 자연적으로 발생할 수 있는 돌연변이, 혹은 이의 잠재성 돌연변이 (silent mutation)를 제외하는 것이 아니며, 이러한 서열 추가 혹은 돌연변이를 가지는 경우에도 본원의 범위 내에 속하는 것이 자명하다.
또한, 본 발명의 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 22의 아미노산 서열과 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 또는 99% 이상의 상동성 또는 동일성을 가지는 아미노산 서열을 포함할 수 있으나, GLP-1 수용체에 작용하여 길항 작용을 나타낼 수 있는 한, 이에 제한되지 않는다.
본 발명에서 용어, '상동성(homology)' 또는 '동일성(identity)'은 두 개의 주어진 아미노산 서열 또는 염기 서열과 서로 관련된 정도를 의미하며 백분율로 표시될 수 있다.
보존된(conserved) 폴리펩티드의 서열 상동성 또는 동일성은 표준 배열 알고리즘에 의해 결정되며, 사용되는 프로그램에 의해 확립된 디폴트 갭 페널티가 함께 이용될 수 있다. 실질적으로, 상동성을 갖거나(homologous) 또는 동일한(identical) 서열은 일반적으로 서열 전체 또는 일부분과 중간 또는 높은 엄격한 조건(stringent conditions)에서 하이브리드할 수 있다. 하이브리드화는 폴리뉴클레오티드에서 일반 코돈 또는 코돈 축퇴성을 고려한 코돈을 함유하는 폴리뉴클레오티드와의 하이브리드화 역시 포함됨이 자명하다.
용어 상동성 및 동일성은 종종 상호교환적으로 이용될 수 있다.
임의의 두 펩타이드 서열이 상동성, 유사성 또는 동일성을 갖는지 여부는 예를 들어, Pearson et al (1988)[Proc. Natl. Acad. Sci. USA 85]: 2444에서와 같은 디폴트 파라미터를 이용하여 "FASTA" 프로그램과 같은 공지의 컴퓨터 알고리즘을 이용하여 결정될 수 있다. 또는, EMBOSS 패키지의 니들만 프로그램(EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16: 276-277)(버전 5.0.0 또는 이후 버전)에서 수행되는 바와 같은, 니들만-운치(Needleman-Wunsch) 알고리즘(Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453)이 사용되어 결정될 수 있다. (GCG 프로그램 패키지 (Devereux, J., et al, Nucleic Acids Research 12: 387 (1984)), BLASTP, BLASTN, FASTA (Atschul, [S.] [F.,] [ET AL, J MOLEC BIOL 215]: 403 (1990); Guide to Huge Computers, Martin J. Bishop, [ED.,] Academic Press, San Diego,1994, 및 [CARILLO ETA/.](1988) SIAM J Applied Math 48: 1073을 포함한다). 예를 들어, 국립 생물공학 정보 데이터베이스 센터의 BLAST, 또는 ClustalW를 이용하여 상동성, 유사성 또는 동일성을 결정할 수 있다.
펩타이드의 상동성, 유사성 또는 동일성은 예를 들어, Smith and Waterman, Adv. Appl. Math (1981) 2:482에 공지된 대로, 예를 들면, Needleman et al. (1970), J Mol Biol.48: 443과 같은 GAP 컴퓨터 프로그램을 이용하여 서열 정보를 비교함으로써 결정될 수 있다. 요약하면, GAP 프로그램은 두 서열 중 더 짧은 것에서의 기호의 전체 수로, 유사한 배열된 기호(즉, 뉴클레오티드 또는 아미노산)의 수를 나눈 값으로 정의한다. GAP 프로그램을 위한 디폴트 파라미터는 (1) 일진법 비교 매트릭스(동일성을 위해 1 그리고 비-동일성을 위해 0의 값을 함유함) 및 Schwartz and Dayhoff, eds., Atlas Of Protein Sequence And Structure, National Biomedical Research Foundation, pp. 353-358 (1979)에 의해 개시된 대로, Gribskov et al(1986) Nucl. Acids Res. 14: 6745의 가중된 비교 매트릭스 (또는 EDNAFULL(NCBI NUC4.4의 EMBOSS 버전) 치환 매트릭스); (2) 각 갭을 위한 3.0의 페널티 및 각 갭에서 각 기호를 위한 추가의 0.10 페널티 (또는 갭 개방 패널티 10, 갭 연장 패널티 0.5); 및 (3) 말단 갭을 위한 무 페널티를 포함할 수 있다. 따라서, 본 발명에서 사용된 것으로서, 용어 "상동성" 또는 "동일성"은 서열들간의 관련성(relevance)를 나타낸다.
본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 공지된 GLP-1 수용체 길항제인 엑센딘-3(9-39)의 활성(100%)에 비해 약 1% 이상, 10% 이상, 30% 이상, 50% 이상, 70% 이상, 80% 이상, 90% 이상, 100% 이상, 150% 이상, 200% 이상, 250% 이상, 300% 이상, 또는 350% 이상의 활성을 나타내는 것일 수 있다.
본 발명에서 용어, "약"은 ±0.5, ±0.4, ±0.3, ±0.2, ±0.1 등을 모두 포함하는 범위로, 약 이란 용어 뒤에 나오는 수치와 동등하거나 유사한 범위의 수치를 모두 포함하나, 이에 제한되지 않는다.
이와 같은 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 활성은 당업계에 공지된 방법으로 측정될 수 있으며, 특정한 방법에 제한되지 않는다. 한 예로, GLP-1 수용체 길항제 아날로그에 의해 생성이 억제되는 cAMP의 농도를 측정함으로써 본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그의 길항 작용을 분석할 수 있다.
또한, 본 발명에 따른 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 펩타이드의 N-말단 및/또는 C-말단이 변형되지 않은 것일 수 있으나, 생체 내의 단백질 절단 효소들로부터 보호하고 안정성을 증가시키기 위하여 이의 N-말단 및/또는 C-말단 등이 화학적으로 수식되거나 유기단으로 보호되거나, 또는 펩타이드 말단 등에 아미노산이 추가되어 변형된 형태 역시 본 발명의 범주에 포함된다.
특히, 화학적으로 합성한 펩타이드의 경우, N- 및 C-말단이 전하를 띠고 있기 때문에, 이러한 전하를 제거하기 위하여 N-말단을 아세틸화 (acetylation) 및/또는 C-말단을 아미드화 (amidation)할 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명에 따른 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 C-말단이 아미드화된 것일 수 있고, 또는 C-말단이 아미드화되고, 동시에 아실화된 것일 수 있으나, 이에 제한되지 않는다.
본 명세서에서 따로 가리키는 바가 없으면, 본 발명에 따른 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체에 대한 발명의 설명이나 청구 범위의 기술은 해당 아날로그 또는 결합체는 물론이고, 해당 아날로그 또는 결합체의 염(예컨대, 상기 펩타이드의 약학적으로 허용가능한 염), 또는 이의 용매화물의 형태를 모두 포함하는 범주에도 적용된다. 따라서 명세서의 해당 기재 내용은 그 특정 염, 그 특정 용매화물, 그 특정 염의 특정 용매화물에도 마찬가지로 적용된다. 이러한 염 형태는 예를 들어 약학적으로 허용되는 임의의 염을 사용한 형태일 수 있다. 상기 염의 종류는 특별히 제한되지는 않는다. 다만, 개체, 예컨대 포유류에게 안전하고 효과적인 형태인 것이 바람직하나, 특별히 이에 제한되는 것은 아니다.
상기 용어, "약학적으로 허용되는"은 의약학적 판단의 범위 내에서，과도한 독성，자극, 또는 알레르기 반응 등을 유발하지 않고 원하는 용도에 효과적으로 사용 가능한 물질을 의미한다.
본 발명에서 용어, "약학적으로 허용되는 염" 이란 약학적으로 허용되는 무기산, 유기산, 또는 염기로부터 유도된 염을 포함한다. 적합한 산의 예로는 염산, 브롬산, 황산, 질산, 과염소산, 푸마르산，말레산, 인산, 글리콜산, 락트산, 살리실산，숙신산, 톨루엔-p-설폰산, 타르타르산, 아세트산，시트르산, 메탄설폰산，포름산, 벤조산, 말론산, 나프탈렌-2-설폰산， 벤젠설폰산 등을 들 수 있다. 적합한 염기로부터 유도된 염은 나트륨, 칼륨 등의 알칼리 금속，마그네슘 등의 알칼리 토금속，및 암모늄 등을 포함할 수 있다.
또한, 본 발명에서 사용된 용어 "용매화물"은 본 발명에 따른 펩타이드, 결합체, 또는 이의 염이 용매 분자와 복합체를 형성한 것을 말한다.
본 발명의 아날로그는 그 길이에 따라 이 분야에서 잘 알려진 방법, 예를 들어 자동 펩타이드 합성기에 의해 합성할 수 있으며, 유전자 조작 기술에 의하여 생산할 수도 있다.
구체적으로, 본 발명의 아날로그는 표준 합성 방법, 재조합 발현 시스템, 또는 임의의 다른 당해 분야의 방법에 의해 제조될 수 있다. 따라서, 본 발명에 따른 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는, 예를 들어 하기를 포함하는 방법을 포함하는 다수의 방법으로 합성될 수 있다:
(a) 펩타이드를 고체상 또는 액체상 방법의 수단으로 단계적으로 또는 단편 조립에 의해 합성하고, 최종 펩타이드 생성물을 분리 및 정제하는 방법; 또는
(b) 펩타이드를 인코딩하는 핵산 작제물을 숙주세포 내에서 발현시키고, 발현 생성물을 숙주 세포 배양물로부터 회수하는 방법; 또는
(c) 펩타이드를 인코딩하는 핵산 작제물의 무세포 시험관 내 발현을 수행하고, 발현 생성물을 회수하는 방법; 또는
(a), (b) 및 (c)의 임의의 조합으로 펩타이드의 단편을 수득하고, 이어서 단편을 연결시켜 펩타이드를 수득하고, 당해 펩타이드를 회수하는 방법.
이상의 내용은 본 발명의 다른 구체예 혹은 다른 양태에도 적용될 수 있으나, 이에 제한되는 것은 아니다.
본 발명을 구현하는 다른 양태는 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 포함하는 조성물을 제공한다.
상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체에 대해서는 앞서 설명한 바와 같다.
구체적으로, 상기 조성물은 약학적 조성물일 수 있으며, 보다 구체적으로 상기 조성물은 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료에 사용될 수 있다.
본 발명의 구체적인 일 양태는 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 약학적 유효량으로 포함하는 선천성 고인슐린증 또는 저혈당증 치료 또는 예방용 약학적 조성물이다.
상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 약학적 유효량으로 포함하는 것은, 목적하는 약리 활성(예를 들어, 선천성 고인슐린증 또는 저혈당증의 예방, 개선 또는 치료)을 얻을 수 있는 정도를 의미하고, 또한 투여되는 개체에서 독성 또는 부작용이 일어나지 않거나 미미한 수준으로서 약학적으로 허용되는 수준을 의미할 수 있으나, 이에 제한되지 않는다. 이와 같은 약학적 유효량은 투여 횟수, 환자, 제형 등을 종합적으로 고려하여 결정될 수 있다.
본 발명에서 용어 "예방"은 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 또는 이들을 포함하는 조성물의 투여로 목적하는 질환, 예컨대 선천성 고인슐린증 또는 저혈당증의 발병을 억제 또는 지연시키는 모든 행위를 의미하며, "치료"는 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 또는 이들을 포함하는 조성물의 투여로 목적하는 질환, 예컨대 선천성 고인슐린증 또는 저혈당증의 증세가 호전되거나 이롭게 되는 모든 행위를 의미한다.
본 발명에서 용어 "투여"는 어떠한 적절한 방법으로 환자에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 특별히 이에 제한되지 않으나, 상기 조성물이 생체 내 표적에 도달할 수 있는 어떠한 일반적인 경로를 통하여 투여될 수 있으며, 예를 들어 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비 내 투여, 폐 내 투여, 직장 내 투여 등이 될 수 있다.
본 발명의 선천성 고인슐린증은 신생아와 소아에서 발생하는 심각하고 지속적인 저혈당을 일으키는 원인 질환 중 하나이다. 저체중 출생아 혹은 당뇨 산모의 출생아에서 일시적인 인슐린 분비 증가, 유전자 돌연변이로 인한 췌장 세포의 이상 기능 등으로 유발될 수 있다.
본 발명의 저혈당증은 혈중 당량이 정상인보다 낮은 상태를 말한다. 통상 혈당이 50 mg/dl 이하일 때를 말하나, 특별히 이에 제한되는 것은 아니다. 본 발명에서 상기 저혈당증은 급성 저혈당증 및 만성 저혈당증을 모두 포함한다.
저혈당증의 증상은 기운이 없고 몸의 떨림이 있으며, 창백, 식은땀, 현기증, 흥분, 불안감, 가슴 두근거림, 공복감, 두통, 피로감 등을 포함한다. 저혈당증이 오래 지속되면 경련이나 발작이 있을 수 있고 쇼크상태가 초래되어 의식을 잃을 수도 있다.
구체적으로, 본 발명에서 상기 저혈당증은 비만 후 저혈당증 (Postbariatric Hypoglycemia, PBH)일 수 있고, 보다 구체적으로는 비만대사 수술 (bariatric surgery)에 의한 저혈당증일 수 있으나, 이에 제한되지 않는다.
본 발명의 “비만 후 저혈당증” 또는 “비만대사 수술에 의한 저혈당증”은 위소매절제술, 십이지장우회술, 루와이 위우회술과 같은 비만대사 수술 이후 환자가 겪는 저혈당증을 의미하며, 합병증 중 하나인 덤핑증후군에 의해 발병되기도 한다.
비만후 저혈당증 또는 비만대사 수술에 의한 저혈당증은 현재까지 명확하게 밝혀진 치료법이 없는 상태로, 모든 연구자들은 식이요법 및 생활요법의 개선이 가장 중요한 치료법임에 동의하고 있다. 식이요법의 원칙은 한 번에 섭취하는 음식물의 양을 줄이고, 고단백, 고지방, 저탄수화물, 저수분 식사를 소량으로 5~6번에 나누어 씹어 먹어야 한다. 덤핑 증후군으로 인해 저혈당, 복부 통증, 경련이 발생할 경우, 진정제나 항경련제 복용포도당 주사, 진정제, 자율신경 차단제와 같은 약물을 투약하여 증상을 조절할 수 있다.
본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 GLP-1 수용체에 대한 길항 작용을 함으로써 체내 혈당 수준을 높이고/높이거나 인슐린의 분비를 감소시켜 선천성 고인슐린증 또는 저혈당증에 대한 예방 또는 치료 효과를 나타낼 수 있으나, 이에 제한되지 않는다.
본 발명의 약학적 조성물은 약학적으로 허용가능한 담체, 부형제 또는 희석제를 추가로 포함할 수 있다. 본 발명에서 용어 "약학적으로 허용가능한"이란 치료효과를 나타낼 수 있을 정도의 충분한 양과 부작용을 일으키지 않는 것을 의미하며, 질환의 종류, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 투여 경로, 투여 방법, 투여횟수, 치료 기간, 배합 또는 동시 사용되는 약물 등 의학 분야에 잘 알려진 요소에 따라 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 포함한 약학적 조성물은 약학적으로 허용가능한 담체를 추가로 포함할 수 있다. 상기 담체는 특별히 이에 제한되지는 않으나, 경구 투여 시에는 결합제, 활택제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장화제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.
본 발명의 조성물의 제형은 상술한 바와 같은 약학적으로 허용가능한 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여 시에는 정제, 트로키, 캡슐, 엘릭서, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 환약, 캡슐, 서방형 제제 등으로 제형화할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로스, 메틸 셀룰로스, 미정질 셀룰로스, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 방부제 등을 추가로 포함할 수 있다.
또한, 본 발명의 약학적 조성물은 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
또한, 상기 조성물은 약학적 분야에서 통상의 방법에 따라 환자의 신체 내 투여에 적합한 단위 투여형의 제제, 구체적으로는 펩타이드 의약품의 투여에 유용한 제제 형태로 제형화시켜 당업계에서 통상적으로 사용하는 투여 방법을 이용하여 경구, 또는 피부, 정맥 내, 근육 내, 동맥 내, 골수 내, 수막강 내, 심실 내, 폐, 경피, 피하, 복 내, 비강 내, 소화관 내, 국소, 설하, 질 내 또는 직장 경로를 포함하는 비경구 투여 경로에 의하여 투여될 수 있으나, 이들에 한정되는 것은 아니다.
또한, 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체는 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 탄수화물, 아스코르브산(ascorbic acid) 또는 글루타티온과 같은 항산화제(antioxidants), 킬레이트제, 저분자 단백질 또는 다른 안정화제(stabilizers) 등이 약제로 사용될 수 있다.
본 발명의 약학적 조성물의 투여량과 횟수는 치료할 질환, 투여 경로, 환자의 연령, 성별 및 체중 및 질환의 중등도 등의 여러 관련 인자와 함께, 활성성분인 약물의 종류에 따라 결정된다.
특별히 이에 제한되지 않으나, 본 발명의 상기 약학적 조성물은 상기 성분 (유효성분)을 0.01 내지 99% 중량 대 부피로 함유할 수 있다.
본 발명의 조성물의 총 유효량은 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)으로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 본 발명의 약학적 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 구체적으로, 본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 바람직한 전체 용량은 하루에 환자 체중 1 kg당 약 0.3 내지 0.9 mg일 수 있다. 상기 투여량은 GLP-1 수용체 길항제 아날로그의 질량값; 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 GLP-1 수용체 길항제 아날로그 에서 지방산 부위의 질량을 제외한 질량값, 즉 폴리펩타이드 부위들만의 질량을 합산한 값을 기준으로 결정될 수 있다. 그러나 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 용량은 약학적 조성물의 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당분야의 통상적인 지식을 가진 자라면 상기 본 발명의 조성물의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
본 발명의 약학적 조성물은 생체 내 지속성 및 역가가 우수할 수 있으며, 다른 약제에 비해 낮은 투여 횟수 및 빈도를 나타낼 수 있으나, 특별히 이에 제한되는 것은 아니다.
본 발명을 구현하는 또 다른 양태는 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 또는 이를 포함하는 조성물을 개체에 투여하는 단계를 포함하는, 선천성 고인슐린증 또는 저혈당증을 예방 또는 치료하는 방법을 제공한다.
상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 이를 포함하는 조성물, 선천성 고인슐린증, 저혈당증, 예방, 및 치료에 대해서는 앞서 설명한 바와 같다.
본 발명에서 상기 개체는 선천성 고인슐린증 또는 저혈당증이 의심되는 개체로서, 상기 선천성 고인슐린증 또는 저혈당증 의심 개체는 해당 질환이 발병하였거나 발병할 수 있는 인간을 포함한 쥐, 가축 등을 포함하는 포유 동물을 의미하나, 본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 혹은 이를 포함하는 상기 조성물로 치료 가능한 개체는 제한 없이 포함된다. 또한, 본 발명의 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체를 포함하는 약학적 조성물을 선천성 고인슐린증 또는 저혈당증 의심 개체에 투여함으로써, 개체를 효율적으로 치료할 수 있다. 선천성 고인슐린증 또는 저혈당증에 대해서는 상기에서 설명한 바와 같다.
본 발명의 방법은 펩타이드를 포함하는 약학적 조성물을 약학적 유효량으로 투여하는 것을 포함할 수 있다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있으며, 1회 또는 수회로 나누어 투여할 수 있다. 그러나 본 발명의 목적상, 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다.
본 발명의 방법은 상기 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 또는 이를 포함하는 조성물은 생체 내 표적에 도달할 수 있는 일반적인 경로를 통하여 투여될 수 있으며, 상기 투여 경로는, 예를 들어 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비 내 투여, 폐 내 투여, 직장 내 투여 등이 될 수 있다.
본 발명을 구현하는 또 다른 양태는 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 혹은 상기 조성물의 선천성 고인슐린증 또는 저혈당증에 대한 예방 또는 치료 용도를 제공한다.
상기 GLP-1 수용체 길항제 아날로그, 상기 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 상기 조성물, 선천성 고인슐린증, 저혈당증에 대해서는 앞서 설명한 바와 같다.
본 발명을 구현하는 또 다른 양태는 GLP-1 수용체 길항제 아날로그 또는 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 혹은 상기 조성물을 선천성 고인슐린증 또는 저혈당증에 대한 예방 또는 치료용 약제 (혹은 약학적 조성물)의 제조에 사용하는 용도를 제공한다.
상기 GLP-1 수용체 길항제 아날로그, 상기 아실화된 GLP-1 수용체 길항제 아날로그 결합체, 상기 조성물, 선천성 고인슐린증, 저혈당증에 대해서는 앞서 설명한 바와 같다.
한편, 본원 명세서에서 문맥상 달리 요구하지 않는 한, “포함한다”, “포함하는”, “함유하는”, 등의 표현은 명시된 정수(integer) 또는 정수 그룹의 포함을 의미하지만, 다른 정수 또는 정수의 집합을 배제하는 것이 아니라고 이해되어야 한다.　
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것은 아니다.
실시예 1: GLP-1 수용체(GLP-1R) 길항제 아날로그 및 아실화 된 GLP-1 수용체(GLP-1R) 길항제 아날로그 결합체의 제조
GLP-1R 길항제 아날로그의 합성은 고체상 합성법을 이용하는 자동 펩타이드 합성기(Symphony X, Gyros Protein Tech.)를 이용하였다. C-말단의 아마이드화를 위해 Rink amide resin을 사용하였다. 각 아미노산을 C-말단에서 N-말단 순서로 합성하였다.
Fmoc(9H-플루오렌-9-일메톡시카르보닐) 보호된(protected) 아미노산, (펩타이드-resin 대비 4 당량), HOBt(1-히드록시벤조트리아졸, 펩타이드-resin 대비 4 당량), DIC (디이소프로필카르보디이미드, 펩타이드-resin 대비 8 당량)를 사용하여 아미노산을 순차적으로 결합시켰다.
아실화된 GLP-1R 길항제 아날로그 결합체는 아실화 되어 있는 아미노산 K(1) 내지 (4)를 사용하여 상기와 같은 방법으로 펩타이드를 합성하였다.
[K(1)] C20diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000021
[K(2)] C18diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000022
[K(3)] C16acid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000023
[K(4)] C16diacid-γGlu-(AEEA)2-Lys
Figure PCTKR2023015820-appb-img-000024
.
Fmoc 보호기는 자동 합성기에서 resin이 있는 반응 용기에 8 mL의 20% 피페리딘/DMF(2 x 5 분)를 가하여 떼어내었다. 남아 있는 불순물을 제거하기 위해 각 과정 후에는 DMF 12 mL로(6 x 10초) 세척하였다. 합성이 완료된 후, 6 mL의 34% Acetic anhydride/DMF 와 3.5 mL의 14% N,N-디이소프로필/DMF로 N 말단을 아세틸화하였다. 제거되지 않은 보호기는 펩타이드가 레진에서 절단될 때 함께 탈보호 되었다.
이와 같은 과정을 통해 제조된 GLP-1R 길항제 아날로그 및 아실화 된 GLP-1R 길항제 아날로그 결합체의 서열은 다음 표 1에 나타내었다.
서열번호 아미노산 서열
1 TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
2 TSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
3 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
4 DLSAQMEEEAVRLFIEWLKNGGPSSGAPPPS
5 DLSSQMEEEAVRLFIEWLKNGGPSSGAPPPS
6 QMEEEAVRLFIEWLKNGGPSSGAPPPS
7 TSDVSSYLEEEAVRLFIAWLVKGGPSSGAPPPS
8 DVSSYLEEEAVRLFIAWLVKGGPSSGAPPPS
9 DVSSYLEEQAVREFIAWLVKGGPSSGAPPPS
10 DLSSYLEEEAVRLFIEWLKNGGPSSGAPPPS
11 DVSSYLEEEAVRLFIEWLKNGGPSSGAPPPS
12 DVSSYLEEEAVRLFIAWLVKGGPSSGAPPPSC
13 DLSSYLEEEAVRLFIEWLK(1)NGGPSSGAPPPS
14 DLSSYLEEEAARLFIEWLK(2)NGGPSSGAPPPS
15 DVSSYLEEEAVRLFIAWLVK(2)GGPSSGAPPPS
16 DVSSYLEEEAARLFIAWLVK(2)GGPSSGAPPPS
17 DLSSYLEEEAVRLFIEWLKNGGPSSGAPPPSK(2)
18 DVSSYLEEEAVRLFIAWLVKGGPSSGAPPPSK(2)
19 DLSSYLEEEAVRLFIEWLKNGGPSSGAPPPSK(1)
20 DVSSYLEEEAVRLFIAWLVKGGPSSGAPPPSK(1)
21 DLSSYLEEEAVRLFIEWLKNGGPSSGAPPPSK(3)
22 DLSSYLEEEAVRLFIEWLKNGGPSSGAPPPSK(4)
상기 표 1에서, K(1) 내지 (4)는 해당 위치에 해당하는 아미노산이 상기의 구조를 갖는 아실화 된 아미노산인 것을 의미한다.
상기 합성된 GLP-1R 길항제 아날로그 및 아실화 된 GLP-1R 길항제 아날로그 결합체의 정제는 역상 크로마토그래피를 이용하였다. 합성된 펩타이드의 순도는 분석용 액상 크로마토그램 (RP-HPLC)를 이용하여 순도를 확인하였으며, 90%이상인 경우 실험에 사용 가능한 수준으로 판단하여 진행하였다. 또한, 액상 크로마토그램/질량분석기 (LC/MS)를 사용하여 펩타이드의 분자량 및 정보를 확인하였다.
합성된 펩타이드는 실험에 사용되기 전까지 -20℃에 보관하였다.
실시예 2: GLP-1 수용체(GLP-1R) 길항제 아날로그 및 아실화 된 GLP-1 수용체(GLP-1R) 길항제 아날로그 결합체의 in vitro 활성 확인
GLP-1R 길항제 아날로그와 아실화 된 GLP-1R 길항제 아날로그 결합체의 활성을 측정하기 위하여 인간 GLP-1R (hGLP-1R)가 형질전환된 세포주를 이용하여 in vitro에서 세포 활성을 측정하는 방법을 사용하였다. 상기 각 세포주는 CHO (Chinese hamster ovary)에 인간 GLP-1R를 발현하도록 형질 전환된 것으로, GLP-1R 길항제의 활성을 측정하기에 적합하다.
GLP-1R 길항제 아날로그와 아실화된 GLP-1R 길항제 아날로그 결합체의 활성 측정을 위해 인간 GLP-1을 9000 pM부터 3배씩 0.15 pM까지 희석하였다. 길항작용을 확인하기 위해 GLP-1을 0.1 nM로 가한 플레이트에 비교 물질[Exendin-3 (9-39) amide (Tocris Bioscience, UK, Cat No. 2081), 서열번호 24], GLP-1R 길항제 아날로그(서열번호 1 내지 12), 및 아실화된 GLP-1R 길항제 아날로그 결합체(서열번호 13 내지 22)들을 9000 nM부터 3배씩 0.15 nM까지 연속적으로 희석하였다. 상기 인간 GLP-1R가 발현된 CHO 세포를 각각 24시간 384웰 플레이트에 배양 후 배양액을 제거하고 연속적으로 희석된 각 물질들을 10 μL씩 상기 플레이트에 첨가한 다음 30분 동안 상온에서 배양하였다. 그런 다음, Eu-cAMP tracer를 5 μL씩 추가한 뒤 이어서 cAMP 항체가 포함된 버퍼를 5 μL씩 가하여, 60분 동안 상온에서 반응시켰다. 반응이 완료된 세포용해물을 LANCE Ultra cAMP kit (PerkinElmer, USA)에 적용하여, GLP-1R 길항제 아날로그와 아실화된 GLP-1R 길항제 아날로그 결합체에 의해 cAMP의 생성이 억제되는 정도를 통해 반수 최대 억제 농도(IC50)값을 산출 한 후, 상호 비교하였다. 그 결과, 비교물질 대비 상대 활성은 하기 표 2에 나타내었다.
GLP-1R 길항제 아날로그 및 아실화 된 아날로그 결합체의 상대 활성 비율
서열번호 비교물질 대비 in vitro 활성(%)
비교물질(서열번호 24) 100
서열번호 1 69.1
서열번호 2 69.8
서열번호 3 134.7
서열번호 4 74.3
서열번호 5 85.0
서열번호 6 13.1
서열번호 7 195.5
서열번호 8 238.5
서열번호 9 188.6
서열번호 10 249.8
서열번호 11 166.1
서열번호 12 189.3
서열번호 13 4.8
서열번호 14 1.7
서열번호 15 14.3
서열번호 16 13.5
서열번호 17 91.8
서열번호 18 19.8
서열번호 19 33.6
서열번호 20 15.1
서열번호 21 380.1
서열번호 22 251.9
상기 실험 결과로부터 실시예 1에서 제조한 본 발명의 GLP-1R 길항제 아날로그 및 아실화 된 GLP-1R 길항제 아날로그 결합체는 인간 GLP-1 수용체(GLP-1R)에 작용하여 GLP-1 수용체에 대한 길항 작용을 할 수 있는 것을 확인하였다.
실시예 3: 아실화 된 GLP-1 수용체(GLP-1R) 길항제 아날로그 결합체의 in vitro 활성 확인
아실화된 GLP-1R 길항제 아날로그 결합체의 활성을 측정하기 위하여 인간(hGLP-1R) 또는 마우스(mGLP-1R) GLP-1R가 형질전환된 세포주를 이용하여 in vitro에서 세포 활성을 측정하는 방법을 사용하였다. 상기 각 세포주는 CHO (Chinese hamster ovary)에 인간 및 마우스 GLP-1R를 각각 발현하도록 형질 전환된 것으로, GLP-1R 길항제의 활성을 측정하기에 적합하다.
아실화된 GLP-1R 길항제 아날로그 결합체의 활성 측정을 위해 인간 GLP-1을 9000 pM부터 3배씩 0.15 pM까지 희석하였다. 길항작용을 확인하기 위해 GLP-1을 0.1 nM로 가한 플레이트에 비교물질[Exendin-3 (9-39) amide (Tocris Bioscience, UK, Cat No. 2081), 서열번호 24]과 아실화된 GLP-1R 길항제 아날로그 결합체(서열번호 17, 19, 21, 22)들을 9000 nM부터 3배씩 0.15 nM까지 연속적으로 희석하였다.
본 실시예에서 사용된 서열번호 17, 19, 21, 및 22의 아실화된 GLP-1R 길항제 아날로그 결합체는 각각 하기 (i) 내지 (iv)의 구조를 갖는다:
(i)
Figure PCTKR2023015820-appb-img-000025
(ii)
Figure PCTKR2023015820-appb-img-000026
(iii)
Figure PCTKR2023015820-appb-img-000027
(iv)
Figure PCTKR2023015820-appb-img-000028
.
추가적으로, 알부민에 결합력을 가진 지방산(fatty acid)의 영향을 확인하기 위해 1% 인간 혈청 알부민 및 마우스 혈청 알부민이 존재하는 버퍼에 상기 아날로그 결합체들을 희석하여 준비하였다. 상기 인간 GLP-1R, 마우스 GLP-1R가 발현된 CHO 세포를 각각 24시간 384웰 플레이트에 배양 후 배양액을 제거하고 연속적으로 희석된 각 물질들을 10 μL씩 상기 플레이트에 첨가한 다음 30분 동안 상온에서 배양하였다. 그런 다음, Eu-cAMP tracer를 5 μL씩 추가한 뒤 이어서 cAMP 항체가 포함된 버퍼를 5 μL씩 가하여, 60분 동안 상온에서 반응시켰다. 반응이 완료된 세포용해물을 LANCE Ultra cAMP kit (PerkinElmer, USA)에 적용하여, GLP-1R 길항제 아날로그와 아실화된 GLP-1R 길항제 아날로그 결합체에 의해 cAMP의 생성이 억제되는 정도를 통해 반수 최대 억제 농도(IC50)값을 산출 한 후, 상호 비교하였다. 그 결과, 비교물질 대비 상대 활성은 하기 표 3에 나타내었다.
아실화 된 GLP-1R 길항제 아날로그 결합체의 상대 활성 비율
비교물질 대비 in vitro 활성(%)
hGLP-1R / CHO cell line mGLP-1R / CHO cell line
서열번호 알부민 없는 조건 1% 인간 혈청 알부민 조건 알부민 없는 조건 1% 마우스 혈청 알부민 조건
비교물질(서열번호 24) 100 100 100 100
서열번호 17 91.8 4.3 50.1 9.2
서열번호 19 33.6 2.4 12.6 3.2
서열번호 21 380.1 29.4 95.7 27.0
서열번호 22 251.9 11.5 162.7 32.7
실시예 1에서 제조한 GLP-1R 길항제 아날로그 및 아실화된 GLP-1R 길항제 아날로그 결합체는 인간 및 마우스 GLP-1R 수용체에 모두 작용하여 길항 작용을 할 수 있으며, 특히, 표 3에서 명시된 바와 같이 길항제로서의 효력은 아실화된 GLP-1R 길항제 아날로그 결합체 중 C16 지방산을 가진 서열번호 21, 22번이 비교물질에 비하여 활성이 우수하며, C18 지방산을 가진 서열번호 17번, C20 지방산을 가진 서열번호 19번 순서로 역가를 확인할 수 있었다.
실시예 4: GLP-1 수용체(GLP-1R) 길항제 아날로그 결합체(서열번호 17)의 혈당조절 효과
아실화된 GLP-1 수용체 길항제 아날로그 결합체(서열번호 17)가 당부하에 미치는 영향을 확인하기 위해 C57BL/6N 마우스를 동물 모델로 사용하였다. 실험은 8주령 수컷 쥐에 대해서 수행되었고 연구 기간 동안 마우스는 5마리씩 수용되었으며 식수에 자유롭게 접근하도록 하였다. 빛은 6 PM에서 6 AM까지 꺼두었다.
시험군은 그룹 1: 부형제(피하투여)-대조군(vehicle), 그룹 2: Exendin-3 (9-39) 3690 μg/kg (1095.0 nmol/kg, 피하투여), 그룹 3: GLP-1R 길항제 아날로그 결합체(서열번호 17) 3690 μg/kg (1061.9 nmol/kg, 피하투여), 그룹 4: GLP-1R 길항제 아날로그 결합체(서열번호 17) 7380 μg/kg (2123.8 nmol/kg, 피하투여)이 있다. 약물의 투여는 그룹 1, 그룹 3, 그룹 4는 구강 당부하검사(oral glucose tolerance test, OGTT)를 실시하기 24시간 전, 그룹 2는 30분 전에 완료하였다. 여기에서, 상기 투여량은 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 전체 질량에서 지방산 부위의 질량을 제외한 수치, 즉 폴리펩타이드 부위들만의 질량을 합산한 값을 기준으로 표시한 수치이다.
OGTT는 모든 그룹에서 4시간의 절식 후 1회에 2 g/kg의 글루코오스(glucose)를 경구로 투여한 후 혈액샘플을 연속해서 공시시간 간격(0, 15, 30, 60, 및 120분)에 꼬리정맥에서 채취하여 혈당 수치를 OneTouch blood glucose meter (OneTouch Select®, LifeScan, USA)로 측정하였다. 통계처리는 독립표본 t 검정(unpaired t-test) (# ~ ###p < 0.05 ~ 0.001)을 사용하여 대조군과 시험군 사이를 비교하였다.
그 결과, 서열번호 17의 GLP-1R 길항제 아날로그 결합체가 모든 투여 용량에서 대조군 대비 체내 혈당 수준을 높인 것을 확인하였다 (도 1). 이는 본 발명에 따른 GLP-1R 길항제 아날로그 또는 아실화된 GLP-1R 길항제 아날로그 결합체가 갖는 혈당 조절 능력으로 선천성 고인슐린증에 대한 치료 효과를 가질 수 있음을 시사한다.
실시예 5: 위소매 절제술(Vertical sleeve gastrectomy; VSG)로 유도한 비만 후 저혈당증(Postbariatric hypoglycemia; PBH) 랫드 모델에서 GLP-1 수용체(GLP-1R) 길항제 아날로그 결합체(서열번호 17)의 혈당 조절 효과 확인
SD 랫드에 모의수술(sham operation) 또는 VSG 수술을 진행하여 PBH 랫드 모델을 만들었다. 상기 랫드는 19주 동안 고지방식이(high fat diet; HFD)를 섭취하고, 10마리를 무작위로 묶어 두 개 그룹(부형제 대조군 및 GLP-1R 길항제 아날로그 결합체 투여군)으로 세분하였다. 부형제 및 GLP-1R 길항제 아날로그 결합체(서열번호 17) 3720 μg/kg (1070.5 nmol/kg)를 각각 피하투여한 후 4시간 후에 혼합식부하검사(Mixed meal tolerance test; MMTT)를 실시하였다. MMTT는 모든 군에서 5시간의 절식 후 1회에 2 mL의 혼합식(Ensure Plus®, Abbott, USA)을 경구로 투여한 후 혈액샘플을 연속해서 공시시간 간격(0, 15, 30, 45, 60, 및 120분)에 채취하여 혈당 수치를 (GDoctor, Allmedicus Co., Korea) 측정하였다. 통계 처리는 일원분산분석(one-way ANOVA) (* ~ ***p < 0.05 ~ 0.001)을 사용하여 VSG 랫드 부형제 군(대조군) 및 시험군 사이를 비교하였다. 여기에서, 상기 투여량은 아실화된 GLP-1 수용체 길항제 아날로그 결합체의 전체 질량에서 지방산 부위의 질량을 제외한 수치, 즉 폴리펩타이드 부위들만의 질량을 합산한 값을 기준으로 표시한 수치이다.
그 결과, 서열번호 17의 GLP-1R 길항제 아날로그 결합체가 부형제 대조군을 투여한 PBH 랫드 대비, 체내 혈당 수준 증가가 유의적으로 나타남을 확인하였다(도 2).
또한 MMTT 실시 후 15분 뒤 혈액 샘플에서 혈장을 분리하여 랫드 인슐린 ELISA 키트(Multi species GLP-1 total ELISA, Merck Millipore, USA)로 인슐린 분비량을 측정하였다. 그 결과, 서열번호 17의 GLP-1R 길항제 아날로그 결합체 투여군에서 부형제 대조군에 비해 인슐린 분비가 47% 감소된 것으로 확인되었다(도 3). 이는 본 발명에 따른 GLP-1R 길항제 아날로그 또는 아실화된 GLP-1R 길항제 아날로그 결합체가 갖는 혈당 조절 능력으로 저혈당증, 특히 비만 후 저혈당증에 대한 치료 효과를 가질 수 있음을 시사한다.
상기 실시예로부터, 본 발명에서 제조된 GLP-1 수용체 아날로그 및 아실화된 GLP-1 수용체 아날로그는 GLP-1 수용체에 대한 길항 작용제로써 기능함을 확인하였을 뿐만 아니라, 이와 같은 활성을 바탕으로 선천성 고인슐린증, 저혈당증, 특히 비만 후 저혈당증에 대한 유용한 치료제로 사용될 수 있음을 확인하였다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있음을 이해할 수 있다. 이와 관련하여, 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 제한적인 것이 아닌 것으로 이해하여야 한다. 본 발명의 범위는 전술한 상세한 설명보다는 후술되는 특허 청구범위의 의미 및 범위, 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (17)

  1. 하기 일반식 1로 표시되는 GLP-1 수용체 길항제 아날로그(GLP-1 receptor antagonist analogs):
    X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-E-E-X13-A-X15-R-X17-F-I-X20-W-L-X23-X24-G-G-P-S-S-G-A-P-P-P-S-X36(일반식 1, 서열번호 25)
    상기 일반식 1에서,
    X1은 트레오닌, 또는 부존재하고;
    X2는 페닐알라닌, 또는 부존재하고;
    X3은 트레오닌, 또는 부존재하고;
    X4는 세린, 또는 부존재하고;
    X5는 아스파르트산 또는 부존재하고;
    X6은 류신, 발린, 또는 부존재하고;
    X7은 세린, 또는 부존재하고;
    X8은 알라닌, 라이신, 세린, 또는 부존재하고;
    X9는 글루타민 또는 티로신이고;
    X10은 메티오닌, 또는 류신이고;
    X13은 글루탐산, 또는 글루타민이고;
    X15는 알라닌, 또는 발린이고;
    X17은 류신, 또는 글루탐산이고;
    X20은 글루탐산, 또는 알라닌이고;
    X23은 라이신, 발린, 또는 아실화된 아미노산이고;
    X24는 아스파라긴, 라이신, 또는 아실화된 아미노산이고;
    X36은 시스테인, 라이신, 아실화된 아미노산, 또는 부존재하고;
    상기 -은 펩타이드 결합을 나타냄.
  2. 제1항에 있어서, 상기 일반식 1에서,
    X5는 아스파르트산이고;
    X6은 류신, 발린이고;
    X7은 세린이고;
    X8은 라이신, 또는 세린이고;
    X15는 발린이고;
    X23은 라이신, 또는 발린이고;
    X24는 아스파라긴, 또는 라이신인 GLP-1 수용체 길항제 아날로그.
  3. 제1항에 있어서, 상기 일반식 1에서,
    X1 내지 X4는 부존재하고;
    X5는 아스파르트산이고;
    X6은 류신이고;
    X7은 세린이고;
    X8은 세린이고;
    X9는 티로신이고;
    X10은 류신이고;
    X13은 글루탐산이고;
    X15는 발린이고;
    X17은 류신이고;
    X20은 글루탐산이고;
    X23은 라이신이고;
    X24는 아스파라긴이고;
    X36은 라이신, 또는 아실화된 아미노산인 GLP-1 수용체 길항제 아날로그.
  4. 제1항에 있어서, 상기 아실화된 아미노산은 하기 K(1) 내지 K(4)로 표시되는 아미노산 중 어느 하나인 것인, GLP-1 수용체 길항제 아날로그:
    [K(1)] C20diacid-γGlu-(AEEA)2-Lys
    Figure PCTKR2023015820-appb-img-000029
    [K(2)] C18diacid-γGlu-(AEEA)2-Lys
    Figure PCTKR2023015820-appb-img-000030
    [K(3)] C16acid-γGlu-(AEEA)2-Lys
    Figure PCTKR2023015820-appb-img-000031
    [K(4)] C16diacid-γGlu-(AEEA)2-Lys
    Figure PCTKR2023015820-appb-img-000032
    .
  5. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 하나 이상의 아미노산에 AEEA((2-(2-aminoethoxy)ethoxy)acetic acid)를 포함하는 링커를 통해 아실기가 부착된 것인, GLP-1 수용체 길항제 아날로그.
  6. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단이 아미드화된 것인, GLP-1 수용체 길항제 아날로그.
  7. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 1개 또는 2개의 카복실산을 포함한 C1-C30 직쇄 또는 분지쇄 아실기로 아실화된 것인, GLP-1 수용체 길항제 아날로그.
  8. 제7항에 있어서, 상기 아실기는 C4 내지 C30 지방산 또는 다이카복실산인, GLP-1 수용체 길항제 아날로그.
  9. 제7항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단에 위치한 아미노산 또는 라이신 잔기에 아실화된 것인, GLP-1 수용체 길항제 아날로그.
  10. 제7항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 C-말단이 아미드화된 것인, GLP-1 수용체 길항제 아날로그.
  11. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 1 내지 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것인, GLP-1 수용체 길항제 아날로그.
  12. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 3, 7 내지 12, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것인, GLP-1 수용체 길항제 아날로그.
  13. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 서열번호 17, 19, 21, 및 22의 아미노산 서열로 이루어진 군에서 선택되는 어느 하나의 서열을 포함하는 것인, GLP-1 수용체 길항제 아날로그.
  14. 제1항에 있어서, 상기 GLP-1 수용체 길항제 아날로그는 하기 (i) 내지 (iv) 중 어느 하나의 구조를 갖는 것인, GLP-1 수용체 길항제 아날로그:
    (i)
    Figure PCTKR2023015820-appb-img-000033
    (ii)
    Figure PCTKR2023015820-appb-img-000034
    (iii)
    Figure PCTKR2023015820-appb-img-000035
    (iv)
    Figure PCTKR2023015820-appb-img-000036
    .
  15. 제1항 내지 제14항 중 어느 한 항의 GLP-1 수용체 길항제 아날로그를 포함하는 선천성 고인슐린증 또는 저혈당증 예방 또는 치료용 약학적 조성물.
  16. 제15항에 있어서, 상기 저혈당증은 비만 후 저혈당증 (Postbariatric Hypoglycemia, PBH)인, 약학적 조성물.
  17. 제16항에 있어서, 상기 비만 후 저혈당증은 비만대사 수술 (bariatric surgery)에 의한 것인, 약학적 조성물.
PCT/KR2023/015820 2022-10-14 2023-10-13 신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물 WO2024080824A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2022-0132606 2022-10-14
KR20220132605 2022-10-14
KR20220132606 2022-10-14
KR10-2022-0132605 2022-10-14

Publications (1)

Publication Number Publication Date
WO2024080824A1 true WO2024080824A1 (ko) 2024-04-18

Family

ID=90669967

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/015820 WO2024080824A1 (ko) 2022-10-14 2023-10-13 신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물

Country Status (1)

Country Link
WO (1) WO2024080824A1 (ko)

Similar Documents

Publication Publication Date Title
WO2017116205A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체
WO2012173422A9 (en) A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
WO2018004283A2 (ko) 글루카곤 유도체, 이의 결합체, 및 이를 포함하는 조성물, 및 이의 치료적 용도
WO2018056764A1 (ko) 인슐린 수용체와의 결합력이 감소된, 인슐린 아날로그 및 이의 용도
WO2018174668A2 (ko) 인슐린 수용체와의 결합력이 감소된 인슐린 아날로그의 결합체 및 이의 용도
WO2020130749A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물
WO2021066600A1 (ko) 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도
US20080026996A1 (en) Selective Vpac2 Receptor Reptide Agonists
WO2023106845A1 (ko) 신규한 아디포넥틴 아날로그 및 결합체
WO2024080824A1 (ko) 신규한 glp-1 수용체 길항제 및 이를 포함하는 선천성 고인슐린증 또는 저혈당증의 예방 또는 치료용 약학적 조성물
WO2020071865A1 (ko) 글루카곤 및 이를 포함하는 조합물의 치료학적 용도
WO2022015082A1 (ko) 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도
WO2022015115A1 (ko) 3중 작용성 지속형 결합체 또는 3중 작용제를 포함하는 조합물의 치료학적 용도
WO2021215801A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법
WO2020214013A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도
WO2020263063A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도
WO2021133087A1 (ko) Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물
WO2020242268A1 (ko) 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물
WO2019035672A1 (ko) 아실화 옥신토모듈린 펩타이드 유사체
WO2021107519A1 (en) Biotin moiety-conjugated polypeptide and pharmaceutical composition for oral administration comprising the same
WO2022035302A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 혈압 강하용 약학 조성물
WO2023277620A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 조합물의 치료학적 용도
WO2022065897A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 신경퇴행성 질환의 치료 용도
WO2022035271A1 (ko) 삼중 활성체 지속형 결합체를 유효성분으로 포함하는 약학 조성물
WO2022065899A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체의 다발성 경화증의 치료 용도