WO2021133087A1 - Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물 - Google Patents
Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물 Download PDFInfo
- Publication number
- WO2021133087A1 WO2021133087A1 PCT/KR2020/019069 KR2020019069W WO2021133087A1 WO 2021133087 A1 WO2021133087 A1 WO 2021133087A1 KR 2020019069 W KR2020019069 W KR 2020019069W WO 2021133087 A1 WO2021133087 A1 WO 2021133087A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glp
- composition
- derivative
- bone
- lysine
- Prior art date
Links
- 208000029725 Metabolic bone disease Diseases 0.000 title claims abstract description 10
- 239000008194 pharmaceutical composition Substances 0.000 title claims description 21
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 claims abstract description 227
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 claims abstract description 150
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 claims abstract description 150
- 210000000988 bone and bone Anatomy 0.000 claims description 85
- 239000000203 mixture Substances 0.000 claims description 81
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 64
- 108060003951 Immunoglobulin Proteins 0.000 claims description 59
- 102000018358 immunoglobulin Human genes 0.000 claims description 59
- 150000001413 amino acids Chemical class 0.000 claims description 56
- 235000001014 amino acid Nutrition 0.000 claims description 53
- 208000030159 metabolic disease Diseases 0.000 claims description 49
- 239000004472 Lysine Substances 0.000 claims description 45
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 45
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 35
- 235000018417 cysteine Nutrition 0.000 claims description 32
- 239000004471 Glycine Substances 0.000 claims description 30
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 claims description 28
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 28
- 239000004475 Arginine Substances 0.000 claims description 26
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 26
- 208000016097 disease of metabolism Diseases 0.000 claims description 26
- 208000001132 Osteoporosis Diseases 0.000 claims description 24
- 239000002202 Polyethylene glycol Substances 0.000 claims description 24
- 229920001223 polyethylene glycol Polymers 0.000 claims description 24
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 23
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 claims description 22
- 108090000573 Osteocalcin Proteins 0.000 claims description 22
- 238000011282 treatment Methods 0.000 claims description 22
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 21
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 19
- 238000000034 method Methods 0.000 claims description 18
- 229920001184 polypeptide Polymers 0.000 claims description 18
- 230000002265 prevention Effects 0.000 claims description 18
- 238000001727 in vivo Methods 0.000 claims description 16
- 230000011164 ossification Effects 0.000 claims description 16
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 15
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 14
- 235000004279 alanine Nutrition 0.000 claims description 14
- 210000004369 blood Anatomy 0.000 claims description 14
- 239000008280 blood Substances 0.000 claims description 14
- 230000004048 modification Effects 0.000 claims description 14
- 238000012986 modification Methods 0.000 claims description 14
- 239000000126 substance Substances 0.000 claims description 14
- 102000004067 Osteocalcin Human genes 0.000 claims description 13
- 239000000539 dimer Substances 0.000 claims description 13
- 102000008108 Osteoprotegerin Human genes 0.000 claims description 12
- 108010035042 Osteoprotegerin Proteins 0.000 claims description 12
- 230000002401 inhibitory effect Effects 0.000 claims description 12
- XXUPLYBCNPLTIW-UHFFFAOYSA-N octadec-7-ynoic acid Chemical compound CCCCCCCCCCC#CCCCCCC(O)=O XXUPLYBCNPLTIW-UHFFFAOYSA-N 0.000 claims description 12
- 230000007423 decrease Effects 0.000 claims description 11
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 10
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 claims description 10
- QFLNJOIJUNDRFH-ROLXFIACSA-N [(5s)-1,5-diamino-5-carboxypentyl]-diazonioazanide Chemical compound [N-]=[N+]=NC(N)CCC[C@H](N)C(O)=O QFLNJOIJUNDRFH-ROLXFIACSA-N 0.000 claims description 10
- 101710190440 Cytotoxin 1 Proteins 0.000 claims description 9
- 102100031475 Osteocalcin Human genes 0.000 claims description 9
- VYVRIXWNTVOIRD-LRHBOZQDSA-N ciguatoxin CTX1B Chemical compound C([C@@]12[C@@H](C)[C@@H]([C@@H]3[C@H]([C@H]([C@H](C)[C@H]4O[C@H]5C[C@@H](C)C[C@H]6O[C@@]7(C)[C@H](O)C[C@H]8O[C@H]9C=C[C@H]%10O[C@H]%11C[C@@H]%12[C@H]([C@@H]([C@H]%13O[C@H](C=CC[C@@H]%13O%12)\C=C\[C@H](O)CO)O)O[C@@H]%11C=C[C@@H]%10O[C@@H]9C\C=C/C[C@@H]8O[C@@H]7C[C@@H]6O[C@@H]5C[C@@H]4O3)O)O2)C)[C@H](O)CO1 VYVRIXWNTVOIRD-LRHBOZQDSA-N 0.000 claims description 9
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 9
- 238000000354 decomposition reaction Methods 0.000 claims description 8
- 208000005368 osteomalacia Diseases 0.000 claims description 8
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 8
- 230000003247 decreasing effect Effects 0.000 claims description 7
- 208000028169 periodontal disease Diseases 0.000 claims description 7
- IMOBSLOLPCWZKQ-UHFFFAOYSA-N 2-(dimethylazaniumyl)-3-(1h-imidazol-5-yl)propanoate Chemical compound CN(C)C(C(O)=O)CC1=CN=CN1 IMOBSLOLPCWZKQ-UHFFFAOYSA-N 0.000 claims description 6
- 206010049088 Osteopenia Diseases 0.000 claims description 6
- 239000011230 binding agent Substances 0.000 claims description 6
- 230000036765 blood level Effects 0.000 claims description 6
- ZCKYOWGFRHAZIQ-UHFFFAOYSA-N dihydrourocanic acid Chemical compound OC(=O)CCC1=CNC=N1 ZCKYOWGFRHAZIQ-UHFFFAOYSA-N 0.000 claims description 6
- 206010003246 arthritis Diseases 0.000 claims description 5
- 230000015556 catabolic process Effects 0.000 claims description 5
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 5
- 108010035532 Collagen Proteins 0.000 claims description 4
- 102000008186 Collagen Human genes 0.000 claims description 4
- 206010031243 Osteogenesis imperfecta Diseases 0.000 claims description 4
- 229920001436 collagen Polymers 0.000 claims description 4
- 108010049937 collagen type I trimeric cross-linked peptide Proteins 0.000 claims description 4
- LOJFGJZQOKTUBR-XAQOOIOESA-N NC(N)=NCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O)C)CC1=CN=CN1 Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O)C)CC1=CN=CN1 LOJFGJZQOKTUBR-XAQOOIOESA-N 0.000 claims description 3
- 229940024606 amino acid Drugs 0.000 description 50
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 32
- 125000003277 amino group Chemical group 0.000 description 30
- 125000003275 alpha amino acid group Chemical group 0.000 description 28
- 229920000642 polymer Polymers 0.000 description 17
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 16
- 229910052799 carbon Inorganic materials 0.000 description 16
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 201000010099 disease Diseases 0.000 description 14
- 239000003814 drug Substances 0.000 description 14
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 11
- 210000002997 osteoclast Anatomy 0.000 description 11
- 125000003396 thiol group Chemical group [H]S* 0.000 description 11
- 238000006243 chemical reaction Methods 0.000 description 10
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 10
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 229940079593 drug Drugs 0.000 description 8
- 235000000346 sugar Nutrition 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 7
- 125000003172 aldehyde group Chemical group 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 7
- 239000000560 biocompatible material Substances 0.000 description 7
- 210000004899 c-terminal region Anatomy 0.000 description 7
- 235000013305 food Nutrition 0.000 description 7
- 239000000710 homodimer Substances 0.000 description 7
- 239000000178 monomer Substances 0.000 description 7
- 230000001737 promoting effect Effects 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 239000003937 drug carrier Substances 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 125000000524 functional group Chemical group 0.000 description 6
- 230000036541 health Effects 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- CILIXQOJUNDIDU-ASQIGDHWSA-N teduglutide Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 CILIXQOJUNDIDU-ASQIGDHWSA-N 0.000 description 6
- 108010073046 teduglutide Proteins 0.000 description 6
- 229960002444 teduglutide Drugs 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 5
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 5
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 230000000875 corresponding effect Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- -1 succinimidyl carboxymethyl Chemical group 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 208000006386 Bone Resorption Diseases 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical group CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 150000001294 alanine derivatives Chemical class 0.000 description 4
- 230000024279 bone resorption Effects 0.000 description 4
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000009245 menopause Effects 0.000 description 4
- 238000007069 methylation reaction Methods 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- 125000004433 nitrogen atom Chemical group N* 0.000 description 4
- 235000015097 nutrients Nutrition 0.000 description 4
- 238000009806 oophorectomy Methods 0.000 description 4
- 125000001151 peptidyl group Chemical group 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 206010065687 Bone loss Diseases 0.000 description 3
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N Butyraldehyde Chemical group CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 3
- 108010022452 Collagen Type I Proteins 0.000 description 3
- 102000012422 Collagen Type I Human genes 0.000 description 3
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 3
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 3
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 239000000556 agonist Substances 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 235000005911 diet Nutrition 0.000 description 3
- 230000037213 diet Effects 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 208000007565 gingivitis Diseases 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 229910052500 inorganic mineral Inorganic materials 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000011707 mineral Substances 0.000 description 3
- 235000010755 mineral Nutrition 0.000 description 3
- 201000001245 periodontitis Diseases 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 238000006268 reductive amination reaction Methods 0.000 description 3
- 210000000813 small intestine Anatomy 0.000 description 3
- BEOOHQFXGBMRKU-UHFFFAOYSA-N sodium cyanoborohydride Chemical compound [Na+].[B-]C#N BEOOHQFXGBMRKU-UHFFFAOYSA-N 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical class O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 208000020084 Bone disease Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 241000700198 Cavia Species 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 108010014258 Elastin Proteins 0.000 description 2
- 102000016942 Elastin Human genes 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101500028771 Homo sapiens Glucagon-like peptide 2 Proteins 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 102000000704 Interleukin-7 Human genes 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- 208000030136 Marchiafava-Bignami Disease Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 108090000526 Papain Proteins 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- RFBKULCUBJAQFT-BIIVOSGPSA-N Ser-Cys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CS)NC(=O)[C@H](CO)N)C(=O)O RFBKULCUBJAQFT-BIIVOSGPSA-N 0.000 description 2
- 206010049416 Short-bowel syndrome Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000037182 bone density Effects 0.000 description 2
- 230000004097 bone metabolism Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 230000006806 disease prevention Effects 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 229920002549 elastin Polymers 0.000 description 2
- 229940011871 estrogen Drugs 0.000 description 2
- 239000000262 estrogen Substances 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 235000013376 functional food Nutrition 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 230000003054 hormonal effect Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 229940100994 interleukin-7 Drugs 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 125000004430 oxygen atom Chemical group O* 0.000 description 2
- 229940055729 papain Drugs 0.000 description 2
- 235000019834 papain Nutrition 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000003449 preventive effect Effects 0.000 description 2
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 2
- 239000002994 raw material Substances 0.000 description 2
- 239000000376 reactant Substances 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000005932 reductive alkylation reaction Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- DKXIKPOYTWCGIE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-methylbutanoate Chemical compound CCC(C)C(=O)ON1C(=O)CCC1=O DKXIKPOYTWCGIE-UHFFFAOYSA-N 0.000 description 1
- FHNMAOLQZHUPIJ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-methylpropanoate Chemical compound CC(C)C(=O)ON1C(=O)CCC1=O FHNMAOLQZHUPIJ-UHFFFAOYSA-N 0.000 description 1
- DYMYLBQTHCJHOQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) butanoate Chemical compound CCCC(=O)ON1C(=O)CCC1=O DYMYLBQTHCJHOQ-UHFFFAOYSA-N 0.000 description 1
- ZJIFDEVVTPEXDL-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) hydrogen carbonate Chemical compound OC(=O)ON1C(=O)CCC1=O ZJIFDEVVTPEXDL-UHFFFAOYSA-N 0.000 description 1
- DRLIANXPAARUMI-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) pentanoate Chemical compound CCCCC(=O)ON1C(=O)CCC1=O DRLIANXPAARUMI-UHFFFAOYSA-N 0.000 description 1
- AASBXERNXVFUEJ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) propanoate Chemical compound CCC(=O)ON1C(=O)CCC1=O AASBXERNXVFUEJ-UHFFFAOYSA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- QHSCIWIRXWFIGH-LURJTMIESA-N (2s)-2-amino-2-methylpentanedioic acid Chemical compound OC(=O)[C@](N)(C)CCC(O)=O QHSCIWIRXWFIGH-LURJTMIESA-N 0.000 description 1
- HTFFMYRVHHNNBE-YFKPBYRVSA-N (2s)-2-amino-6-azidohexanoic acid Chemical compound OC(=O)[C@@H](N)CCCCN=[N+]=[N-] HTFFMYRVHHNNBE-YFKPBYRVSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 125000001431 2-aminoisobutyric acid group Chemical group [#6]C([#6])(N*)C(*)=O 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 241000220479 Acacia Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000002679 Alveolar Bone Loss Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010006326 Breath odour Diseases 0.000 description 1
- 238000011746 C57BL/6J (JAX™ mouse strain) Methods 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 206010006956 Calcium deficiency Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 208000002064 Dental Plaque Diseases 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- 102000015626 Glucagon-Like Peptide-2 Receptor Human genes 0.000 description 1
- 108010024044 Glucagon-Like Peptide-2 Receptor Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101000851054 Homo sapiens Elastin Proteins 0.000 description 1
- 101001015549 Homo sapiens Glucagon-like peptide 2 receptor Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 206010025476 Malabsorption Diseases 0.000 description 1
- 208000004155 Malabsorption Syndromes Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 208000016285 Movement disease Diseases 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- XLBVNMSMFQMKEY-BYPYZUCNSA-N N-methyl-L-glutamic acid Chemical compound CN[C@H](C(O)=O)CCC(O)=O XLBVNMSMFQMKEY-BYPYZUCNSA-N 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 206010031252 Osteomyelitis Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000008312 Tooth Loss Diseases 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- 206010047626 Vitamin D Deficiency Diseases 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 208000038016 acute inflammation Diseases 0.000 description 1
- 230000006022 acute inflammation Effects 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000002744 anti-aggregatory effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 125000005340 bisphosphate group Chemical group 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 208000016738 bone Paget disease Diseases 0.000 description 1
- 230000037118 bone strength Effects 0.000 description 1
- 230000001680 brushing effect Effects 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 230000002308 calcification Effects 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000004027 cell Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 210000001100 crypt cell Anatomy 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000009615 deamination Effects 0.000 description 1
- 238000006481 deamination reaction Methods 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000022811 deglycosylation Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000018823 dietary intake Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000001842 enterocyte Anatomy 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 230000006126 farnesylation Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013373 food additive Nutrition 0.000 description 1
- 239000002778 food additive Substances 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000005417 food ingredient Substances 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 230000027119 gastric acid secretion Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 235000013402 health food Nutrition 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 229920006158 high molecular weight polymer Polymers 0.000 description 1
- 102000044683 human GLP2R Human genes 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000003870 intestinal permeability Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000003127 knee Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000002429 large intestine Anatomy 0.000 description 1
- 239000008141 laxative Substances 0.000 description 1
- 229940125722 laxative agent Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000036244 malformation Effects 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 125000000962 organic group Chemical group 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 239000008057 potassium phosphate buffer Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 108091006084 receptor activators Proteins 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000007670 refining Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
- 208000007442 rickets Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- UQDJGEHQDNVPGU-UHFFFAOYSA-N serine phosphoethanolamine Chemical compound [NH3+]CCOP([O-])(=O)OCC([NH3+])C([O-])=O UQDJGEHQDNVPGU-UHFFFAOYSA-N 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 125000004434 sulfur atom Chemical group 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 238000001308 synthesis method Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/12—Drugs for disorders of the metabolism for electrolyte homeostasis
- A61P3/14—Drugs for disorders of the metabolism for electrolyte homeostasis for calcium homeostasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present invention relates to the therapeutic use of GLP-2 and long-acting conjugates thereof for diseases of bone metabolism.
- Glucagon-like peptide-2 (GLP-2) is a peptide hormone composed of 33 amino acids produced by L-cells in the small intestine in response to ingested nutrients. GLP-2 induces mucosal growth in the small intestine and large intestine, promotes growth of enterocytes and crypt cells, and inhibits apoptosis. GLP-2 also increases the absorption of nutrients from the small intestine and decreases intestinal permeability. Inhibits gastric emptying and gastric acid secretion, increases intestinal blood flow rate, and relaxes intestinal smooth muscle.
- Metabolic bone disease is an umbrella term that refers to bone malformations caused by various types of disorders, and is caused by an imbalance of calcium, phosphorus, magnesium, and vitamin D. In particular, calcium deficiency is the main cause. is known as Examples of the bone metabolic disease include osteoporosis, osteomalacia, rickets, cystic fibrous osteomyelitis, bone Paget's disease, and the like.
- osteoporosis which is a representative example of bone metabolic disease
- osteoporosis is an unavoidable symptom for the elderly, especially postmenopausal women, although there is a difference in degree, and as the population ages in developed countries, interest in osteoporosis and its therapeutic agent is gradually increasing.
- Osteoporosis refers to a state in which the amount of bone is significantly reduced compared to normal people, and the strength to withstand body weight or mechanical pressure is weakened, and it is a common metabolic disease in which bones easily fracture even with a slight impact such as a light fall indoors.
- Bone in our body repeats the reproducible process of being resorbed and created, and it is believed that bone metabolic disease is caused by the imbalance between bone formation and bone resorption. It is known that promoting bone formation and inhibiting bone decomposition is an important therapeutic mechanism for treating bone metabolic diseases including osteoporosis. Accordingly, drugs for maintaining the current bone mass by increasing bone formation or preventing bone loss are being developed. Bisphosphate, calcitonin, or estrogen are used as drugs for inhibiting bone resorption, and parathyroid hormone is used to increase bone formation (Republic of Korea Patent No. 10-1964376).
- One object of the present invention is to provide a pharmaceutical composition for preventing or treating bone metabolic diseases, including GLP-2 (Glucagon-like peptide-2).
- Another object of the present invention is to provide a method for preventing or treating bone metabolic diseases, comprising administering GLP-2 or a composition comprising the same to an individual in need thereof.
- Another object of the present invention is to provide the use of GLP-2 or a composition comprising the same in the manufacture of a medicament for the prevention or treatment of bone metabolic diseases.
- One aspect embodying the present invention is a composition for preventing, treating, or improving bone metabolic diseases, including glucagon-like peptide-2 (GLP-2).
- GLP-2 glucagon-like peptide-2
- the present invention relates to a pharmaceutical composition for the prevention or treatment of bone metabolic diseases, including GLP-2.
- the present invention relates to a food composition for preventing or improving bone metabolic diseases, including GLP-2.
- the present invention includes a pharmaceutically acceptable excipient; And it relates to a pharmaceutical composition for the prevention or treatment of bone metabolic diseases, comprising GLP-2 in a pharmaceutically effective amount.
- X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
- X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
- X 30 is lysine or arginine
- X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidolysine, or cysteine.
- composition according to any one of the preceding embodiments, wherein the GLP-2 derivative comprises
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is cysteine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is lysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is arginine
- X 34 is lysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is 6-azidolysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is arginine
- X 34 is cysteine
- X 1 is imidazoacetyldeshistidine
- X 2 is Aib
- X 30 is lysine
- X 34 is cysteine
- X 1 is histidine
- X 2 is Aib
- X 30 is lysine
- X 34 is cysteine.
- composition according to any one of the preceding embodiments, wherein the GLP-2 derivative comprises an amino acid sequence represented by the following general formula 2:
- X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
- X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
- X 30 is lysine or arginine
- X 34 is characterized in that it is one or more optional amino acids or one or more optional amino acids that have been modified.
- composition according to any one of the preceding embodiments, wherein the GLP-2 derivative is an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 8.
- composition according to any one of the preceding embodiments, wherein the bone metabolic disease is Osteoporosis, Osteopenia, Arthritis, Periodontal disease, Osteopsathyrosis, or Osteomalacia. characterized by being.
- composition according to any one of the preceding embodiments, wherein the composition promotes bone formation; inhibiting the breakdown of bone; It is characterized by promoting bone formation and inhibiting bone decomposition.
- composition according to any one of the preceding embodiments, wherein the bone metabolic disease is osteoporosis.
- composition according to any one of the preceding embodiments, wherein the composition, upon administration, has at least one of the following properties:
- X is GLP-2 (native GLP-2 or GLP-2 derivative);
- L is a linker containing an ethylene glycol repeating unit
- a is 0 or a natural number, provided that when a is 2 or more, each L is independent of each other;
- F is an immunoglobulin Fc region
- the "-" is a covalent bond.
- composition according to any one of the preceding embodiments, wherein F is an immunoglobulin Fc region.
- composition according to any one of the preceding embodiments, wherein the immunoglobulin Fc region is non-glycosylated.
- composition according to any one of the preceding embodiments, wherein the immunoglobulin Fc region is an IgG4 Fc region.
- composition according to any one of the preceding embodiments, wherein the immunoglobulin Fc region is a non-glycosylated Fc region derived from human IgG4.
- composition according to any one of the preceding embodiments, wherein L is polyethylene glycol.
- Another aspect of the present invention is a method for preventing or treating bone metabolic diseases, comprising administering a pharmaceutically effective amount of GLP-2 or a long-acting conjugate of GLP-2 or a composition comprising the same to an individual in need thereof.
- Another aspect of the present invention is the use of GLP-2 or a composition comprising the same for the prevention or treatment of bone metabolic diseases.
- Another aspect of the present invention is the use of GLP-2 or a composition comprising the same in the manufacture of a medicament for the prevention or treatment of a bone metabolic disease.
- composition comprising GLP-2 according to the present invention can be applied to the treatment of bone-related diseases including osteoporosis.
- the bone disease may be a bone metabolic disease, and more specifically, a bone degenerative disease, but is not particularly limited thereto.
- a pharmaceutically acceptable excipient As a specific example of the present invention, a pharmaceutically acceptable excipient; and a pharmaceutical composition for preventing or treating bone metabolic diseases, including, but not limited to, glucagon-like peptide-2 in a pharmaceutically effective amount.
- glucagon-like peptide-2 or “GLP-2 (Glucagon-like peptide-2) refers to a polypeptide form as an agonist of human glucagon-like peptide-2 receptor. Alternatively, it refers to a substance in the form of a conjugate in which a non-polypeptide moiety is linked to a polypeptide.
- glucagon-like peptide-2 or GLP-2 includes not only natural human GLP-2, but also derivatives thereof, and conjugates thereof.
- the GLP-2 is an active ingredient included in the pharmaceutical composition of the present invention, and may be included in the pharmaceutical composition in a pharmaceutically effective amount.
- the amino acid sequence of native GLP-2 is as follows.
- HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID NO: 1)
- GLP-2 receptor agonist refers to a substance that binds to a human glucagon-like peptide-2 (GLP-2) receptor in vivo or isolated and produces the same or similar physiological activity as native GLP-2.
- GLP-2 agonist may include native GLP-2 or a GLP-2 derivative.
- GLP-2 derivative refers to a peptide having one or more differences in amino acid sequence compared to native GLP-2; a peptide in which the native GLP-2 sequence is modified through modification; and/or mimics of native GLP-2 having a function of preventing, treating and/or ameliorating bone metabolic diseases, such as native GLP-2.
- the GLP-2 derivative is a modification selected from the group consisting of substitution, addition, deletion, modification, and combinations thereof to at least one amino acid in the native GLP-2 sequence. may have occurred, but is not limited thereto.
- the N-terminal amino group of GLP-2 of the present invention may be substituted, removed, or modified, but is not limited thereto.
- GLP-2 of the present invention is a method of removing the alpha amino group of histidine at the N-terminus to prevent binding to the N-terminus, which is an important site for the in vivo activity of GLP-2, when preparing a long-acting conjugate; Synthesis method by substituting an amino group with a hydroxyl group or a carboxyl group, imidazo-acetyl action by removing the alpha carbon of the N-terminal histidine and the N-terminal amino group bonded to the alpha carbon It can be prepared through a method of leaving only a group, a method of modifying an N-terminal amino group with two methyl groups, and the like.
- the GLP-2 derivative is imidazoacetyl-deshistidyl GLP-2 (imidazoacetyl-deshistidyl- GLP-2) in which the alpha carbon of the histidine residue, which is the first N-terminal amino acid of GLP-2, and the N-terminal amino group attached to the alpha carbon are removed.
- GLP-2 CA-GLP-2
- desaminohistidyl GLP-2 from which the N-terminal amino group of GLP-2 has been removed desaminohistidyl GLP-2, DA-GLP-2
- the N-terminal amino group of GLP-2 Beta-hydroxyimidazopropionyldeshistidyl GLP-2 ( ⁇ -hydroxyimidazopropionyldeshistidyl GLP-2, HY-GLP-2) substituted with a hydroxyl group
- the N-terminal amino group of GLP-2 is modified with two methyl groups N-dimethylhistidyl GLP-2 (N-dimethylhistidyl GLP-2, DM-GLP-2), or beta-carboxyimidazopropionyldeshistidyl-GLP in which the N-terminal amino group of GLP-2 is substituted with a carboxyl group -2 ( ⁇ -carboxyimidazopropionyl-deshistidyl GLP
- the GLP-2 derivative may be one in which at least one amino acid of amino acids 1, 2, 30 and 34 in SEQ ID NO: 1 is modified, but is not limited thereto.
- the modification may be a modification selected from the group consisting of substitution, addition, deletion, modification, and combinations thereof of at least one amino acid, wherein the added amino acid is a non-natural amino acid (eg, a D-type amino acid) Also, it is possible to substitute non-natural amino acids in addition to natural amino acids.
- the added amino acid sequence may be derived from native GLP-2, but is not limited thereto.
- the GLP-2 derivative of the present invention exhibits at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology with native GLP-2 in amino acid sequence. and/or in which some groups of one amino acid residue of GLP-2 are chemically substituted (eg, alpha-methylation, alpha-hydroxylation), removed (eg, deamination) or modified (eg, N-methylation).
- some groups of one amino acid residue of GLP-2 are chemically substituted (eg, alpha-methylation, alpha-hydroxylation), removed (eg, deamination) or modified (eg, N-methylation).
- the GLP-2 derivative may comprise, but is not limited to, the amino acid sequence of Formula 1 below:
- X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
- X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
- X 30 is lysine or arginine
- X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidolysine, or cysteine.
- the GLP-2 derivative may comprise, but is not limited to, the amino acid sequence of the following general formula 2:
- X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
- X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
- X 30 is lysine or arginine
- X 34 is one or more optional amino acids or one or more optional amino acids to which a modification has occurred.
- sequence identical to SEQ ID NO: 1 among the amino acid sequences of Formula 1 or 2 may be excluded from the GLP-2 derivative, but is not limited thereto.
- the GLP-2 derivative of the present invention is the second amino acid of native GLP-2, alanine, with glycine or Aib (2-aminoisobutyric acid), lysine, the 30th amino acid, with arginine, or these It may have a combination of, but is not limited thereto.
- the GLP-2 derivative is a thiol group (eg, cysteine), an amino group (eg, lysine, arginine, glutamine or histidine) at the C-terminus (eg, the 33rd amino acid), or an azide group ( For example, 6-azidolysine) may be introduced, but is not limited thereto.
- a GLP-2 conjugate with a selectively controlled binding site can be prepared using this.
- one end of the non-peptide linker is bound to a hydroxyl group, a thiol group, an amino group, or an azide group of the GLP-2 derivative, and a substance capable of increasing the half-life in vivo to the other end of the non-peptide linker (for example, an immunoglobulin Fc region) may be bound.
- the thiol group, amino group, or azide group may be introduced by adding an amino acid to GLP-2, but is not limited thereto.
- the thiol group is introduced by adding cysteine (C) to GLP-2; Amino groups are introduced by adding lysine (K), arginine (R), glutamine (Q) or histidine (H); The azide group may be introduced by adding 6-azidolysine ( AZ K), but is not limited thereto.
- At least one residue may be cysteine, lysine, arginine, glutamine, histidine or 6-azidolysine, but is not limited thereto.
- the GLP-2 derivative of the present invention includes substitution of alanine, the second amino acid of native GLP-2, with glycine, and introduction of a thiol group (eg, cysteine) at the C-terminus, more specifically N - May include imidazoacetyl deshistidine in which the alpha carbon of the histidine residue, which is the first amino acid at the terminal, and the N-terminal amino group bonded to the alpha carbon are removed, for example, it may have the amino acid sequence of SEQ ID NO: 2, but is not limited thereto does not
- the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native GLP-2, with glycine and introduction of an amino group (eg, lysine) at the C-terminus, more specifically N - May include imidazoacetyl deshistidine in which the alpha carbon of the histidine residue, which is the first amino acid at the terminal, and the N-terminal amino group bonded to the alpha carbon are removed, for example, it may have the amino acid sequence of SEQ ID NO: 3, but is not limited thereto. does not
- the GLP-2 derivative of the present invention contains alanine as the second amino acid of native GLP-2 and glycine, lysine at the 30th amino acid of native GLP-2 with arginine, and C-terminus. It may include the introduction of an amino group (eg, lysine), more specifically imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed. and, for example, may have the amino acid sequence of SEQ ID NO: 4, but is not limited thereto.
- the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native GLP-2, with glycine, and introduction of an azide group (eg, 6-azidolysine) at the C-terminus, , more specifically, may include imidazoacetyl deshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first amino acid at the N-terminus has been removed, for example, it may have the amino acid sequence of SEQ ID NO: 5 However, it is not limited thereto.
- the GLP-2 derivative of the present invention contains alanine, the second amino acid of native GLP-2, glycine, and lysine, the 30th amino acid, of native GLP-2, arginine, and the C-terminus. It may include introduction of a thiol group (eg, cysteine), more specifically imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed. and, for example, may have the amino acid sequence of SEQ ID NO: 6, but is not limited thereto.
- a thiol group eg, cysteine
- the GLP-2 derivative of the present invention comprises substitution of alanine, the second amino acid of native GLP-2, with 2-aminoisobutyric acid, and introduction of a thiol group (eg, cysteine) at the C-terminus,
- a thiol group eg, cysteine
- it may have the amino acid sequence of SEQ ID NO: 8, and more specifically, may include imidazoacetyl deshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed.
- the GLP-2 derivatives of SEQ ID Nos: 2 to 8 are shown in Table 1 below.
- ca H is substituted with imidazoacetyl deshistidine instead of histidine
- Aib is 2-aminoisobutyric acid
- AZ K is 6-azido-L-lysine (6-azido- L-lysyine).
- the GLP-2 derivative according to the present invention may be a peptide comprising the specific sequence described above or a peptide (essentially) composed of the specific sequence described above, but is not limited thereto.
- the GLP-2 derivative is (1) X 2 is glycine or Aib, (2) X 30 is lysine or arginine, or (3) X 2 is glycine or Aib, and X 30 may be lysine or arginine, but is not limited thereto.
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is cysteine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is lysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is arginine
- X 34 is lysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is lysine
- X 34 is 6-azidolysine
- X 1 is imidazoacetyldeshistidine
- X 2 is glycine
- X 30 is arginine
- X 34 is cysteine
- X 1 is imidazoacetyldeshistidine
- X 2 is Aib
- X 30 is lysine
- X 34 is cysteine
- X 1 may be histidine
- X 2 may be Aib
- X 30 may be lysine
- X 34 may be cysteine, but is not limited thereto.
- modifications for the preparation of agonists, fragments, variants and derivatives of native GLP-2 include modifications using L-form or D-form amino acids, and/or non-natural amino acids; and/or modifying the native sequence by modification or post-translational modification (eg, methylation, acylation, ubiquitination, intramolecular covalent bonding, etc.).
- the GLP-2 or GLP-2 derivative is protected from proteolytic enzymes in vivo and its N-terminal and/or C-terminus is chemically modified or protected with an organic group, Alternatively, the GLP-2 or GLP-2 derivative may be in a modified form by adding an amino acid to the terminus or the like.
- the N-terminus is acetylated and/or the C-terminus is amidated to remove these charges.
- it is not particularly limited thereto.
- GLP-2 or a GLP-2 derivative may have its C-terminus unmodified or amidated, but is not limited thereto.
- the GLP-2 or GLP-2 derivative of the present invention can be synthesized through a solid phase synthesis method, can be produced by a recombinant method, and can be produced by requesting commercially.
- the GLP-2 is in the form of a long-acting conjugate in which a biocompatible substance capable of increasing the in vivo half-life of the native GLP-2 or GLP-2 derivative is bound to the native GLP-2 or GLP-2 derivative.
- the long-acting conjugate may exhibit increased potency persistence compared to GLP-2 or a derivative thereof to which a biocompatible material (eg, an immunoglobulin Fc region) is not bound, and in the present invention, GLP-2 or a derivative thereof
- a conjugate comprising GLP-2 or a derivative thereof, which has an increased half-life by binding with a compatible substance is referred to as a “long-acting conjugate”.
- the long-acting binder is used interchangeably with the binder.
- the combination may be non-naturally occurring.
- connection between GLP-2 and a biocompatible material may be a physical or chemical bond, a non-covalent bond or a covalent bond, and specifically a covalent bond.
- a biocompatible material eg, an immunoglobulin Fc region
- the present invention is not limited thereto.
- the method of linking GLP-2 and a biocompatible material is not particularly limited, but GLP-2 and a biocompatible material (eg, immune system) through a linker globulin Fc region) may be linked to each other.
- Korean Patent Application Laid-Open No. 10-2019-0037181 relating to a long-acting conjugate of GLP-2 is incorporated herein by reference.
- the long-acting conjugate of GLP-2 of the present invention has the structure of Formula 1 below.
- X is GLP-2 (native GLP-2 or GLP-2 derivative);
- L is a linker containing ethylene glycol repeating units
- a is 0 or a natural number, provided that when a is 2 or more, each L is independent of each other;
- F is an immunoglobulin Fc region
- the "-" is a covalent bond.
- X and L, and L and F may be connected to each other by a covalent bond, and in this case, the conjugate may be a conjugate in which X, L, and F are each connected through a covalent bond in the order of Formula 1 .
- F may be directly connected to X (ie, a is 0 in Formula 1) or connected through a linker (L).
- F is X, that is, a substance capable of increasing the half-life of GLP-2 or a derivative thereof according to the present invention, and corresponds to one component of a moiety constituting the conjugate of the present invention.
- the F may be bonded to each other by a covalent chemical bond or a non-covalent chemical bond with X, and F and X may be bonded to each other through L through a covalent chemical bond, a non-covalent chemical bond, or a combination thereof.
- the F is a material capable of increasing the half-life of X is a biocompatible material, for example, a high molecular weight polymer, fatty acid, cholesterol, albumin and fragments thereof, an albumin binding material, a polymer of a repeating unit of a specific amino acid sequence, an antibody, an antibody It may be selected from the group consisting of fragments, FcRn binding materials, in vivo connective tissue, nucleotides, fibronectin, transferrin, saccharides, heparin, and elastin, but is not particularly limited thereto.
- the elastin may be human tropoelastin, a water-soluble precursor, and may be a polymer of some sequences or some repeating units, for example, all of the cases of an elastin-like polypeptide, but is not particularly limited thereto. .
- polymer polymer examples include polyethylene glycol (PEG), polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitin, and a high molecular polymer selected from the group consisting of hyaluronic acid, oligonucleotides, and combinations thereof, and the polysaccharide may include dextran, but is not particularly limited thereto.
- PEG polyethylene glycol
- polypropylene glycol ethylene glycol-propylene glycol copolymer
- polyoxyethylated polyol polyvinyl alcohol
- polysaccharide polyvinyl ethyl ether
- biodegradable polymer lipid polymer
- chitin examples of the polysaccharide may include dextran, but is not particularly limited thereto.
- polyethylene glycol is a term encompassing all forms of ethylene glycol homopolymer, PEG copolymer, or monomethyl-substituted PEG polymer (mPEG), but is not particularly limited thereto.
- biocompatible material includes, but is not limited to, poly-amino acids such as poly-lysine, poly-aspartic acid and poly-glutamic acid.
- the fatty acid may have a binding force with albumin in vivo, but is not particularly limited thereto.
- the F may be an FcRn-binding material, and specifically, the FcRn-binding material may be an immunoglobulin Fc region, more specifically an IgG Fc region, more specifically an aglycosylated IgG4 Fc area, but is not particularly limited thereto.
- the F eg, immunoglobulin Fc region
- the F is a dimer consisting of two polypeptide chains, and one end of L is linked to only one of the two polypeptide chains. may have, but is not limited thereto.
- the long-acting conjugate of the present invention may be one in which GLP-2 or a derivative thereof and an immunoglobulin Fc region are linked, but is not limited thereto.
- immunoglobulin Fc region refers to a region including heavy chain constant region 2 (CH2) and/or heavy chain constant region 3 (CH3), excluding the heavy and light chain variable regions of immunoglobulin.
- the immunoglobulin Fc region may be one component constituting a moiety of the conjugate of the present invention. Specifically, it corresponds to F in Formula 1 above.
- the Fc region not only the native sequence obtained from papain digestion of immunoglobulin, but also derivatives thereof, such as one or more amino acid residues in the native sequence, are converted by deletion, insertion, non-conservative or conservative substitution, or a combination thereof, resulting in a native natural sequence. It encompasses and includes sequences that differ from the type.
- the F eg, immunoglobulin Fc region
- the F is a structure in which two polypeptide chains are linked by a disulfide bond, and may be a structure in which only one of the two chains is linked through a nitrogen atom, but is limited thereto doesn't happen
- the linkage through the nitrogen atom may be connected through reductive amination to the epsilon amino atom or the N-terminal amino group of lysine.
- Reductive amination reaction means a reaction in which an amine group or an amino group of a reactant reacts with an aldehyde (i.e., a functional group capable of reductive amination) of another reactant to form an amine, and then forms an amine bond by a reduction reaction, It is an organic synthesis reaction well known in the art.
- aldehyde i.e., a functional group capable of reductive amination
- the long-acting conjugate may be one in which the immunoglobulin Fc region is linked to a linker through its N-terminal nitrogen atom.
- the immunoglobulin Fc region may include a hinge region in the heavy chain constant region, but is not limited thereto.
- the immunoglobulin Fc region may include a specific hinge sequence at the N-terminus.
- flankinge sequence refers to a region that is located on a heavy chain and forms a dimer of an immunoglobulin Fc region through an inter disulfide bond.
- the hinge sequence may be mutated to have only one cysteine residue by deleting a part of the hinge sequence having the following amino acid sequence, but is not limited thereto:
- the hinge sequence may include only one cysteine residue by deleting the 8th or 11th cysteine residue in the hinge sequence of SEQ ID NO: 11.
- the hinge sequence of the present invention may be composed of 3 to 12 amino acids, including only one cysteine residue, but is not limited thereto.
- the hinge sequence of the present invention may have the following sequence: Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro (SEQ ID NO: 12), Glu-Ser- Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Pro (SEQ ID NO: 13), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser (SEQ ID NO: 14), Glu- Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Pro (SEQ ID NO: 15), Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser (SEQ ID NO: 16), Glu-Ser-Lys- Tyr-Gly-Pro-Pro-Cys (SEQ ID NO: 17), Glu-Lys-Tyr-Gly-Pro-Pro-Cys (SEQ ID NO: 18),
- the hinge sequence may include the amino acid sequence of SEQ ID NO: 21 (Pro-Ser-Cys-Pro) or SEQ ID NO: 30 (Ser-Cys-Pro), but is not limited thereto.
- the N-terminus of the immunoglobulin Fc region in the conjugate is proline, and in this conjugate, the Fc region is linked to a linker through a nitrogen atom of the proline.
- the immunoglobulin Fc region has a hinge sequence so that two chains of the immunoglobulin Fc region form a homodimer or a heterodimer.
- the conjugate of Formula 1 of the present invention may be in a form in which one end of the linker is linked to one chain of the dimer immunoglobulin Fc region, but is not limited thereto.
- N-terminus refers to the amino terminus of a protein or polypeptide, and 1, 2, 3, 4, 5, 6, It may include up to 7, 8, 9, or 10 or more amino acids.
- the immunoglobulin Fc region of the present invention may include a hinge sequence at the N-terminus, but is not limited thereto.
- part or all of the heavy chain constant region 1 (CH1) and/or light chain constant region except for only the heavy and light chain variable regions of immunoglobulin 1 (CL1) may be an extended Fc region. It may also be a region in which some fairly long amino acid sequences corresponding to CH2 and/or CH3 have been removed.
- the immunoglobulin Fc region of the present invention comprises 1) a CH1 domain, a CH2 domain, a CH3 domain and a CH4 domain, 2) a CH1 domain and a CH2 domain, 3) a CH1 domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, 5) a combination of one or two or more domains of a CH1 domain, a CH2 domain, a CH3 domain and a CH4 domain with an immunoglobulin hinge region (or part of a hinge region), or 6) heavy chain constant region each domain and a light chain constant region may be a dimer
- the present invention is not limited thereto.
- the immunoglobulin Fc region F is a dimer (dimer) consisting of two polypeptide chains, wherein the Fc region dimers F and X are They are covalently linked through one and the same linker L containing ethylene glycol repeat units.
- X is covalently linked via a linker L to only one of the two polypeptide chains of this Fc region dimer F.
- only one molecule of X is covalently linked via L to one of the two polypeptide chains of the Fc region dimer F to which X is linked.
- F is a homodimer.
- the long-acting conjugate of the present invention it is also possible for two molecules of X to bind symmetrically to one Fc region in a dimeric form.
- the immunoglobulin Fc and X may be linked to each other by a non-peptide linker.
- a non-peptide linker it is not limited to the examples described above.
- the immunoglobulin Fc region of the present invention includes a native amino acid sequence as well as a sequence derivative thereof.
- An amino acid sequence derivative means that one or more amino acid residues in a native amino acid sequence have a different sequence by deletion, insertion, non-conservative or conservative substitution, or a combination thereof.
- amino acid residues 214 to 238, 297 to 299, 318 to 322, or 327 to 331 known to be important for binding may be used as suitable sites for modification.
- various types of derivatives are possible, such as a site capable of forming a disulfide bond is removed, some amino acids at the N-terminus of native Fc are removed, or a methionine residue may be added to the N-terminus of native Fc Do.
- the complement binding site eg, the C1q binding site
- the ADCC antibody dependent cell mediated cytotoxicity
- the above-described Fc derivative may exhibit biological activity equivalent to that of the Fc region of the present invention, and may have increased structural stability against heat, pH, etc. of the Fc region.
- the Fc region may be obtained from a native type isolated in vivo from animals such as humans, cows, goats, pigs, mice, rabbits, hamsters, rats or guinea pigs, or obtained from transformed animal cells or microorganisms. It may be recombinant or a derivative thereof.
- the method of obtaining from the native type may be a method of obtaining whole immunoglobulin by isolating it from a living body of a human or animal, and then treating it with a proteolytic enzyme. When treated with papain, it is cleaved into Fab and Fc, and when treated with pepsin, it is cleaved into pF'c and F(ab)2.
- Fc or pF'c may be separated using size-exclusion chromatography or the like.
- a recombinant immunoglobulin Fc region obtained from a human-derived Fc region from a microorganism.
- the immunoglobulin Fc region may be in the form of a native sugar chain, an increased sugar chain compared to the native type, a decreased sugar chain compared to the native type, or a form in which the sugar chain is removed.
- Conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms may be used for the increase or decrease or removal of such immunoglobulin Fc sugar chains.
- the immunoglobulin Fc region from which the sugar chain is removed from the Fc has significantly reduced binding to complement (c1q) and reduced or eliminated antibody-dependent cytotoxicity or complement-dependent cytotoxicity, so that unnecessary immune responses in vivo are not induced. does not In this regard, a form more suitable for the original purpose as a drug carrier will be an immunoglobulin Fc region in which sugar chains are removed or non-glycosylated.
- deglycosylation refers to an Fc region from which sugars are removed by an enzyme
- aglycosylation refers to an Fc region that is not glycosylated by production in prokaryotes, in a more specific embodiment, in E. coli. .
- the immunoglobulin Fc region may be of human or animal origin, such as cattle, goats, pigs, mice, rabbits, hamsters, rats, guinea pigs, and in a more specific embodiment, human origin.
- the immunoglobulin Fc region may be an Fc region derived from IgG, IgA, IgD, IgE, or IgM, a combination thereof, or a hybrid thereof. In a more specific embodiment, it is derived from IgG or IgM, which is most abundant in human blood, and in a more specific embodiment is derived from IgG, which is known to enhance the half-life of ligand binding proteins. In an even more specific embodiment, the immunoglobulin Fc region is an IgG4 Fc region, and in the most specific embodiment, the immunoglobulin Fc region is a non-glycosylated Fc region derived from human IgG4, but is not limited thereto.
- the immunoglobulin Fc region is a fragment of human IgG4 Fc, and is a homodimer in which two monomers are linked through a disulfide bond (inter-chain form) between cysteine, the 3rd amino acid of each monomer.
- the homodimer may have/have a disulfide bond between cysteines at positions 35 and 95 and between cysteines at positions 141 and 199 in each monomer, i.e., two disulfide bonds (in an intra-chain form).
- the number of amino acids of each monomer may consist of 221 amino acids, and the amino acids forming a homodimer may consist of a total of 442 amino acids, but is not limited thereto.
- two monomers having the amino acid sequence of SEQ ID NO: 31 (consisting of 221 amino acids) form a homodimer through a disulfide bond between cysteine, the 3rd amino acid of each monomer, and the monomer of the homodimer may each independently form an internal disulfide bond between cysteines at positions 35 and 95 and an internal disulfide bond between cysteines at positions 141 and 199, but is not limited thereto.
- dimers or multimers can be prepared from two or more fragments selected from the group consisting of IgG Fc, IgA Fc, IgM Fc, IgD Fc and IgE Fc fragments.
- hybrid is a term that means that sequences corresponding to immunoglobulin Fc fragments of two or more different origins exist in a single-chain immunoglobulin constant region.
- various types of hybrids are possible. That is, a hybrid of domains consisting of 1 to 4 domains from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is possible, and may include a hinge.
- IgG can also be divided into subclasses of IgG1, IgG2, IgG3 and IgG4, and in the present invention, a combination thereof or hybridization thereof is also possible. Specifically, they are subclasses of IgG2 and IgG4, and most specifically, the Fc region of IgG4, which has little effector function such as complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- the above-described conjugate may have an increased duration of effect compared to native GLP-2 or compared to unmodified X, and this conjugate is not only in the above-described form, but also in the form encapsulated in biodegradable nanoparticles. including, but not limited to, the like.
- L may be a non-peptidyl linker, for example, a linker containing an ethylene glycol repeating unit.
- non-peptidyl linker includes a biocompatible polymer in which two or more repeating units are bonded. The repeating units are linked to each other through any covalent bond other than a peptide bond.
- the non-peptidyl linker may be one component constituting a moiety of the conjugate of the present invention, and corresponds to L in Formula 1 above.
- the non-peptidyl linker that can be used in the present invention may be used without limitation as long as it is a polymer resistant to proteolytic enzymes in vivo.
- the non-peptidyl linker may be used in combination with a non-peptidyl polymer.
- non-peptidyl linker may be a linker containing an ethylene glycol repeating unit, for example, polyethylene glycol, and also derivatives thereof known in the art and easily at the level of skill in the art. Derivatives that can be prepared are also included in the scope of the present invention.
- the repeating unit of the non-peptidyl linker may be an ethylene glycol repeating unit, and specifically, the non-peptidyl linker may include an ethylene glycol repeating unit and a functional group used in the preparation of the conjugate at the terminal thereof.
- the long-acting conjugate according to the present invention may be in a form in which X and F are linked through the functional group, but is not limited thereto.
- the non-peptidyl linker may include two, or three or more functional groups, and each functional group may be the same or different from each other, but is not limited thereto.
- the linker may be polyethylene glycol (PEG) represented by the following formula (2), but is not limited thereto:
- the PEG moiety in the long-acting conjugate may include not only the -(CH 2 CH 2 O) n -structure, but also an oxygen atom intervening between the linking element and the -(CH 2 CH 2 O) n -, but this It is not limited.
- the conjugate may have a structure in which GLP-2 or a GLP-2 derivative and an immunoglobulin Fc region (F) are covalently linked through a linker containing an ethylene glycol repeating unit, but is limited thereto. it is not
- the polyethylene glycol is a term encompassing all forms of ethylene glycol homopolymer, PEG copolymer, or monomethyl-substituted PEG polymer (mPEG), but is not particularly limited thereto.
- the non-peptidyl linker that can be used in the present invention may be used without limitation as long as it is a polymer resistant to protease in vivo.
- the molecular weight of the non-peptidyl polymer is in the range of more than 0 to 200 kDa, specifically, about 1 to 100 kDa. range, more specifically in the range of about 1 to 50 kDa, even more specifically in the range of about 1 to 20 kDa, even more specifically in the range of about 3.4 kDa to 10 kDa, even more specifically in the range of about 3.4 kDa doesn't happen
- the term "about” includes all ranges including ⁇ 0.5, ⁇ 0.4, ⁇ 0.3, ⁇ 0.2, ⁇ 0.1, etc., and includes all values in a range equal to or similar to the value following the term about, but not limited
- non-peptidyl linker of the present invention coupled to the immunoglobulin Fc region may be a combination of different types of polymers as well as one type of polymer.
- both ends of the non-peptidyl linker may bind to a thiol group, an amino group, a hydroxyl group of the immunoglobulin Fc region, and a thiol group, an amino group, an azide group, or a hydroxyl group of GLP-2. , but not limited thereto.
- the non-peptidyl linker has a reactive group capable of binding to immunoglobulin Fc and GLP-2 or a derivative thereof, respectively, at both ends, specifically, a thiol group of a cysteine in the immunoglobulin Fc region; an amino group located at the N-terminus, lysine, arginine, glutamine and/or histidine; and/or a thiol group of a cysteine of GLP-2 bonded to a hydroxyl group located at the C-terminus; amino groups of lysine, arginine, glutamine and/or histidine; azide group of azidolysine; and/or a reactive group capable of bonding to a hydroxyl group, but is not limited thereto.
- the reactive group of the non-peptidyl polymer may be at least one selected from the group consisting of an aldehyde group, a maleimide group, and a succinimide derivative, but is not limited thereto.
- a propion aldehyde group or a butyl aldehyde group may be exemplified as the aldehyde group, but the present invention is not limited thereto.
- succinimidyl carboxymethyl, succinimidyl valerate, succinimidyl methylbutanoate, succinimidyl methylpropionate, succinimidyl butanoate, succinimidyl propionate, N -Hydroxysuccinimide, hydroxy succinimidyl or succinimidyl carbonate may be used, but not limited thereto.
- the non-peptidyl linker may be linked to the immunoglobulin Fc and GLP-2 derivatives through the above-described reactive groups, and converted into a non-peptidyl polymer linkage.
- the final product resulting from reductive alkylation with aldehyde bonds is much more stable than those linked with amide bonds.
- the aldehyde reactive group selectively reacts with the N-terminus at a low pH, and can form a covalent bond with a lysine residue at a high pH, for example, pH 9.0.
- the terminal reactive groups of the non-peptidyl linker of the present invention may be the same as or different from each other.
- the non-peptidyl linker may have an aldehyde group reactive group at the terminal, and the non-peptidyl linker may have an aldehyde group and a maleimide reactive group at the terminal, respectively, or have an aldehyde group and a succinimide reactive group at the terminal, respectively can, but is not limited thereto.
- it may have a maleimide group at one end and an aldehyde group, propionaldehyde group or butyraldehyde group at the other end.
- it may have a succinimidyl group at one end and a propionaldehyde group or a butyl aldehyde group at the other end.
- the hydroxyl group can be activated into the various reactive groups by a known chemical reaction, or a commercially available polyethylene glycol having a modified reactive group is used. It can be used to prepare the conjugate of the present invention.
- the reactive group of the non-peptidyl linker may be linked to a cysteine residue of GLP-2 or a GLP-2 derivative, more specifically, a -SH group of cysteine, but is not limited thereto.
- maleimide-PEG-aldehyde is used, the maleimide group is linked to the -SH group of GLP-2 or a GLP-2 derivative by a thioether bond, and the aldehyde group is reduced to the -NH 2 group of immunoglobulin Fc. It may be linked through an alkylation reaction, but is not limited thereto, and this corresponds to one example.
- the N-terminal amino group of the immunoglobulin Fc region is linked to an oxygen atom located at one end of PEG through a linker functional group having a structure of -CH 2 CH 2 CH 2 -, -PEG-O -CH 2 CH 2 CH 2 NH-Can form the same structure as immunoglobulin Fc, and form a structure in which one end of PEG is linked to a sulfur atom located at the cysteine of GLP-2 or GLP-2 derivatives through a thioether bond can do.
- the above-mentioned thioether bond is
- the reactive group of the non-peptidyl linker may be linked to -NH 2 located at the N-terminus of the immunoglobulin Fc region, but this corresponds to one example.
- GLP-2 or a GLP-2 derivative may be linked to a non-peptidyl linker having a reactive group through the C-terminus, but this corresponds to one example.
- C-terminus refers to the carboxy terminus of a peptide, and refers to a position capable of binding to a non-peptide polymer for the purpose of the present invention.
- it may include all amino acid residues around the C-terminus as well as the most terminal amino acid residue at the C-terminus, and specifically includes the first to 20th amino acid residues from the most terminal.
- the long-acting conjugate comprising GLP-2 or a GLP-2 derivative according to the present invention includes both the peptide itself, a salt thereof (eg, a pharmaceutically acceptable salt of the peptide), or a solvate thereof. do.
- the long-acting conjugate may be in any pharmaceutically acceptable form.
- GLP-2 or GLP-2 derivatives of the present invention may have a use for preventing or treating bone metabolic disease.
- the composition of the present invention can be used for the prevention or treatment of bone metabolic diseases, and in particular, can be used without limitation for the prevention or treatment of bone metabolic diseases caused by imbalance of osteoblasts and osteoclasts.
- bone metabolic diseases include, but are not limited to, osteoporosis, osteopenia, arthritis, periodontal disease, osteopsathyrosis, osteomalacia, and the like.
- GLP-2 or a derivative thereof according to the present invention.
- the long-acting conjugate containing the same has an effect of promoting bone formation and/or inhibiting bone degradation by osteoclasts, it can be used as an effective therapeutic agent for bone metabolic diseases.
- composition of the present invention may exhibit one or more of the following characteristics upon administration, but is not limited thereto:
- the derivative of the composition of the present invention may exhibit the prevention or treatment effect of bone metabolic diseases by promoting bone formation and/or inhibiting bone decomposition.
- osteoporosis refers to a state in which the calcification of bone tissue is reduced, so that the compactness of the bone is thinned and the bone marrow cavity is widened. It is easy to fracture even with a small impact. Bone mass is affected by several factors, such as genetic factors, nutritional intake, hormonal changes, and differences in exercise and lifestyle. The causes of osteoporosis include old age, lack of exercise, low weight, smoking, low-calcium diet, menopause, Ovariectomy and the like are known. On the other hand, although there are individual differences, the bone mass is higher in blacks than in whites due to a lower bone resorption level.
- bone mass is the highest at the age of 14 to 18, and decreases by about 1% per year in old age.
- bone loss continues to progress after the age of 30, and when they reach menopause, bone loss progresses rapidly due to hormonal changes. That is, when the menopause reaches the estrogen concentration rapidly decreases, at this time, as by IL-7 (interleukin-7), B-lymphocytes (B-lymphocytes) are produced in large amounts, B-cell precursors (pre-B) in the bone marrow (bone marrow) cells) accumulate, and this increases the amount of IL-6, which increases the activity of osteoclasts, which may eventually lead to a decrease in bone mass.
- IL-7 interleukin-7
- pre-B B-cell precursors
- osteoclasts which may eventually lead to a decrease in bone mass.
- patients with short bowel syndrome do not receive sufficient nutrients, complications such as osteoporosis, osteopenia, and osteomalacia due to decreased bone density are accompanied.
- osteoporosis More specific types include primary type 1 osteoporosis, primary type 2 osteoporosis, secondary osteoporosis, osteomalacia-like osteoporosis, osteoporosis due to menopause or ovarian resection, and osteoporosis due to short bowel syndrome. , but is not particularly limited thereto.
- osteoopenia refers to a state in which bones are weakened or bone mineral density (BDM) is lower than normal.
- osteoarthritis refers to a disease in which inflammatory changes occur in a joint, and includes osteoarthritis, rheumatoid arthritis, and the like.
- gingivitis refers to an inflammatory state of the dental support tissue caused by bacteria, and can be divided into gingivitis and periodontitis.
- the cause of the disease is the formation of a bacterial film when oral bacteria hit due to poor oral hygiene. If the dental plaque is left unattended, it can become inflamed and sometimes bleed from the gums and cause bad breath. These symptoms are called gingivitis, and if gingivitis progresses further, periodontitis occurs. As periodontitis progresses, the gums may bleed and swell even with mild stimulation such as brushing, and often turn into acute inflammation, causing pain.
- composition according to the present invention can be usefully used for periodontal disease, particularly alveolar bone loss due to periodontal disease.
- osteogenesis imperfecta is a disease called incomplete osteoplasty, and refers to a disease in which bone strength is weak and fractures easily for no particular reason.
- osteomalacia refers to temporary swelling and pain in the knee area. Causes are vitamin D deficiency, calcium and phosphate metabolism disorders, and malabsorption of nutrients in the stomach, long-term use of laxatives, insufficient exposure to sunlight, and pregnancy. It refers to a state in which the bone mineral density (BMD) is lower than normal due to the excessive formation of non-calcified osseous tissue in the bone, which causes the bone to become soft and cause movement disorders.
- BMD bone mineral density
- prevention refers to GLP-2 or a derivative thereof; Or it means any action that inhibits or delays the onset of a bone metabolic disease by administration of a composition comprising the same, and “treatment” refers to the administration of GLP-2 or a long-acting conjugate of GLP-2 or a composition comprising the same to improve bone metabolism by administering the same. It means any action that improves or benefits the symptoms of a disease.
- prevention or treatment of bone metabolic diseases includes prevention and complete or partial treatment of bone metabolic diseases. It also includes any other change in the patient that reduces, ameliorates, alleviates the symptoms of, reduces the incidence of, or increases the outcome of, a bone metabolic disease symptom.
- the long-acting conjugate containing the same can maintain bone mass and bone density by inhibiting bone mass loss by promoting bone formation and/or inhibiting bone decomposition, thereby exhibiting a preventive or therapeutic effect on bone metabolic diseases.
- the term "administration” means introducing a predetermined substance to a patient by any suitable method, and the route of administration of the composition is not particularly limited thereto, but any general route through which the composition can reach an in vivo target It may be administered through, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, or rectal administration.
- routes of administration of the composition is not particularly limited thereto, but any general route through which the composition can reach an in vivo target It may be administered through, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, or rectal administration.
- the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, excipient or diluent.
- a pharmaceutically acceptable carrier excipient or diluent.
- Such pharmaceutically acceptable carriers, excipients, or diluents may be non-naturally occurring.
- the term "pharmaceutically acceptable” means a sufficient amount to exhibit a therapeutic effect and does not cause side effects, and the type of disease, the patient's age, weight, health, sex, and the patient's sensitivity to the drug , administration route, administration method, frequency of administration, treatment period, combination or drugs used at the same time can be easily determined by those skilled in the art according to factors well known in the medical field.
- the pharmaceutical composition comprising GLP-2 or a long-acting conjugate thereof of the present invention may further include a pharmaceutically acceptable carrier.
- the carrier is not particularly limited thereto, but in the case of oral administration, a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersing agent, a stabilizer, a suspending agent, a color, a fragrance, etc. may be used, and in the case of an injection, a buffer, A preservative, an analgesic agent, a solubilizer, an isotonic agent, a stabilizer, etc. can be mixed and used, and in the case of topical administration, a base, excipient, lubricant, preservative, etc. can be used.
- the formulation of the composition of the present invention can be prepared in various ways by mixing with the pharmaceutically acceptable carrier as described above.
- the pharmaceutically acceptable carrier in the case of oral administration, it may be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like, and in the case of injections, it may be prepared in the form of unit dose ampoules or multiple doses.
- it can be formulated as a solution, suspension, tablet, pill, capsule, sustained-release preparation, and the like.
- suitable carriers, excipients and diluents for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, Microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil may be used.
- it may further include a filler, an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, a preservative, and the like.
- the pharmaceutical composition of the present invention is any one selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, internal solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solvents, freeze-dried preparations and suppositories may have the form of
- composition is formulated in a dosage form suitable for administration in a patient's body according to a conventional method in the pharmaceutical field, specifically, a formulation useful for administration of a protein drug, and administration commonly used in the art.
- the conjugate can be used by mixing with various pharmaceutically acceptable carriers such as physiological saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran, ascorbic acid (ascorbic acid) to increase stability or absorption acid) or antioxidants such as glutathione, chelating agents, low molecular weight proteins or other stabilizers, etc. may be used as agents.
- various pharmaceutically acceptable carriers such as physiological saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran, ascorbic acid (ascorbic acid) to increase stability or absorption acid) or antioxidants such as glutathione, chelating agents, low molecular weight proteins or other stabilizers, etc.
- the dosage and frequency of administration of the pharmaceutical composition of the present invention is determined according to the type of drug as the active ingredient, along with several related factors such as the disease to be treated, the route of administration, the age, sex and weight of the patient, and the severity of the disease.
- the total effective amount of the composition of the present invention may be administered to a patient as a single dose, or may be administered by a fractionated treatment protocol in which multiple doses are administered for a long period of time.
- the pharmaceutical composition of the present invention may vary the content of the active ingredient depending on the severity of the disease. Specifically, a preferred total dose of GLP-2 or a long-acting conjugate thereof of the present invention may be about 0.0001 mg to 500 mg per kg of body weight of a patient per day.
- the dose of GLP-2 or its long-acting conjugate is determined by considering various factors such as the age, weight, health status, sex, severity of disease, diet and excretion rate of the patient, as well as the administration route and number of treatments of the pharmaceutical composition. Since the effective dosage is determined for, those of ordinary skill in the art in consideration of this will be able to determine an appropriate effective dosage according to the specific use of the composition of the present invention.
- the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route and administration method as long as the effect of the present invention is exhibited.
- GLP-2 or a GLP-2 derivative; Or that the long-acting conjugate comprising the same is included in the pharmaceutical composition in a pharmacologically effective amount means GLP-2 or a GLP-2 derivative; Or it means the degree to which the desired pharmacological activity (eg, prevention, improvement or treatment of bone metabolic disease) can be obtained due to the long-acting conjugate containing the same, and toxicity or side effects do not occur or are insignificant in the administered subject.
- a pharmaceutically acceptable level but is not limited thereto.
- Such a pharmaceutically effective amount may be determined by comprehensively considering the number of administration, patient, formulation, and the like.
- the pharmaceutical composition of the present invention has excellent in vivo persistence and potency, so that the number and frequency of administration of the pharmaceutical preparation of the present invention can be significantly reduced.
- the pharmaceutical composition of the present invention may be administered once a week, once every two weeks, once every four weeks, or once a month, but is not limited thereto.
- Another aspect embodying the present invention provides a food composition for preventing or improving bone metabolic disease, comprising GLP-2 or a long-acting conjugate thereof.
- the GLP-2 or its long-acting conjugate, bone metabolic disease, etc. are the same as described above.
- the food composition may be used as a health functional food.
- GLP-2 or a GLP-2 derivative When the composition of the present invention is used as a food additive, GLP-2 or a GLP-2 derivative; Alternatively, a long-acting binder including the same may be added as it is or used with other foods or food ingredients, and may be appropriately used according to a conventional method.
- the mixing amount of the active ingredient may be appropriately determined according to the purpose of use (prevention, health or therapeutic treatment).
- health functional food in the present invention refers to a food manufactured and processed by extracting, concentrating, refining, mixing, etc., a specific ingredient as a raw material or a specific ingredient contained in a food raw material for the purpose of health supplementation, It refers to food designed and processed to sufficiently exert biological control functions such as biological defense, regulation of biological rhythm, prevention and recovery of disease, etc., by the above ingredients, and the composition for health food is used for prevention of diseases and prevention of diseases. It can perform functions related to recovery, etc.
- Another aspect for implementing the present invention provides a method for preventing or treating bone metabolic disease, comprising administering a composition comprising the GLP-2 or a long-acting conjugate thereof to an individual in need thereof.
- the GLP-2 or its long-acting conjugate, bone metabolic disease, etc. are the same as described above.
- the subject is a subject suspected of having a bone metabolic disease
- the subject suspected of a bone metabolic disease is a mammal, including mice, livestock, etc., including humans that has or may develop a bone metabolic disease
- Individuals that can be treated with a conjugate of or the composition comprising the same are included without limitation. Specific examples include, without limitation, any individual beneficial for promoting bone formation and/or inhibiting bone degradation.
- the method of the present invention may include administering a pharmaceutical composition comprising GLP-2 or a long-acting conjugate thereof in a pharmaceutically effective amount.
- a suitable total daily amount may be determined by the treating physician within the scope of sound medical judgment, and may be administered once or divided into several doses.
- a specific therapeutically effective amount for a particular patient depends on the type and extent of the response to be achieved, the specific composition, including whether other agents are used, if necessary, the specific composition, the patient's age, weight, general health, It is preferable to apply differently depending on various factors including sex and diet, administration time, administration route and secretion rate of the composition, treatment period, drugs used together or concurrently with a specific composition, and similar factors well known in the pharmaceutical field.
- the preferred total dose of GLP-2 or a long-acting conjugate thereof of the present invention may be about 0.0001 mg to 500 mg/kg of patient body weight per day, once a week, once every 2 weeks, for 4 weeks. It may be administered once or once a month, but is not limited thereto.
- Another aspect for implementing the present invention provides the use of the GLP-2 or a long-acting conjugate thereof or a composition comprising the same for the prevention or treatment of bone metabolic diseases.
- the GLP-2 or its long-acting conjugate, bone metabolic disease, etc. are the same as described above.
- Another aspect for implementing the present invention provides the use of GLP-2 or a long-acting conjugate thereof or a composition comprising the same in the manufacture of a medicament for the prevention or treatment of bone metabolic disease.
- the GLP-2 or its long-acting conjugate, bone metabolic disease, etc. are the same as described above.
- the GLP-2 derivative CA GLP-2 RK of SEQ ID NO: 4 in Table 1 is modified polyethylene glycol ALD(2) PEG (hydrogens at both ends are substituted with propionaldehyde groups (3-oxopropyl groups), respectively, and ethylene glycol repeating units For pegylation with modified polyethylene glycol having a moiety formula weight of 3.4 kDa, NOF, Japan), the molar ratio of the GLP-2 derivative and the ALD(2) PEG was 1: 5 to 1: 20, the GLP-2 derivative At a concentration of 5 to 10 mg/ml, the reaction was performed at 2 to 8° C. for 4 to 16 hours.
- reaction was carried out in 20 mM HEPES pH 7.5 and ethanol, and a reducing agent, 20 mM sodium cyanoborohydride [sodium cyanoborohydride (NaCNBH 3 )] was added to the reaction.
- the reaction solution was a monopegylated GLP-2 derivative using a Source 15S (GE, USA) column using a sodium citrate pH 2.0, ethanol-containing buffer solution and potassium chloride concentration gradient.
- the molar ratio of the purified monopegylated GLP-2 derivative and the immunoglobulin Fc fragment of SEQ ID NO: 31 is 1:2 to 1:6, and the total protein concentration is 30 to 35 mg/mL.
- the reaction was carried out at ⁇ 8° C. for 12 to 20 hours. At this time, 20 mM sodium cyanoborohydride was added as a reducing agent to the reaction solution in 100 mM potassium phosphate buffer (pH 6.0) and isopropanol.
- the reaction solution was applied to a Source 15Q (GE, USA) column using a bis-Tris pH 6.5 buffer and a sodium chloride concentration gradient, and a concentration gradient of ammonium sulfate and sodium citrate pH 5.0 to 5.2 was applied to Source 15 ISO (GE, USA), and a long-acting conjugate of the GLP-2 derivative, which is a conjugate in which the GLP-2 derivative is covalently linked to an immunoglobulin Fc fragment by a polyethylene glycol linker, was purified.
- Source 15Q GE, USA
- Example 2 Confirmation of changes in C-terminal telopeptide levels of osteocalcin, osteoprotezerin and type 1 collagen in the blood in osteoporosis model mice following administration of the GLP-2 derivative long-acting conjugate
- osteocalcin refers to a carboxylated osteocalcin capable of affinity binding to hydroxyapatite, a basic mineral component of bone.
- Osteoprotezerin OPG
- RTKL osteoclast progenitor receptor
- CX-1 C-terminal telopeptide of type 1 collagen is a specific peptide sequence produced by cleavage by osteoclasts during bone resorption, it is proportional to osteoclast activity.
- mice 7-week-old female mice
- the groups were separated and 10 mice in each group were removed from the normal control group (only skin incision and suture without ovariectomy, G1, Sham Vehicle), ovariectomized control group (G2, OVX vehicle), group administered teduglutide (56 ⁇ g/kg/BID) after ovariectomy (G3, OVX Teduglutide), GLP-2 derivative long-acting conjugate after ovariectomy ( 6237 ⁇ g/kg/QW) was divided into groups (G4, OVX GLP-2) (In the present specification, 6237 ⁇ g is used in the figure of 6237 ⁇ g/kg per week expressed as the dose of the GLP-2 derivative long-acting conjugate.
- the blood osteoprotezerin (OPG) level was It showed a tendency to increase compared to the ovariectomized control group (OVX vehicle), and it was confirmed that it increased significantly compared to the group administered with teduglutide (56 ⁇ g/kg/BID) (FIG. 1 (B)).
- the level of C-terminal telopeptide (CTX-1) in the blood tended to decrease compared to the ovariectomized control group (OVX vehicle).
- CTX-1 C-terminal telopeptide
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Physical Education & Sports Medicine (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Rheumatology (AREA)
- Endocrinology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Abstract
본 발명은 GLP-2 또는 이의 지속형 결합체의 골 대사성 질환 예방 또는 치료 용도에 관한 것이다.
Description
본 발명은 GLP-2 및 이의 지속형 결합체의 골 대사성 질환에 대한 치료적 용도에 관한 것이다.
글루카곤 유사 펩타이드-2(GLP-2)는 섭취된 영양분에 반응하여 소장의 L-세포에서 생성되는 33개의 아미노산으로 구성된 펩타이드 호르몬이다. GLP-2는 소장, 대장에서 점막 성장을 유도하고, 장세포와 crypt 세포의 성장 촉진 및 세포사멸(apoptosis)을 억제한다. 또한 GLP-2는 소장에서 영양분의 흡수를 증가시키고 장 투과성을 감소시킨다. 위 배출(Gastric emptying) 및 위산 분비를 억제하고, 장 혈류 속도를 증가시키고, 장평활근을 이완시킨다.
골 대사성 질환(metabolic bone disease, MBD)은 다양한 범주의 장애가 야기하는 뼈의 기형을 지칭하는 포괄적인 용어로, 칼슘, 인, 마그네슘, 비타민 D 등의 불균형에 의해 발병하며, 특히 칼슘 부족이 대표적인 원인으로 알려져 있다. 골 대사성 질환의 예로는, 골다공증, 골연화증, 구루병, 낭포성섬유성골염, 뼈 페이젯병 등을 들 수 있다.
한편, 골 대사성 질환의 대표적인 예인 골다공증은 정도에 차이는 있으나 노년층, 특히 폐경기 이후의 여성에게 있어서는 피할 수 없는 증상으로, 선진국에서는 인구가 노령화됨에 따라 골다공증 및 그 치료제에 대한 관심이 점차 증가하고 있다. 골다공증은 정상인에 비하여 현저하게 뼈의 양이 줄어든 상태를 지칭하며, 체중이나 기계적인 압력에 견디는 힘이 약해지고 실내에서 가볍게 넘어지는 것과 같은 미약한 충격에도 뼈가 쉽게 골절을 일으키는 흔한 대사성 질환이다.
우리 몸의 뼈는 흡수되고 생성되는 재현성 과정을 반복하며, 골 대사성 질환은 이런 골 형성과 골 흡수 과정의 균형이 깨져 생기는 것으로 보고 있다. 뼈의 형성을 촉진하고 뼈의 분해를 억제하는 것은 골다공증을 비롯한 골 대사성 질환을 치료하기 위하여 중요한 치료 기전으로 알려져 있다. 이에, 골형성을 증가시키거나 골소실을 방지하여 현재의 골량을 유지하기 위한 약물들이 개발되고 있다. 골흡수를 억제시키는 약물로는 비스포스페이트, 칼시토닌, 또는 에스트로겐 등이 사용되고 있으며, 골형성을 증가시키기 위해 부갑상선호르몬이 사용되고 있다(대한민국 등록특허 제10-1964376호).
현재까지 글루카곤-유사 펩타이드-2를 이용한 골 대사성 질환 치료제 개발은 미비한 상태인바, 지속적인 치료제 개발의 필요성이 있다.
본 발명의 하나의 목적은 GLP-2(Glucagon-like peptide-2)를 포함하는 골 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 다른 목적은 GLP-2 또는 이를 포함하는 조성물을 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 골 대사성 질환의 예방 또는 치료 방법을 제공하는 것이다.
본 발명의 다른 목적은 골 대사성 질환의 예방 또는 치료를 위한 약제의 제조에 있어서 GLP-2 또는 이를 포함하는 조성물의 용도를 제공하는 것이다.
본 발명을 구현하는 하나의 양태는 글루카곤 유사 펩타이드-2(Glucagon-like peptide-2, GLP-2)를 포함하는 골 대사성 질환의 예방, 치료, 또는 개선용 조성물이다.
하나의 구체예로서, 본 발명은 GLP-2를 포함하는, 골 대사성 질환의 예방 또는 치료를 위한 약학적 조성물에 관한 것이다.
다른 하나의 구체예로서, 본 발명은 GLP-2를 포함하는, 골 대사성 질환의 예방 또는 개선을 위한 식품 조성물에 관한 것이다.
앞선 구체예에 따른 조성물로서, 본 발명은 약학적으로 허용되는 부형제; 및 GLP-2를 약학적 유효량으로 포함하는, 골 대사성 질환의 예방 또는 치료를 위한 약학적 조성물에 관한 것이다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2는 천연형 GLP-2; 또는 천연형 GLP-2 서열에서 적어도 하나 이상의 아미노산에 치환(substitution), 추가(addition), 제거(deletion), 수식(modification) 및 이들의 조합으로 이루어지는 군에서 선택된 변형이 일어난 GLP-2 유도체인 것인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 34번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 하기 일반식 1로 표시되는 아미노산 서열을 포함하는 펩타이드인 것을 특징으로 한다:
[일반식 1]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신, 또는 시스테인임.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는
(1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,
(2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,
(3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,
(4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,
(5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,
(6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는
(7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 하기 일반식 2로 표시되는 아미노산 서열을 포함하는 것인, 조성물:
[일반식 2]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 서열번호 2 내지 8로 이루어진 군으로부터 선택된 아미노산 서열인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 골 대사성 질환은 골다공증(Osteoporosis), 골감소증(Osteopenia), 관절염 (Arthritis), 치주질환(Periodontal disease), 골 형성 부전증(Osteopsathyrosis), 또는 골연화증(Osteomalacia)인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 조성물은 뼈의 형성을 촉진하거나; 뼈의 분해를 억제하거나; 뼈의 형성을 촉진하고 뼈의 분해를 억제하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 골 대사성 질환은 골다공증인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 조성물은 투여시 투여 시 하기 특성 중 하나 이상을 갖는 것을 특징으로 한다:
(i) 오스테오칼신(Osteocalcin/Bone Gla Protein, OC/BGP)의 혈중 농도 증가;
(ii) 오스티오프로테제린(Osteoprotegerin, OPG)의 혈중 농도 감소; 및
(iii) 제1형 콜라겐의 C-말단 텔로펩타이드 (C-telopeptide of collagen type 1, CTX-1) 혈중 농도 감소.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2는 이의 C-말단이 변형되지 않았거나 아미드화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 결합체는 하기 화학식 1로 표시되는 것을 특징으로 한다:
[화학식 1]
X - La - F
여기서,
X는 GLP-2(천연형 GLP-2 또는 GLP-2 유도체)이고;
L은, 에틸렌글리콜 반복 단위를 함유하는 링커이며;
a는, 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;
F는, 면역글로불린 Fc 영역이며;
상기 "-"는 공유 결합임.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 F는 면역글로불린 Fc 영역인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 면역글로불린 Fc 영역은 비당쇄화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 면역글로불린 Fc 영역은 IgG4 Fc 영역인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 면역글로불린 Fc 영역은 인간 IgG4 유래의 비-당쇄화된 Fc 영역인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 F는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 L은 폴리에틸렌글리콜인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 L 내의 에틸렌글리콜 반복 단위 부위(moiety)의 화학식량은 1 내지 100 kDa 범위에 있는 것을 특징으로 한다.
본 발명의 다른 양태는 약학적으로 유효량의 GLP-2 또는 GLP-2 지속형 결합체 또는 이를 포함하는 조성물을 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 골 대사성 질환의 예방 또는 치료 방법이다.
본 발명의 다른 양태는 골 대사성 질환의 예방 또는 치료를 위한 GLP-2 또는 이를 포함하는 조성물의 용도이다.
본 발명의 다른 양태는 골 대사성 질환의 예방 또는 치료를 위한 약제의 제조에 있어서 GLP-2 또는 이를 포함하는 조성물의 용도이다.
본 발명에 따른 GLP-2를 포함하는 조성물은 골다공증을 비롯한 골 관련 질환의 치료에 적용될 수 있다.
도 1은 오스테오칼신(OC/BGP), 오스티오프로테제린(OPG), 및 제1형 콜라겐의 C-말단 텔로펩타이드(CTX-1)의 혈중 농도 변화를 통해 GLP-2 지속형 결합체의 골 대사성 질환 치료 효과를 확인한 도이다.
이하에서는, 본 발명을 더욱 상세히 설명한다.
한편, 본원에서 개시되는 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본원에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술되는 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 할 수 없다.
또한, 당해 기술분야의 통상의 지식을 가진 자는 통상의 실험만을 사용하여 본 출원에 기재된 본 발명의 특정 양태에 대한 다수의 등가물을 인지하거나 확인할 수 있다. 또한, 이러한 등가물은 본 발명에 포함되는 것으로 의도된다.
본 명세서 전반을 통하여, 천연적으로 존재하는 아미노산에 대한 통상의 1문자 및 3문자 코드가 사용될 뿐만 아니라 Aib (α-아미노이소부티르산), Sar (N-methylglycine), 알파-메틸-글루탐산 (α-methyl-glutamic acid) 등과 같은 다른 아미노산에 대해 일반적으로 허용되는 3문자 코드가 사용된다. 또한 본 명세서에서 약어로 언급된 아미노산은 IUPAC-IUB 명명법에 따라 기재되었다.
알라닌 Ala, A 아르기닌 Arg, R
아스파라긴 Asn, N 아스파르트산 Asp, D
시스테인 Cys, C 글루탐산 Glu, E
글루타민 Gln, Q 글리신 Gly, G
히스티딘 His, H 이소류신 Ile, I
류신 Leu, L 라이신 Lys, K
메티오닌 Met, M 페닐알라닌 Phe, F
프롤린 Pro, P 세린 Ser, S
트레오닌 Thr, T 트립토판 Trp, W
티로신 Tyr, Y 발린 Val, V
본 발명을 구현하기 위한 하나의 양태는 글루카곤 유사 펩타이드-2(Glucagon-like peptide-2, GLP-2)를 포함하는, 골 질환의 예방 또는 치료를 위한 약학적 조성물을 제공한다. 구체적으로, 상기 골 질환은 골 대사성 질환일 수 있고, 보다 더 구체적으로 골 감소성 질환일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 한 구체적인 예로, 약학적으로 허용되는 부형제; 및 글루카곤 유사 펩타이드-2를 약학적 유효량으로 포함하는 골 대사성 질환의 예방 또는 치료용 약학적 조성물을 들 수 있으나, 이에 제한되지 않는다.
본 발명에서 용어 “글루카곤 유사 펩타이드-2” 또는 "GLP-2(Glucagon-like peptide-2)"는 사람 글루카곤 유사 펩타이드-2 수용체(glucagon-like peptide-2receptor)의 작용제(agonist)로서 폴리펩타이드 형태 또는 폴리펩타이드에 비폴리펩타이드 부위가 연결된 결합체(conjugate) 형태인 물질을 가리킨다. 본 발명에서 글루카곤 유사 펩타이드-2 또는 GLP-2에는 천연형 사람 GLP-2뿐만 아니라, 이의 유도체(derivative)도 포함되며, 이들의 결합체도 포함된다. 상기 GLP-2는 본 발명의 약학적 조성물에 포함되는 유효성분으로서, 약학적 조성물에 약리학적 유효량으로 포함되는 것일 수 있다.
천연형 GLP-2의 아미노산 서열은 아래와 같다.
GLP-2(1-33)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD (서열번호 1)
본 발명에서 "GLP-2 수용체 작용제"는 생체 내 또는 분리된 사람 글루카곤 유사 펩타이드-2(GLP-2) 수용체와 결합하여 천연형 GLP-2와 동일한 혹은 유사한 생리활성을 일으키는 물질을 말한다. 예를 들어, GLP-2 작용제에는 천연형 GLP-2 또는 GLP-2 유도체가 포함될 수 있다.
본 발명에서 "GLP-2 유도체"는 천연형 GLP-2와 비교하여 아미노산 서열에 하나 이상의 차이가 있는 펩타이드; 천연형 GLP-2 서열을 개질(modification)을 통하여 변형시킨 펩타이드; 및/또는 천연형 GLP-2와 같이 골 대사성 질환의 예방, 치료 및/또는 개선 기능을 가진 천연형 GLP-2의 모방체를 포함한다. 구체적으로, 상기 GLP-2 유도체는 천연형 GLP-2 서열에서 적어도 하나 이상의 아미노산에 치환(substitution), 추가(addition), 제거(deletion), 수식(modification) 및 이들의 조합으로 이루어지는 군에서 선택된 변형이 일어난 것일 수 있으나, 이에 제한되지 않는다.
하나의 구체적인 실시 형태에서 본 발명의 GLP-2는 N-말단 아미노기가 치환, 제거, 또는 수식될 수 있으나, 이에 제한되지 않는다. 본 발명의 GLP-2는 지속형 결합체 제조 시 GLP-2의 생체 내 활성에 중요한 부위인 N-말단에 결합이 일어나는 것을 방지하기 위해, N-말단 히스티딘의 알파 아미노기를 제거하는 방법, N-말단 아미노기를 하이드록실(hydroxyl)기 또는 카복실(carboxyl)기로 치환하여 합성하는 방법, N-말단 히스티딘의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기를 제거하여 이미다조-아세틸(imidazo-acetyl) 작용기만을 남겨두는 방법, N-말단 아미노기를 2개의 메틸기로 수식하는 방법 등을 통해 제조될 수 있다.
구체적으로, GLP-2 유도체는 GLP-2의 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딜 GLP-2(imidazoacetyl-deshistidyl-GLP-2, CA-GLP-2), GLP-2의 N-말단 아미노기가 제거된 데스아미노히스티딜 GLP-2(desaminohistidyl GLP-2, DA-GLP-2), GLP-2의 N-말단 아미노기가 하이드록실기로 치환된 베타-히드록시이미다조프로피온일데스히스티딜 GLP-2(β-hydroxyimidazopropionyldeshistidyl GLP-2, HY-GLP-2), GLP-2의 N-말단 아미노기가 2개의 메틸기로 수식된 N-디메틸히스티딜 GLP-2(N-dimethylhistidyl GLP-2, DM-GLP-2), 또는 GLP-2의 N-말단 아미노기가 카복실기로 치환된 베타-카복시이미다조프로피온일데스히스티딜-GLP-2(β-carboxyimidazopropionyl-deshistidyl GLP-2, CX-GLP-2)일 수 있으나, 이에 제한되지 않는다. 하나의 비제한적 예시로서 GLP-2 유도체 제조에 사용된 물질 구조는 아래와 같다.
하나의 구체적인 실시 형태에서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 34번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것일 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 변형은 적어도 하나의 아미노산의 치환, 추가, 제거, 수식, 및 이들의 조합으로 이루어지는 군에서 선택된 변형일 수 있으며, 이 때 추가되는 아미노산은 비 천연형 아미노산(예; D형 아미노산)도 가능하며, 천연형 아미노산 이외에 비 천연형 아미노산의 치환도 가능하다. 상기 추가되는 아미노산 서열은 천연형 GLP-2에서 유래된 것일 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2의 유도체는 천연형 GLP-2와 아미노산 서열에서 적어도 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 이상의 상동성을 보이는 것일 수 있고/있거나, GLP-2의 아미노산 한 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation), 제거(예; deamination) 또는 수식(예; N-methylation) 된 형태일 수 있으나, 이에 제한되는 것은 아니다.
하나의 구체적인 실시 형태에서, GLP-2 유도체는 하기 일반식 1의 아미노산 서열을 포함할 수 있으나, 이에 제한되지 않는다:
[일반식 1]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신, 또는 시스테인임.
다른 하나의 구체적인 실시 형태에서, GLP-2 유도체는 하기 일반식 2의 아미노산 서열을 포함할 수 있으나, 이에 제한되지 않는다:
[일반식 2]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산임.
구체적으로, 상기 일반식 1 또는 2의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 GLP-2 유도체에서 제외될 수 있으나, 이에 제한되지 않는다
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신 또는 Aib(2-aminoisobutyric acid)으로의 치환, 30번째 아미노산인 라이신의 아르지닌으로의 치환, 또는 이들의 조합을 가질 수 있으나, 이에 제한되지 않는다. 또한, 상기 GLP-2 유도체는 C-말단(예들 들어, 33번째 아미노산)에 티올기(예들 들어, 시스테인), 아미노기(예를 들어, 라이신, 아르지닌, 글루타민 또는 히스티딘), 또는 아지드기(예들 들어, 6-아지도라이신)가 도입될 수 있으나, 이에 제한되지 않는다.
GLP-2 유도체의 지속형 결합체 제조 시 상기 도입된 그룹에서 결합이 일어나므로, 이를 이용하여 결합 위치가 선택적으로 조절된 GLP-2 결합체를 제조할 수 있다. 구체적으로, GLP-2 유도체의 하이드록실기, 티올기, 아미노기 또는 아지드기에 비펩타이드성 링커의 한 쪽 말단이 결합되고, 비펩타이드성 링커의 다른 말단에 생체 내 반감기를 증가시킬 수 있는 물질(예를 들어, 면역글로불린 Fc 영역)이 결합될 수 있다. 상기 티올기, 아미노기 또는 아지드기는 GLP-2에 아미노산을 추가하여 도입시킬 수 있으나, 이에 제한되지 않는다. 상기 티올기는 GLP-2에 시스테인(C)을 추가시켜 도입되고; 아미노기는 라이신(K), 아르지닌(R), 글루타민(Q) 또는 히스티딘(H)을 추가시켜 도입되고; 아지드기는 6-아지도라이신(6-azidolysine, AZK)을 추가시켜 도입될 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명에 따른 GLP-2 유도체는 적어도 하나의 잔기가 시스테인, 라이신, 아르지닌, 글루타민, 히스티딘 또는 6-아지도라이신일 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 2의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 아미노기(예를 들어, 라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 3의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환, 천연형 GLP-2의 30번째 아미노산인 라이신의 아르지닌으로의 치환 및 C-말단에 아미노기(예를 들어, 라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 4의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 아지드기(예들 들어, 6-아지도라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 5의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환, 천연형 GLP-2의 30번째 아미노산인 라이신의 아르지닌으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 6의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 2-아미노이소부티르산으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 그 예로 서열번호 8의 아미노산 서열을 가질 수 있고, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 7의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
상기 서열번호 2 내지 8의 GLP-2 유도체를 하기 표 1에 나타내었다.
상기 표 1에서 caH는 히스티딘 대신 이미다조아세틸데스히스티딘으로 치환된 것을, Aib는 2-아미노이소부티르산(2-aminoisobutyric acid)을, AZK는 6-아지도-L-라이신(6-azido-L-lysyine)을 가리킨다.
본 발명에 따른 GLP-2 유도체는 상기 기술된 특정 서열을 포함하는 펩타이드, 상기 기술된 특정 서열로 (필수적으로) 구성된 펩타이드일 수 있으나, 이에 제한되는 것은 아니다.
한편, 본원에서 '특정 서열번호로 구성되는 (이루어진)' 펩타이드 또는 GLP-2 유도체라고 기재되어 있다 하더라도, 해당 서열번호의 아미노산 서열로 이루어진 펩타이드 또는 GLP-2 유도체와 동일 혹은 상응하는 활성을 가지는 경우라면 해당 서열번호의 아미노산 서열 앞뒤의 무의미한 서열 추가 또는 자연적으로 발생할 수 있는 돌연변이, 혹은 이의 잠재성 돌연변이(silent mutation)를 제외하는 것이 아니며, 이러한 서열 추가 혹은 돌연변이를 가지는 경우에도 본원의 범위 내에 속하는 것이 자명하다.
구체적으로, GLP-2 유도체는 일반식 1 또는 2에서 (1) X2가 글라이신 또는 Aib이거나, (2) X30이 라이신 또는 아르지닌이거나, 또는 (3) X2가 글라이신 또는 Aib이고, X30이 라이신 또는 아르지닌일 수 있으나, 이에 제한되지 않는다.
구체적으로, 일반식 1 또는 2에서
(1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,
(2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,
(3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,
(4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,
(5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,
(6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는
(7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인 일 수 있으나, 이에 제한되지 않는다.
본 발명에서 천연형 GLP-2의 작용제, 단편, 변이체 및 유도체의 제조를 위한 이러한 변형은 L-형 혹은 D-형 아미노산, 및/또는 비-천연형 아미노산을 이용한 변형; 및/또는 천연형 서열을 개질 혹은 번역 후 변형 (예, 메틸화, 아실화, 유비퀴틴화, 분자 내 공유결합 등) 함으로써 변형하는 것을 모두 포함한다.
본 발명에서, 상기 GLP-2 또는 GLP-2 유도체는 생체 내의 단백질 절단 효소들로부터 보호하고 안정성을 증가시키기 위하여 이의 N-말단 및/또는 C-말단 등이 화학적으로 수식되거나 유기단으로 보호되거나, 또는 GLP-2 또는 GLP-2 유도체는 말단 등에 아미노산이 추가되어 변형된 형태일 수 있다.
특히, 화학적으로 합성한 펩타이드의 경우, N- 및 C-말단이 전하를 띠고 있기 때문에, 이러한 전하를 제거하기 위하여 N-말단을 아세틸화(acetylation) 및/또는 C-말단을 아미드화(amidation)할 수 있으나, 특별히 이에 제한되지는 않는다.
구체적으로, 본 발명에서, GLP-2 또는 GLP-2 유도체는 이의 C-말단이 변형되지 않았거나 아미드화된 것일 수 있으나, 이에 제한되지 않는다.
본 발명의 GLP-2 또는 GLP-2 유도체는 Solid phase 합성법을 통하여 합성될 수 있으며, 재조합 방법으로도 생산 가능하고, 상업적으로 의뢰하여 제조할 수 있다.
본 발명에서, 상기 GLP-2는 천연형 GLP-2 또는 GLP-2 유도체에 천연형 GLP-2 또는 GLP-2 유도체의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된 지속형 결합체의 형태일 수 있으나, 이에 제한되지 않는다. 상기 지속형 결합체는 생체적합성물질(예로서, 면역글로불린 Fc 영역)이 결합되지 않은 GLP-2 또는 이의 유도체에 비하여 증가된 효력의 지속성을 나타낼 수 있으며, 본 발명에서는 GLP-2 또는 이의 유도체에 생체적합성 물질이 결합하여 반감기가 증가된, GLP-2 또는 이의 유도체를 포함하는 결합체를 "지속형 결합체"로 지칭한다. 본 발명에서 지속형 결합체는 결합체와 혼용된다.
한편, 이러한 결합체는 비자연적인 (non-naturally occurring) 것일 수 있다.
또한, GLP-2의 지속형 결합체에 있어서 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)의 연결은 물리 또는 화학 결합이거나, 비공유 또는 공유 결합일 수 있으며, 구체적으로 공유 결합일 수 있으나 이에 제한되지 않는다.
또한, GLP-2의 지속형 결합체는 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)의 연결 방법은 특별히 제한되지 않으나, 링커를 통해 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)이 서로 연결된 것일 수 있다.
또한, GLP-2의 지속형 결합체에 관한 한국 공개특허 제10-2019-0037181호는 참조로 본원에 포함된다
하나의 구체적인 실시 형태에서, 본 발명의 GLP-2의 지속형 결합체는 하기 화학식 1의 구조를 가진다.
[화학식 1]
X - La - F
여기서,
X는 GLP-2(천연형 GLP-2 또는 GLP-2 유도체)이고;
L은 에틸렌글리콜 반복 단위를 함유하는 링커이고;
a는 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;
F는 면역글로불린 Fc 영역이며;
상기 “-“는 공유결합이다.
보다 구체적으로, X와 L, 및 L과 F는 공유결합으로 서로 연결되는 것일 수 있으며, 이때 상기 결합체는 화학식 1의 순서로, X, L, 및 F가 공유결합을 통하여 각각 연결된 결합체일 수 있다.
또한, 상기 F는 X와 직접적으로 연결되거나 (즉, 상기 화학식 1에서 a가 0이거나), 또는 링커 (L)를 통해 연결된 것일 수 있다.
본 발명에 따른 결합체에서 F는 X, 즉 본 발명에 따른 GLP-2 또는 이의 유도체의 반감기를 증가시킬 수 있는 물질로서, 본 발명의 결합체를 구성하는 모이어티의 일 구성에 해당한다.
상기 F는 X와 공유 화학결합 또는 비공유 화학결합으로 서로 결합되는 것일 수 있으며, 공유 화학결합, 비공유 화학결합 또는 이들의 조합으로 L을 통하여 F와 X가 서로 결합되는 것일 수 있다.
상기 F는 X의 반감기를 증가시킬 수 있는 물질은 생체적합성 물질로서, 예를 들어, 고분자 중합체, 지방산, 콜레스테롤, 알부민 및 이의 단편, 알부민 결합물질, 특정 아미노산 서열의 반복단위의 중합체, 항체, 항체 단편, FcRn 결합물질, 생체 내 결합조직, 뉴클레오타이드, 파이브로넥틴, 트랜스페린(Transferrin), 사카라이드(saccharide), 헤파린, 및 엘라스틴으로 이루어진 군에서 선택되는 것일 수 있으나, 특별히 이에 제한되지 않는다.
상기 엘라스틴의 경우 수용성 전구체인 인간 트로포엘라스틴(tropoelastin) 일 수 있으며, 이들 중 일부 서열 혹은 일부 반복단위의 중합체일 수 있으며, 예컨대, 엘라스틴 유사 폴리펩타이드인 경우를 모두 포함하나, 특별히 이에 제한되는 것은 아니다.
상기 고분자 중합체의 예로, 폴리에틸렌글리콜(PEG), 폴리프로필렌글리콜, 에틸렌글리콜-프로필렌글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 올리고뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 고분자 중합체를 들 수 있고, 상기 다당류로는 덱스트란이 포함될 수 있으나, 특별히 이에 제한되지 않는다.
본 명세서에서 폴리에틸렌글리콜은 에틸렌글리콜 동종 중합체, PEG 공중합체, 또는 모노메틸-치환된 PEG 중합체(mPEG)의 형태를 모두 포괄하는 용어이나, 특별히 이에 제한되는 것은 아니다.
또한, 상기 생체적합성 물질은 폴리-라이신, 폴리-아스파르트산 및 폴리-글루탐산과 같은 폴리-아미노산을 포함하나, 이에 제한되는 것은 아니다.
또한, 지방산은 생체 내 알부민과 결합력을 갖는 것일 수 있으나, 특별히 이에 제한되지 않는다.
상기 F의 한 예로서, 상기 F는 FcRn 결합 물질일 수 있고, 구체적으로, 상기 FcRn 결합물질은 면역글로불린 Fc 영역일 수 있으며, 보다 구체적으로 IgG Fc 영역, 더 구체적으로는 비당쇄화된 IgG4 Fc 영역일 수 있으나, 특별히 이에 제한되지 않는다.
본 발명의 구체적인 한 예로, 상기 F(예를 들어, 면역글로불린 Fc 영역)는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 구조를 가질 수 있으나, 이에 제한되지 않는다.
하나의 구체적인 실시 형태에서, 본 발명의 지속형 결합체는 GLP-2 또는 이의 유도체와 면역글로불린 Fc 영역이 연결된 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서, "면역글로불린 Fc 영역"은, 면역글로불린의 중쇄와 경쇄 가변영역을 제외한, 중쇄 불변영역 2(CH2) 및/또는 중쇄 불변영역 3(CH3)부분을 포함하는 부위를 의미한다. 상기 면역글로불린 Fc 영역은 본 발명의 결합체의 모이어티를 이루는 일 구성일 수 있다. 구체적으로, 상기 화학식 1에서 F에 해당한다.
본 명세서에서 Fc 영역이라고 하면 면역글로불린의 파파인 소화에서 얻는 천연형 서열뿐 아니라 그 유도체, 예컨대 천연 서열 중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 변환되어 천연형과 상이하게 된 서열까지 망라하여 포함된다.
상기 F(예를 들어, 면역글로불린 Fc 영역)는, 2개의 폴리펩타이드 사슬이 이황화결합으로 연결되어 있는 구조이며, 상기 두 사슬 중 한 사슬의 질소 원자를 통해서만 연결되어 있는 구조일 수 있으나, 이에 제한되지 않는다. 상기 질소 원자를 통한 연결은 라이신의 입실론 아미노 원자나 N-말단 아미노기에 환원적 아민화를 통하여 연결될 수 있다.
환원적 아민화 반응이란 반응물의 아민기 또는 아미노기가 다른 반응물의 알데히드(즉, 환원적 아민화가 가능한 작용기)와 반응하여 아민을 생성한 다음, 환원 반응에 의해 아민 결합을 형성시키는 반응을 의미하여, 당해 기술 분야에 널리 알려져 있는 유기합성 반응이다.
본 발명의 GLP-2 지속형 결합체의 하나의 구체예로서, 상기 지속형 결합체는 상기 면역글로불린 Fc 영역이 그 N-말단 질소 원자를 통하여 링커에 연결된 것일 수 있다.
이러한 면역글로불린 Fc 영역은 중쇄 불변영역에 힌지(hinge) 부분을 포함할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, 면역글로불린 Fc 영역은 N-말단에 특정 힌지 서열을 포함할 수 있다.
본 발명의 용어, "힌지 서열"은 중쇄에 위치하여 이황화결합(inter disulfide bond)를 통하여 면역글로불린 Fc 영역의 이량체를 형성하는 부위를 의미한다.
본 발명에서, 상기 힌지 서열은 하기의 아미노산 서열을 갖는 힌지 서열 중 일부가 결실되어 하나의 시스테인 잔기만을 갖도록 변이된 것일 수 있으나, 이에 제한되지 않는다:
Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Cys-Pro(서열번호 11).
상기 힌지 서열은 서열번호 11의 힌지 서열 중 8번째 또는 11번째 시스테인 잔기가 결실되어 하나의 시스테인 잔기만을 포함하는 것일 수 있다. 본 발명의 힌지 서열은 하나의 시스테인 잔기만을 포함하는, 3 내지 12개의 아미노산으로 구성된 것일 수 있으나, 이에 제한되지 않는다. 보다 구체적으로, 본 발명의 힌지 서열은 다음과 같은 서열을 가질 수 있다: Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro(서열번호 12), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Pro(서열번호 13), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser(서열번호 14), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Pro(서열번호 15), Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser(서열번호 16), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 17), Glu-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 18), Glu-Ser-Pro-Ser-Cys-Pro(서열번호 19), Glu-Pro-Ser-Cys-Pro(서열번호 20), Pro-Ser-Cys-Pro(서열번호 21), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Ser-Cys-Pro(서열번호 22), Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro(서열번호 23), Glu-Ser-Lys-Tyr-Gly-Pro-Ser-Cys-Pro(서열번호 24), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 25), Lys-Tyr-Gly-Pro-Pro-Cys-Pro(서열번호 26), Glu-Ser-Lys-Pro-Ser-Cys-Pro(서열번호 27), Glu-Ser-Pro-Ser-Cys-Pro(서열번호 28), Glu-Pro-Ser-Cys(서열번호 29), Ser-Cys-Pro(서열번호 30).
더욱 구체적으로는 상기 힌지 서열은 서열번호 21(Pro-Ser-Cys-Pro)또는 서열번호 30(Ser-Cys-Pro)의 아미노산 서열을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명의 GLP-2 지속형 결합체의 한 더욱 구체적인 형태에서, 상기 결합체내 상기 면역글로불린 Fc 영역의 N-말단은 프롤린이고, 이 결합체는 상기 프롤린의 질소 원자를 통하여 Fc 영역이 링커에 연결된 것이다.
본 발명의 GLP-2의 지속형 결합체의 한 실시 형태에서 상기 면역글로불린 Fc 영역은 힌지 서열이 존재함으로써 면역글로불린 Fc 영역의 사슬 두 개가 동종이합체(homodimer)나 이종이합체(heterodimer)를 형성한 이합체 형태일 수 있다. 본 발명의 화학식 1의 결합체는 링커의 일 말단이 이합체의 면역글로불린 Fc 영역의 한 사슬에 연결된 형태일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 용어, "N-말단"은 단백질 또는 폴리펩티드의 아미노 말단을 의미하는 것으로, 아미노 말단의 최말단, 또는 최말단으로부터 1개, 2개, 3개, 4개, 5개, 6개, 7개, 8개, 9개, 또는 10개 이상의 아미노산까지 포함하는 것일 수 있다. 본 발명의 면역글로불린 Fc 영역은 힌지 서열을 N-말단에 포함할 수 있으나, 이에 제한되지 않는다.
또한 본 발명의 면역글로불린 Fc 영역은 천연형과 실질적으로 동등하거나 향상된 효과를 갖는 한, 면역 글로불린의 중쇄와 경쇄 가변영역만을 제외하고, 일부 또는 전체 중쇄 불변영역 1(CH1) 및/또는 경쇄불변영역 1(CL1)을 포함하는 확장된 Fc 영역일 수 있다. 또한, CH2 및/또는 CH3에 해당하는 상당히 긴 일부 아미노산 서열이 제거된 영역일 수도 있다.
예컨대, 본 발명의 면역글로불린 Fc 영역은 1) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인, 2) CH1 도메인 및 CH2 도메인, 3) CH1 도메인 및 CH3 도메인, 4) CH2 도메인 및 CH3 도메인, 5) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인 중 1개 또는 2개의 이상의 도메인과 면역글로불린 힌지 영역(또는 힌지 영역의 일부)와의 조합, 또는 6) 중쇄 불변 영역 각 도메인과 경쇄 불변영역의 이량체일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명의 GLP-2 지속형 결합체의 하나의 실시 형태로서, 상기 면역글로불린 Fc 영역 F는 두 개의 폴리펩타이드 사슬로 이루어진 이합체(이량체 dimer)이며, 이 때 상기 Fc 영역 이합체 F와 X는 에틸렌글리콜 반복 단위를 함유하는 하나의 동일한 링커 L을 통하여 공유결합적으로 연결되어 있다. 이 실시 형태의 한 구체예에서, X는 이러한 Fc 영역 이합체 F의 두 폴리펩타이드 사슬 중 하나의 폴리펩타이드 사슬에만 링커 L을 통하여 공유결합으로 연결되어 있다. 이 실시 형태의 더욱 구체적인 예시에서, 이러한 Fc 영역 이합체 F의 두 폴리펩타이드 사슬 중 X가 연결된 하나의 폴리펩타이드 사슬에는 한 분자의 X만이 L을 통하여 공유결합적으로 연결되어 있다. 이 실시 형태의 가장 구체적인 예시에서 상기 F는 동종이합체이다.
본 발명의 지속형 결합체의 다른 실시 형태에서는, 이합체 형태의 하나의 Fc 영역에 X 두 분자가 대칭적으로 결합하는 것 역시 가능하다. 이때 상기 면역글로불린 Fc와 X는 비펩타이드성 링커에 의해 서로 연결될 수 있다. 그러나, 상기 기술된 예에 제한되는 것은 아니다.
또한, 본 발명의 면역글로불린 Fc 영역은 천연형 아미노산 서열뿐만 아니라 이의 서열 유도체를 포함한다. 아미노산 서열 유도체란 천연 아미노산 서열 중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 상이한 서열을 가지는 것을 의미한다.
예를 들면, IgG Fc의 경우 결합에 중요하다고 알려진 214 내지 238, 297 내지 299, 318 내지 322 또는 327 내지 331번 아미노산 잔기들이 변형을 위해 적당한 부위로서 이용될 수 있다.
또한, 이황화 결합을 형성할 수 있는 부위가 제거되거나, 천연형 Fc에서 N-말단의 몇몇 아미노산이 제거되거나 또는 천연형 Fc의 N-말단에 메티오닌 잔기가 부가될 수도 있는 등 다양한 종류의 유도체가 가능하다. 또한, 이펙터 기능을 없애기 위해 보체결합부위, 예로 C1q 결합부위가 제거될 수도 있고, ADCC (antibody dependent cell mediated cytotoxicity) 부위가 제거될 수도 있다. 이러한 면역글로불린 Fc 영역의 서열 유도체를 제조하는 기술은 국제특허공개 제WO 97/34631호, 국제특허공개 제96/32478호 등에 개시되어 있다.
분자의 활성을 전체적으로 변경시키지 않는 단백질 및 펩타이드에서의 아미노산 교환은 당해 분야에 공지되어 있다 (H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation), 아세틸화(acetylation) 및 아미드화(amidation) 등으로 수식(modification)될 수도 있다.
상기 기술한 Fc 유도체는 본 발명의 Fc 영역과 동등한 생물학적 활성을 나타내며 Fc 영역의 열, pH 등에 대한 구조적 안정성을 증대시킨 것일 수 있다.
또한, 이러한 Fc 영역은 인간, 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트 또는 기니아 픽 등의 동물의 생체 내에서 분리한 천연형으로부터 얻어질 수도 있고, 형질전환된 동물세포 또는 미생물로부터 얻어진 재조합형 또는 이의 유도체일 수 있다. 여기서, 천연형으로부터 획득하는 방법은 전체 면역글로불린을 인간 또는 동물의 생체로부터 분리한 후, 단백질 분해효소를 처리하여 획득하는 방법일 수 있다. 파파인을 처리할 경우에는 Fab 및 Fc로 절단되고, 펩신을 처리할 경우에는 pF'c 및 F(ab)2로 절단된다. 이를 크기 배제 크로마토그래피 (size-exclusion chromatography) 등을 이용하여 Fc 또는 pF'c를 분리할 수 있다. 더 구체적인 실시 형태에서는 인간 유래의 Fc 영역을 미생물로부터 수득한 재조합형 면역글로불린 Fc 영역이다.
또한, 면역글로불린 Fc 영역은 천연형 당쇄, 천연형에 비해 증가된 당쇄, 천연형에 비해 감소한 당쇄 또는 당쇄가 제거된 형태일 수 있다. 이러한 면역글로불린 Fc 당쇄의 증감 또는 제거에는 화학적 방법, 효소학적 방법 및 미생물을 이용한 유전 공학적 방법과 같은 통상적인 방법이 이용될 수 있다. 여기서, Fc에서 당쇄가 제거된 면역글로불린 Fc 영역은 보체(c1q)와의 결합력이 현저히 저하되고, 항체-의존성 세포독성 또는 보체-의존성 세포 독성이 감소 또는 제거되므로, 생체 내에서 불필요한 면역 반응을 유발하지 않는다. 이런 점에서 약물의 캐리어로서의 본래의 목적에 보다 부합하는 형태는 당쇄가 제거되거나 비당쇄화된 면역글로불린 Fc 영역이라 할 것이다.
본 발명에서 "당쇄의 제거(Deglycosylation)"는 효소로 당을 제거한 Fc 영역을 말하며, 비당쇄화(Aglycosylation)는 원핵동물, 더 구체적인 실시 형태에서는 대장균에서 생산하여 당쇄화되지 않은 Fc 영역을 의미한다.
한편, 면역글로불린 Fc 영역은 인간 또는 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트, 기니아 픽 등의 동물기원일 수 있으며, 더 구체적인 실시 형태에서는 인간 기원이다.
또한, 면역글로불린 Fc 영역은 IgG, IgA, IgD, IgE, IgM 유래 또는 이들의 조합(combination) 또는 이들의 혼성(hybrid)에 의한 Fc 영역일 수 있다. 더 구체적인 실시 형태에서는 인간 혈액에 가장 풍부한 IgG 또는 IgM유래이며 보다 더 구체적인 실시 형태에서는 리간드 결합 단백질의 반감기를 향상시키는 것으로 공지된 IgG 유래이다. 더욱 더 구체적인 실시 형태에서 상기 면역글로불린 Fc 영역은 IgG4 Fc 영역이며, 가장 구체적인 실시 형태에서 상기 면역글로불린 Fc 영역은 인간 IgG4 유래의 비-당쇄화된 Fc 영역이나, 이에 제한되는 것은 아니다.
또한, 하나의 구체예로서, 면역글로불린 Fc 영역은 인간 IgG4 Fc의 단편으로서, 각 단량체의 3번 아미노산인 시스테인 사이의 이황화 결합(inter-chain 형태)을 통해 2개의 단량체가 연결된 동종이합량체일 수 있으며, 이 때 동종이합체는 각 단량체에서 35번 및 95번의 시스테인 사이 및 141번 및 199번의 시스테인 사이에 이황화 결합, 즉 2개의 이황화 결합(intra-chain 형태)을 가지거나/가질 수 있다.
각 단량체의 아미노산 수는 221개의 아미노산으로 구성될 수 있므며, 동종이합체를 형성하는 아미노산은 전체 442개의 아미노산으로 이루어질 수 있으나, 이에 제한되지 않는다. 구체적으로 면역글로불린 Fc 절편은 서열번호 31의 아미노산 서열 (221개의 아미노산으로 구성됨)을 갖는 단량체 2개가 각 단량체의 3번 아미노산인 시스테인 사이에 이황화 결합을 통해 동종이합체를 형성하고, 상기 동종이합체의 단량체는 각각 독립적으로 35번 및 95번의 시스테인 간의 내부의 이황화 결합 및 141번 및 199번의 시스테인 간의 내부의 이황화 결합을 형성하는 것일 수 있으나, 이에 제한되지 않는다.
한편, 본 발명에서 "조합(combination)"이란 이량체 또는 다량체를 형성할 때, 동일 기원 단쇄 면역글로불린 Fc 영역을 암호화하는 폴리펩타이드가 상이한 기원의 단쇄 폴리펩타이드와 결합을 형성하는 것을 의미한다. 즉, IgG Fc, IgA Fc, IgM Fc, IgD Fc 및 IgE의 Fc 단편으로 이루어진 그룹으로부터 선택된 2개 이상의 단편으로부터 이량체 또는 다량체의 제조가 가능하다.
본 발명에서 "하이브리드(hybrid)"란 단쇄의 면역글로불린 불변영역 내에 2개 이상의 상이한 기원의 면역글로불린 Fc 단편에 해당하는 서열이 존재함을 의미하는 용어이다. 본 발명의 경우 여러 형태의 하이브리드가 가능하다. 즉, IgG Fc, IgM Fc, IgA Fc, IgE Fc 및 IgD Fc의 CH1, CH2, CH3 및 CH4로 이루어진 그룹으로부터 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하며, 힌지를 포함할 수 있다.
한편, IgG 역시 IgG1, IgG2, IgG3 및 IgG4의 서브클래스로 나눌 수 있고 본 발명에서는 이들의 조합 또는 이들의 혼성화도 가능하다. 구체적으로는 IgG2 및 IgG4 서브클래스이며, 가장 구체적으로는 보체 의존적 독성(CDC, Complement dependent cytotoxicity)과 같은 이펙터 기능(effector function)이 거의 없는 IgG4의 Fc 영역이다.
또한, 상술한 결합체는 효력의 지속성이 천연형 GLP-2에 비해, 또는 F가 수식되지 않은 X에 비해 증가된 것일 수 있으며, 이러한 결합체는 상술한 형태뿐만 아니라, 생분해성 나노파티클에 봉입된 형태 등을 모두 포함하나 이에 제한되지 않는다.
상기 화학식 1에서 상기 L은 비펩타이드성 링커, 예를 들어 에틸렌글리콜 반복 단위를 함유하는 링커일 수 있다.
본 발명에서 "비펩타이드성 링커"는 반복 단위가 2개 이상 결합된 생체 적합성 중합체를 포함한다. 상기 반복 단위들은 펩타이드 결합이 아닌 임의의 공유결합을 통해 서로 연결된다. 상기 비펩타이드성 링커는 본 발명의 결합체의 모이어티를 이루는 일 구성일 수 있으며, 상기 화학식 1에서 L에 해당된다.
본 발명에서 사용될 수 있는 비펩타이드성 링커는 생체 내 단백질 분해 효소에 저항성 있는 중합체이면 제한 없이 사용될 수 있다. 본 발명에서 상기 비펩타이드성 링커는 비펩타이드성 중합체와 혼용되어 사용될 수 있다.
특별히 이에 제한되지 않으나, 상기 비펩타이드성 링커는 에틸렌글리콜 반복 단위를 함유하는 링커, 예를 들어, 폴리에틸렌글리콜일 수 있고, 또한, 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.
상기 비펩타이드성 링커의 반복 단위는 에틸렌글리콜 반복 단위일 수 있고, 구체적으로, 상기 비펩타이드성 링커는 에틸렌글리콜 반복 단위를 포함하면서, 결합체의 제조에 이용되는 작용기를 말단에 포함하는 것일 수 있다. 본 발명에 따른 지속형 결합체는 상기 작용기를 통해 X와 F가 연결된 형태일 수 있으나 이에 제한되지 않는다. 본 발명에서, 상기 비펩타이드성 링커는 2개, 또는 3개 이상의 작용기를 포함할 수 있고, 각 작용기는 동일하거나, 서로 상이할 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 링커는 하기 화학식 2로 표시되는 폴리에틸렌글리콜(PEG)일 수 있으나, 이에 제한되는 것은 아니다:
[화학식 2]
여기서, n= 10 내지 2400, n= 10 내지 480, 또는 n = 50 내지 250이나, 이에 제한되지 않는다.
상기 지속형 결합체에서 PEG 모이어티는, -(CH2CH2O)n-구조 뿐만 아니라 연결 요소와 이 -(CH2CH2O)n- 사이에 개재하는 산소 원자도 포함할 수 있으나, 이에 제한되는 것은 아니다.
또한, 하나의 구체적인 실시 형태에서 상기 결합체는 GLP-2 또는 GLP-2 유도체와 면역글로불린 Fc 영역(F)이 에틸렌글리콜 반복 단위를 함유하는 링커를 통해 공유 결합으로 연결된 구조 일 수 있으나, 이에 제한되는 것은 아니다.
상기 폴리에틸렌글리콜은, 에틸렌 글리콜 동종 중합체, PEG 공중합체, 또는 모노메틸-치환된 PEG 중합체(mPEG)의 형태를 모두 포괄하는 용어이나, 특별히 이에 제한되는 것은 아니다.
본 발명에서 사용될 수 있는 비펩타이드성 링커는 생체 내 단백질분해효소에 저항성 있는 중합체이면 제한 없이 사용될 수 있으나, 구체적으로 비펩타이드성 중합체의 분자량은 0 초과 200 kDa 범위, 구체적으로, 약 1 내지 100 kDa 범위, 보다 구체적으로, 약 1 내지 50 kDa 범위, 보다 더 구체적으로, 약 1 내지 20kDa 범위, 보다 더 구체적으로 약 3.4kDa 내지 10 kDa, 범위, 보다 더 구체적으로 약 3.4kDa일 수 있으나, 이에 제한되지 않는다.
본 발명에서 용어, "약"은 ±0.5, ±0.4, ±0.3, ±0.2, ±0.1 등을 모두 포함하는 범위로, 약 이란 용어 뒤에 나오는 수치와 동등하거나 유사한 범위의 수치를 모두 포함하나, 이에 제한되지 않는다.
또한, 면역글로불린 Fc 영역과 결합되는 본 발명의 비펩타이드성 링커는 한 종류의 중합체뿐만 아니라 상이한 종류의 중합체들의 조합이 사용될 수도 있다.
하나의 구체적인 실시 형태에서 상기 비펩타이드성 링커의 양 말단은 면역글로불린 Fc 영역의 티올기, 아미노기, 하이드록실기 및 GLP-2의 티올기, 아미노기, 아지드기, 하이드록실기에 결합할 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 비펩타이드성 링커는 양쪽 말단에 각각 면역글로불린 Fc 및 GLP-2 또는 이의 유도체와 결합될 수 있는 반응기, 구체적으로는 면역글로불린 Fc 영역의 시스테인의 티올기; N-말단, 라이신, 아르지닌, 글루타민 및/또는 히스티딘에 위치한 아미노기; 및/또는 C-말단에 위치한 하이드록실기와 결합되고, GLP-2의 시스테인의 티올기; 라이신, 아르지닌, 글루타민 및/또는 히스티딘의 아미노기; 아지도라이신의 아지드기; 및/또는 하이드록실기와 결합될 수 있는 반응기를 포함할 수 있으나, 이에 제한되지 않는다.
보다 구체적으로, 상기 비펩타이드성 중합체의 반응기는 알데히드 그룹, 말레이미드 그룹 및 석시니미드 유도체로 이루어진 군으로부터 선택되는 하나 이상일 수 있으나, 이에 제한되지 않는다.
상기에서, 알데히드 그룹으로 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 예로서 들 수 있으나, 이에 제한되지 않는다.
상기에서, 석시니미드 유도체로는 석시니미딜 카르복시메틸, 석시니미딜 발레르에이트, 석시니미딜 메틸부타노에이트, 석시니미딜 메틸프로피온에이트, 석시니미딜 부타노에이트, 석시니미딜 프로피온에이트, N-하이드록시석시니미드, 히드록시 석시니미딜 또는 석시니미딜 카보네이트가 이용될 수 있으나, 이에 제한되지 않는다.
상기 비펩타이드성 링커는 상기와 같은 반응기를 통해 면역글로불린 Fc 및 GLP-2 유도체에 연결되어, 비펩타이드성 중합체 연결부로 전환될 수 있다.
또한, 알데히드 결합에 의한 환원성 알킬화로 생성된 최종 산물은 아미드 결합으로 연결된 것보다 훨씬 안정적이다. 알데히드 반응기는 낮은 pH에서 N-말단에 선택적으로 반응하며, 높은 pH, 예를 들어 pH 9.0 조건에서는 라이신 잔기와 공유결합을 형성할 수 있다.
본 발명의 비펩타이드성 링커의 말단 반응기는 서로 같거나 다를 수 있다. 상기 비펩타이드성 링커는 말단에 알데히드 그룹 반응기를 갖는 것일 수 있고, 또한 상기 비펩타이드성 링커는 말단에 각각 알데히드 그룹 및 말레이미드 반응기를 가질 수 있거나, 말단에 각각 알데히드 그룹 및 석시니미드 반응기를 가질 수 있으나, 이에 제한되지 않는다.
예를 들어, 한쪽 말단에는 말레이미드 그룹을, 다른 쪽 말단에는 알데히드 그룹, 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 가질 수 있다. 또 한 가지 예로, 한쪽 말단에는 석시니미딜 그룹을, 다른 쪽 말단에는 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 가질 수 있다.
프로피온쪽 말단에 하이드록시 반응기를 갖는 폴리에틸렌글리콜을 비펩타이드성 링커로 이용하는 경우에는, 공지의 화학반응에 의해 상기 하이드록시기를 상기 다양한 반응기로 활성화하거나, 상업적으로 입수가능한 변형된 반응기를 갖는 폴리에틸렌글리콜을 이용하여 본 발명의 결합체를 제조할 수 있다.
하나의 구체적인 실시 형태에서 상기 비펩타이드성 링커의 반응기가 GLP-2 또는 GLP-2 유도체의 시스테인 잔기, 보다 구체적으로 시스테인의 -SH 기에 연결되는 것일 수 있으나, 이에 제한되지 않는다.
만약, 말레이미드-PEG-알데히드를 사용하는 경우, 말레이미드기는 GLP-2 또는 GLP-2 유도체의 -SH 기와 티오에테르(thioether) 결합으로 연결하고, 알데히드기는 면역글로불린 Fc의 -NH2 기와 환원적 알킬화 반응을 통해 연결할 수 있으나, 이에 제한되지 않으며, 이는 하나의 일례에 해당한다.
이와 같은 환원적 알킬화를 통하여 PEG의 한쪽 말단에 위치한 산소 원자에 면역글로불린 Fc 영역의 N-말단 아미노기가 -CH2CH2CH2-의 구조를 가지는 링커 작용기를 통해 서로 연결되어, -PEG-O-CH2CH2CH2NH-면역글로불린 Fc와 같은 구조를 형성할 수 있고, 티오에테르 결합을 통하여 PEG의 한쪽 말단이 GLP-2 또는 GLP-2 유도체의 시스테인에 위치한 황 원자에 연결된 구조를 형성할 수 있다. 상술한 티오에테르 결합은
의 구조를 포함할 수 있다.
그러나, 상술한 예에 특별히 제한되는 것은 아니며, 이는 하나의 일례에 해당한다.
또한, 상기 결합체에서, 비펩타이드성 링커의 반응기가 면역글로불린 Fc 영역의 N-말단에 위치한 -NH2와 연결된 것일 수 있으나, 이는 하나의 일례에 해당한다.
또한, 상기 결합체에서, GLP-2 또는 GLP-2 유도체는 반응기를 갖는 비펩타이드성 링커와 C-말단을 통해 연결될 수 있으나, 이는 하나의 일례에 해당한다.
본 발명에서 "C-말단"은, 펩타이드의 카르복시 말단을 의미하는 것으로, 본 발명의 목적상 비펩타이드성 중합체와 결합할 수 있는 위치를 말한다. 그 예로, 이에 제한되지는 않으나, C-말단의 최말단 아미노산 잔기뿐만 아니라 C-말단 주위의 아미노산 잔기를 모두 포함할 수 있으며, 구체적으로는 최말단으로부터 첫 번째 내지 20 번째의 아미노산 잔기를 포함할 수 있다.
한편, 본 발명에 따른 GLP-2 또는 GLP-2 유도체를 포함하는 지속형 결합체는 펩타이드 그 자체, 이의 염 (예컨대, 상기 펩타이드의 약학적으로 허용가능한 염), 또는 이의 용매화물의 형태를 모두 포함한다.
또한, 지속형 결합체는 약학적으로 허용되는 임의의 형태일 수 있다.
본 발명의 GLP-2 또는 GLP-2 유도체; 또는 이를 포함하는 지속형 결합체; 또는 이를 포함하는 조성물은 골 대사성 질환의 예방 또는 치료 용도를 가질 수 있다.
구체적으로, 본 발명의 조성물은 골 대사성 질환의 예방 또는 치료에 사용될 수 있으며 특히, 조골세포 및 파골세포의 불균형으로 인해 유발되는 골 대사성 질환의 예방 또는 치료에 제한 없이 사용될 수 있다. 이러한 질환의 예로는 골다공증(Osteoporosis), 골감소증(Osteopenia), 관절염 (Arthritis), 치주질환(Periodontal disease), 골 형성 부전증(Osteopsathyrosis), 골연화증(Osteomalacia)등을 들 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 따른 GLP-2 또는 이의 유도체; 및 이를 포함하는 지속형 결합체는 뼈의 형성 촉진 및/또는 파골세포에 의한 뼈 분해 억제 효과를 가지므로, 골 대사성 질환의 효과적인 치료제로 사용될 수 있다.
구체적으로, 본 발명의 조성물은 투여시 투여 시 하기 특성 중 하나 이상을 나타낼 수 있으나, 이에 제한되지 않는다:
(i) 오스테오칼신(Osteocalcin/Bone Gla Protein, OC/BGP)의 혈중 농도 증가;
(ii) 오스테오프로테제린(Osteoprotegerin, OPG)의 혈중 농도 감소; 및
(iii) 제 1형 콜라겐 C-텔로펩타이드(C-telopeptide of collagen type 1 (CTX-1)) 혈중 농도 감소.
상기 OC/BGP 수치는 뼈 형성을 나타내는 수치이므로, 이의 혈중 농도 증가는 본 발명에 따른 지속형 결합체에 의한 뼈의 형성 촉진 효과를 의미하며, 상기 OPG 및 CTX-1는 파골세포 분화 억제 및 파골세포 활동을 보여주는 지표에 해당하므로, 이의 혈중 농도 감소는 본 발명에 따른 지속형 결합체에 의한 뼈의 분해 억제 효과를 의미한다. 따라서, 상기와 같은 특성을 바탕으로 본 발명의 조성물은 유도체는 뼈의 형성을 촉진하고/하거나, 뼈의 분해를 억제함으로써 골 대사성 질환의 예방 또는 치료 효과를 나타낼 수 있다.
본 발명에서 용어, "골다공증(osteoporosis)"은 골 조직의 석회가 감소되어 뼈의 치밀질이 엷어지고 그로 인해 골수강(骨髓腔)이 넓어지는 상태로, 증세가 진전됨에 따라 뼈가 약해지기 때문에 작은 충격에도 골절되기 쉽다. 골량은 유전적 요인, 영양 섭취, 호르몬의 변화, 운동 및 생활 습관의 차이 등 여러 가지 요인들에 의해 영향을 받으며, 골다공증의 원인으로는 노령, 운동 부족, 저체중, 흡연, 저칼슘 식이, 폐경, 난소절제 등이 알려져 있다. 한편, 개인차는 있지만 백인보다는 흑인이 골 재흡수 수준(bone resorption level)이 낮아 골량이 더 높으며, 대개 골량은 14 ~ 18세에 가장 높고 노후에는 1년에 약 1%씩 감소한다. 특히, 여성의 경우 30세 이후부터 골 감소가 지속적으로 진행되며, 폐경기에 이르면 호르몬 변화에 의해 골 감소가 급격히 진행된다. 즉, 폐경기에 이르면 에스트로젠 농도가 급속히 감소하는데, 이때, IL-7(interleukin-7)에 의한 것처럼 B-임파구(B-lymphocyte)가 다량 생성되어 골수(bone marrow)에 B 세포 전구체(pre-B cell)가 축적되고, 이로 인해 IL-6의 양이 증가하여 파골세포의 활성을 증가시키므로 결국 골량이 감소할 수 있다. 또한, 단장증후군(Short bowel syndrome) 환자에서는 영양분을 충분히 공급받지 못하기 때문에 골 밀도 감소로 인한 골다공증 (Osteoporosis), 골감소증 (Osteopenia), 골연화증 (Osteomalacia) 등의 합병증이 동반된다.
상기 골다공증의 보다 구체적인 종류로서 원발성 제1형 골다공증, 원발성 제2형 골다공증, 속발성 골다공증, 골연화증-유사 골다공증, 또는 폐경 또는 난소 절제로 인한 골다공증, 단장증후군(Short bowel syndrome)으로 인한 골다공증을 들 수 있으나, 특별히 이에 한정되는 것은 아니다.
본 발명에서 용어, "골감소증(osteopenia)"은 뼈가 약화되거나 뼈의 미네랄 밀도 (BDM)이 정상에 비하여 떨어지는 상태를 말한다.
본 발명에서 용어, "관절염"은 관절 내에 염증성 변화가 생긴 질환으로서, 골관절염, 및 류마티스 관절염 등을 들 수 있다.
본 발명에서 용어, "치주질환"은 세균에 의해 야기되는 치아지지 조직의 염증 상태를 말하며, 치은염 및 치주염으로 분리할 수 있다. 발병원인은 불량한 구강 위생 상태로 인한 구강 세균이 치면 세균막을 형성하는데 있다. 치면 세균막은 그냥 방치해 두면, 염증이 생겨 가끔 잇몸에서 피가 나고, 구취가 나는 경우가 있으며 이러한 증상을 치은염이라 하고, 치은염이 더 진행되면 치주염이 발생 된다. 치주염이 진행되면 칫솔질과 같은 약한 자극에도 잇몸에서 피가 나기도 하며 붓고, 종종 급성염증으로 변화되어 통증을 유발한다. 이러한 염증은 골을 만드는 기능은 저하시키고, 골을 흡수하는 작용이 높아져서 치조골이 점점 낮아지게 되어 치조골이 파괴되고 결국 치아를 상실하게 된다. 따라서, 본 발명에 따른 조성물은 치주질환, 특히 치주질환으로 인한 치조골 소실에 유용하게 사용할 수 있다.
본 발명에서 용어, "골 형성 부전증"은 불완전 골형성증으로 불리우는 질환으로서, 골의 강도가 약해서 특별한 이유 없이 쉽게 골절되는 질환을 말한다.
본 발명에서 용어, “골연화증(osteomalacia)”은 무릎 부위에 일시적으로 부종과 통증이 나타난다. 원인은 비타민D 결핍과 칼슘 및 인산염 대사장애이며 위장에서의 영양소 흡수 불량, 완화제의장기간 사용, 태양광선의 노출 부족, 임신 등에 의해 발생한다. 뼈에서 석회화가 안 된 골상조직의 과잉 형성으로, 뼈가 물러져서 운동장애를 일으키며 뼈의 미네랄 밀도 (BMD)가 정상에 비하여 떨어지는 상태를 말한다.
본 발명에서 용어 "예방"은 상기 GLP-2 또는 이의 유도체; 또는 이를 포함하는 조성물의 투여로 골 대사성 질환의 발병을 억제 또는 지연시키는 모든 행위를 의미하며, "치료"는 상기 GLP-2 또는 GLP-2의 지속형 결합체 또는 이를 포함하는 조성물의 투여로 골 대사성 질환의 증세가 호전되거나 이롭게 되는 모든 행위를 의미한다. 본 발명에서 용어, "골 대사성 질환의 예방 또는 치료"란 골 대사성 질환의 예방 및 완전한 또는 부분적인 치료를 포함한다. 이는 또한 골 대사성 질환 증상의 감소, 개선, 그 증상의 고통 경감, 골 대사성 질환 발생율 감소 또는 치료결과를 증가시키는 환자의 어떠한 다른 변화를 포함한다.
본 발명의 GLP-2 또는 이의 유도체; 또는 이를 포함하는 지속형 결합체는 뼈의 형성을 촉진하고/하거나 뼈의 분해를 억제하여 골량 감소를 억제함으로써 골량과 골 밀도를 유지할 수 있으므로, 골 대사성 질환에 대한 예방 또는 치료 효과를 나타낼 수 있다.
본 발명에서 용어 "투여"는 어떠한 적절한 방법으로 환자에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 특별히 이에 제한되지 않으나, 상기 조성물이 생체 내 표적에 도달할 수 있는 어떠한 일반적인 경로를 통하여 투여될 수 있으며, 예를 들어 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피 내 투여, 경구 투여, 국소 투여, 비 내 투여, 폐 내 투여, 또는 직장 내 투여 등이 될 수 있다.
본 발명의 약학적 조성물은 약학적으로 허용가능한 담체, 부형제 또는 희석제를 추가로 포함할 수 있다. 이러한 약학적으로 허용가능한 담체, 부형제, 또는 희석제는 비자연적으로 발생된 것일 수 있다.
본 발명에서 용어 "약학적으로 허용가능한"이란 치료효과를 나타낼 수 있을 정도의 충분한 양과 부작용을 일으키지 않는 것을 의미하며, 질환의 종류, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 투여 경로, 투여 방법, 투여횟수, 치료 기간, 배합 또는 동시 사용되는 약물 등 의학 분야에 잘 알려진 요소에 따라 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 GLP-2 또는 그 지속형 결합체를 포함한 약학적 조성물은 약학적으로 허용가능한 담체를 추가로 포함할 수 있다. 상기 담체는 특별히 이에 제한되지는 않으나, 경구 투여 시에는 결합제, 활택제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장화제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.
본 발명의 조성물의 제형은 상술한 바와 같은 약학적으로 허용가능한 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여 시에는 정제, 트로키, 캡슐, 엘릭서, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 환약, 캡슐, 서방형 제제 등으로 제형화할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로스, 메틸 셀룰로스, 미정질 셀룰로스, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 방부제 등을 추가로 포함할 수 있다.
또한, 본 발명의 약학적 조성물은 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
또한, 상기 조성물은 약학적 분야에서 통상의 방법에 따라 환자의 신체 내 투여에 적합한 단위 투여형의 제제, 구체적으로는 단백질 의약품의 투여에 유용한 제제 형태로 제형화시켜 당업계에서 통상적으로 사용하는 투여 방법을 이용하여 경구, 또는 피부, 정맥 내, 근육 내, 동맥 내, 골수 내, 수막강 내, 심실 내, 폐, 경피, 피하, 복 내, 비강 내, 소화관 내, 국소, 설하, 질 내 또는 직장 경로를 포함하는 비경구 투여 경로에 의하여 투여될 수 있으나, 이들에 한정되는 것은 아니다.
또한, 상기 결합체는 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 탄수화물, 아스코르브산(ascorbic acid) 또는 글루타티온과 같은 항산화제(antioxidants), 킬레이트제, 저분자 단백질 또는 다른 안정화제(stabilizers) 등이 약제로 사용될 수 있다.
본 발명의 약학적 조성물의 투여량과 횟수는 치료할 질환, 투여 경로, 환자의 연령, 성별 및 체중 및 질환의 중등도 등의 여러 관련 인자와 함께, 활성성분인 약물의 종류에 따라 결정된다.
본 발명의 조성물의 총 유효량은 단일 투여(single dose)로 환자에게 투여될 수도 있으며, 다중 투여(multiple dose)로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수도 있다. 본 발명의 약학적 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 구체적으로, 본 발명의 GLP-2 또는 이의 지속형 결합체의 바람직한 전체 용량은 하루에 환자 체중 1 kg당 약 0.0001 mg 내지 500 mg일 수 있다.
그러나 상기 GLP-2 또는 이의 지속형 결합체의 용량은 약학적 조성물의 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당분야의 통상적인 지식을 가진 자라면 상기 본 발명의 조성물의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
본 발명에서, GLP-2 또는 GLP-2 유도체; 또는 이를 포함하는 지속형 결합체가 약학적 조성물에 약리학적 유효량으로 포함된다는 것은, GLP-2 또는 GLP-2 유도체; 또는 이를 포함하는 지속형 결합체로 인한 목적하는 약리 활성(예를 들어, 골 대사성 질환의 예방, 개선 또는 치료)을 얻을 수 있는 정도를 의미하고, 또한 투여되는 개체에서 독성 또는 부작용이 일어나지 않거나 미미한 수준으로서 약학적으로 허용되는 수준을 의미할 수 있으나, 이에 제한되지 않는다. 이와 같은 약학적 유효량은 투여 횟수, 환자, 제형 등을 종합적으로 고려하여 결정될 수 있다.
또한, 본 발명의 약학적 조성물은 생체 내 지속성 및 역가가 우수하여, 본 발명의 약학적 제제의 투여 횟수 및 빈도를 현저하게 감소시킬 수 있다.
구체적으로, 본 발명의 약학적 조성물은 1주에 한 번, 2주에 한 번, 4주에 한 번, 또는 한 달에 한 번 투여하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명을 구현하는 다른 하나의 양태는 GLP-2 또는 그 지속형 결합체를 포함하는, 골 대사성 질환의 예방 또는 개선을 위한 식품 조성물을 제공한다.
상기 GLP-2 또는 그 지속형 결합체, 골 대사성 질환 등에 대해서는 앞서 설명한 바와 같다.
상기 식품조성물은 건강기능식품으로 사용될 수 있다. 본 발명의 조성물을 식품 보조첨가제로 사용할 경우, GLP-2 또는 GLP-2 유도체; 또는 이를 포함하는 지속형 결합체를 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효 성분의 혼합량은 사용목적(예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다.
본 발명에서의 용어 "건강기능식품"이란, 건강보조의 목적으로 특정성분을 원료로 하거나 식품 원료에 들어있는 특정성분을 추출, 농축, 정제, 혼합 등의 방법으로 제조, 가공한 식품을 말하며, 상기 성분에 의해 생체방어, 생체리듬의 조절, 질병의 방지와 회복 등 생체조절기능을 생체에 대하여 충분히 발휘할 수 있도록 설계되고 가공된 식품을 말하는 것으로서, 상기 건강식품용 조성물은 질병의 예방 및 질병의 회복 등과 관련된 기능을 수행할 수 있다.
본 발명을 구현하기 위한 다른 하나의 양태는 상기 GLP-2 또는 그 지속형 결합체를 포함하는 조성물을 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 골 대사성 질환의 예방 또는 치료 방법을 제공한다.
상기 GLP-2 또는 그 지속형 결합체, 골 대사성 질환 등에 대해서는 앞서 설명한 바와 같다.
본 발명에서 상기 개체는 골 대사성 질환이 의심되는 개체로서, 상기 골 대사성 질환 의심 개체는 골 대사성 질환이 발병하였거나 발병할 수 있는 인간을 포함한 쥐, 가축 등을 포함하는 포유 동물을 의미하나, 본 발명의 결합체 혹은 이를 포함하는 상기 조성물로 치료 가능한 개체는 제한 없이 포함된다. 구체적인 예로, 골 형성 촉진 및/또는 골 분해 억제가 이로운 개체라면 제한 없이 포함된다.
본 발명의 방법은 상기 GLP-2 또는 그 지속형 결합체를 포함하는 약학적 조성물을 약학적 유효량으로 투여하는 것을 포함할 수 있다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있으며, 1회 또는 수회로 나누어 투여할 수 있다. 그러나 본 발명의 목적상, 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다.
구체적으로, 본 발명의 GLP-2 또는 이의 지속형 결합체의 바람직한 전체 용량은 하루에 환자 체중 1 kg당 약 0.0001 mg 내지 500 mg일 수 있으며, 1주에 한 번, 2주에 한 번, 4주에 한 번, 또는 한 달에 한 번 투여되는 것일 수 있으나, 이에 제한되지 않는다.
본 발명을 구현하기 위한 다른 하나의 양태는 골 대사성 질환의 예방 또는 치료를 위한 상기 GLP-2 또는 그 지속형 결합체 또는 이를 포함하는 조성물의 용도를 제공한다.
상기 GLP-2 또는 그 지속형 결합체, 골 대사성 질환 등에 대해서는 앞서 설명한 바와 같다.
본 발명을 구현하기 위한 다른 하나의 양태는 골 대사성 질환의 예방 또는 치료를 위한 약제의 제조에 있어서 상기 GLP-2 또는 그 지속형 결합체 또는 이를 포함하는 조성물의 용도를 제공한다.
상기 GLP-2 또는 그 지속형 결합체, 골 대사성 질환 등에 대해서는 앞서 설명한 바와 같다.
이하, 하기 실시예에 의하여 본 발명을 보다 상세하게 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐 본 발명의 범위가 이들로 한정되는 것은 아니다.
실시예 1: GLP-2 유도체 지속형 결합체의 제조
표 1의 서열번호 4의 GLP-2 유도체 CA GLP-2 RK를 개질 폴리에틸렌글리콜인 ALD(2) PEG(양 말단의 수소가 각각 프로피온알데히드기(3-옥소프로필기)로 치환되고, 에틸렌글리콜 반복단위 부위(moiety)의 화학식량이 3.4 kDa인 개질 폴리에틸렌글리콜, 일본 NOF사)로 페길화시키기 위하여 GLP-2 유도체와 ALD(2) PEG의 몰 비를 1: 5~ 1:20, GLP-2 유도체 농도를 5~10 mg/ml로 하여 2~8℃에서 4~16시간 반응시켰다. 이 때 반응은 20 mM 헤페스(HEPES) pH 7.5와 에탄올에서 이루어졌으며 환원제인 20 mM 소디움 시아노보로하이드라이드[sodium cyanoborohydride(NaCNBH3)]를 첨가하여 반응시켰다. 반응액은 구연산나트륨 pH 2.0, 에탄올이 포함된 완충 용액과 염화칼륨 농도 구배를 이용한 Source 15S(GE, 미국) 컬럼을 사용하여 모노페길화된 GLP-2 유도체를 정제하였다.
다음으로, 상기 정제된 모노페길화된 GLP-2 유도체와 서열번호 31의 면역글로불린 Fc 단편의 몰 비가 1:2~1:6가 되도록 하고, 전체 단백질 농도를 30~35 mg/mL로 하여 2~8℃에서 12~20시간 반응시켰다. 이때 반응액은 100 mM 인산칼륨 완충액(pH 6.0)과 아이소프로판올에 환원제로서 20 mM 소디움 시아노보로하이드라이드를 첨가하였다.
반응이 종결된 후 반응액은 비스-트리스(bis-Tris) pH 6.5 버퍼와 염화나트륨 농도 구배를 이용하여 Source 15Q(GE, 미국) 컬럼에 적용하고, 황산 암모늄과 구연산 나트륨 pH 5.0~5.2의 농도 구배를 이용하여 Source 15 ISO(GE, 미국)에 적용하여, 면역글로불린 Fc 단편에 GLP-2 유도체가 폴리에틸렌글리콜 링커에 의해 공유결합으로 연결된 결합체인 GLP-2 유도체의 지속형 결합체를 정제하였다.
실시예 2: GLP-2 유도체 지속형 결합체 투여에 따른 골다공증 모델 마우스에서의 혈중 오스테오칼신, 오스테오프로테제린 및 제1형 콜라겐의 C-말단 텔로펩타이드 수치 변화 확인
상기 실시예 1에서 제조된 GLP-2 유도체 지속형 결합체 투여에 따른 인 비보(in vivo) 뼈 보호 효력을 측정하기 위하여 골다공증 모델인 난소 적출 마우스(ovariectomized mice, OVX mice, Dae Han Bio Link Co., Ltd.)를 이용하였다.
구체적으로, 오스테오칼신(OC/BGP)는 뼈의 기본 미네랄 성분인 수산화인회석에 친화적으로 결합이 가능한 카복실화된 오스테오칼신을 의미하며, 뼈 형성 표지자로서 혈중에 많이 존재할 경우 뼈의 합성이 많이 일어나고 있음을 의미한다. 오스테오프로테제린(OPG)는 파골 세포 분화 억제 표지자로서, 파골 세포 분화에 중요한 역할을 하는 RANKL(Receptor activator of nuclear factor kappa-Β ligand) 과 경쟁적으로 파골 세포 전구 수용체에 결합하여, 파골 세포의 분화를 저해하기 때문에 혈중에 높게 존재할 경우 뼈 분해를 억제하고 있음을 의미한다. 제1형 콜라겐의 C-말단 텔로펩타이드(CTX-1)는 뼈 재 흡수 동안 파골 세포에 의해 절단되어 생기는 특정 펩타이드 서열이기 때문에 파골 세포 활동에 비례한다.
이에, GLP-2 유도체 지속형 결합체 투여에 따른 상기 혈중 오스테오칼신(OC/BGP), 오스테오프로테제린(OPG), 및 제1형 콜라겐의 C-말단 텔로펩타이드 (CTX-1)의 수치 변화를 확인함으로써, 뼈의 형성 및 뼈 분해에 미치는 본 발명의 GLP-2 유도체 지속형 결합체의 효과를 확인하고자 하였다.
먼저, 7주령의 암컷 마우스(C57BL/6J mouse)의 난소를 제거하고, 1 주간의 회복기를 거친 후 군 분리를 실시하여 각군 10 마리씩 정상 대조군(난소 적출하지 않고 피부 절개 및 봉합만을 진행, G1, Sham Vehicle), 난소 적출 대조군(G2, OVX vehicle), 난소 적출 후 테두글루타이드(56 μg/kg/BID)를 투여한 군(G3, OVX Teduglutide), 난소 적출 후 GLP-2 유도체 지속형 결합체(6237 μg/kg/QW)를 투여한 군(G4, OVX GLP-2)으로 나누었다(본 명세서에서 GLP-2 유도체 지속형 결합체의 투여량으로 나타낸 주당 6237 μg/kg이란 수치에서 6237 μg이란 사용된 GLP-2 유도체 지속형 결합체의 전체 질량에서 폴리에틸렌글리콜 링커 부위를 제외한 수치, 즉 폴리펩타이드 부위들만의 질량을 합산한 값을 기준으로 표시한 수치이다). 각 군에 비히클(vehicle), 테두글루타이드 또는 GLP-2 유도체 지속형 결합체를 피하로 10주간 투여한 후 각 군에 대하여 혈중 오스테오칼신(OC/BGP) 수치, 오스테오프로테제린(OPG) 수치 및 제 1형 콜라겐 C-텔로펩타이드(CTX-1) 수치를 측정하였다.
시험 결과 난소 적출 대조군(OVX vehicle) 및 테두글루타이드(56 μg/kg/BID) 투여군에 비해 GLP-2 유도체 지속형 결합체(6237 μg/kg/QW)를 투여한 군 에서 유의적으로 혈중 오스테오칼신(OC/BGP) 수치가 증가하는 것을 확인하였으며(도 1의 (A)), GLP-2 유도체 지속형 결합체(6237 μg/kg/QW)를 투여한 군에서 혈중 오스테오프로테제린(OPG) 수치는 난소 적출 대조군(OVX vehicle) 과 비교하여 증가하는 경향을 보였으며, 테두글루타이드(56 μg/kg/BID) 투여 군보다 유의적으로 증가한 것을 확인하였다(도 1의 (B)). 또한 GLP-2 유도체 지속형 결합체(6237 μg/kg/QW)를 투여한 군에서 혈중 C-말단 텔로펩타이드 (CTX-1) 수치는 난소 적출 대조군(OVX vehicle)과 비교하여 감소하는 경향을 보였으며, 테두글루타이드 (56 μg/kg/BID) 투여군보다 유의적으로 감소한 것을 확인하였다(도 1의 (C)).
이와 같은 결과는 본 발명의 GLP-2 유도체 지속형 결합체를 투여하면 뼈 분해 감소와 뼈 형성 증가의 기전을 통해 골 대사성 질환의 예방 또는 치료적 효력를 나타낼 수 있음을 시사한다.
이상의 설명으로부터, 본 발명이 속하는 기술 분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.
Claims (18)
- 골 대사성 질환의 예방 또는 치료를 위한 약학적 조성물로서,약학적으로 허용되는 부형제; 와글루카곤 유사 펩타이드-2(Glucagon-like peptide-2, GLP-2)를 약학적 유효량으로 포함하는 약학적 조성물.
- 제1항에 있어서, 상기 GLP-2는 천연형 GLP-2 또는 GLP-2 유도체인 것인 조성물.
- 제2항에 있어서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 34번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것인 조성물.
- 제2항에 있어서, 상기 GLP-2 유도체는 하기 일반식 1로 표시되는 아미노산 서열을 포함하는 것인 조성물:[일반식 1]X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)여기서,X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;X30은 라이신 또는 아르지닌이고;X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신 또는 시스테인임.
- 제4항에 있어서, 상기 GLP-2 유도체는(1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,(2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,(3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,(4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,(5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,(6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는(7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인인 조성물.
- 제2항에 있어서, 상기 GLP-2 유도체는 하기 일반식 2로 표시되는 아미노산 서열을 포함하는 것인 조성물:[일반식 2]X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)여기서,X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;X30은 라이신 또는 아르지닌이고;X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산임.
- 제2항에 있어서, 상기 GLP-2 유도체는 서열번호 2 내지 8로 이루어진 군으로부터 선택된 아미노산 서열인 조성물.
- 제1항 또는 제2항에 있어서, 상기 골 대사성 질환은 골다공증(Osteoporosis), 골감소증(Osteopenia), 관절염 (Arthritis), 치주질환(Periodontal disease), 골 형성 부전증(Osteopsathyrosis), 또는 골연화증(Osteomalacia)인 조성물.
- 제1항 또는 제2항에 있어서, 상기 조성물은 뼈의 형성을 촉진하거나; 뼈의 분해를 억제하거나; 또는 뼈의 형성을 촉진하고 뼈의 분해를 억제하는 것인 조성물.
- 제9항에 있어서, 상기 골 대사성 질환은 골다공증인 조성물.
- 제10항에 있어서, 상기 조성물은 투여시 투여 시 하기 특성 중 하나 이상을 갖는 것인 조성물:(i) 오스테오칼신(Osteocalcin/Bone Gla Protein, OC/BGP)의 혈중 농도 증가;(ii) 오스테오프로테제린(Osteoprotegerin, OPG)의 혈중 농도 감소; 및(iii) 제 1형 콜라겐 C-텔로펩타이드(C-telopeptide of collagen type 1 (CTX-1)의 혈중 농도 감소.
- 제1항 또는 제2항에 있어서, 상기 GLP-2는 이의 C-말단이 변형되지 않았거나 아미드화된 조성물.
- 제1항 또는 제2항에 있어서, 상기 GLP-2는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태인 조성물.
- 제13항에 있어서, 상기 결합체는 하기 화학식 1로 표시되는 조성물:[화학식 1]X - La - F여기서,X는 GLP-2(천연형 GLP-2 또는 GLP-2 유도체)이고;L은, 에틸렌글리콜 반복 단위를 함유하는 링커이며;a는, 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;F는, 면역글로불린 Fc 영역이며;상기 "-"는 공유결합임.
- 제14항에 있어서, 상기 면역글로불린 Fc 영역은 비당쇄화된 IgG4 Fc 영역인 것인 조성물.
- 제14항에 있어서, 상기 F는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 조성물.
- 제14항에 있어서, 상기 L은 폴리에틸렌글리콜인 조성물.
- 제14항에 있어서, 상기 L 내의 에틸렌글리콜 반복 단위 부위의 화학식량은 1 내지 100 kDa 범위에 있는 조성물.
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202080095573.0A CN115052619A (zh) | 2019-12-24 | 2020-12-24 | 包含glp-2或其缀合物的用于预防或治疗代谢性骨病的药物组合物 |
JP2022539188A JP2023508175A (ja) | 2019-12-24 | 2020-12-24 | Glp-2又はその結合体を含む、代謝性骨疾患の予防又は治療用薬学的組成物 |
EP20904974.1A EP4082561A4 (en) | 2019-12-24 | 2020-12-24 | PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING METABOLIC BONE DISEASES, CONTAINING GLP-2 OR A CONJUGATE THEREOF |
US17/788,488 US20220362347A1 (en) | 2019-12-24 | 2020-12-24 | Pharmaceutical composition for preventing or treating metabolic bone diseases, comprising glp-2 or conjugate thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2019-0174117 | 2019-12-24 | ||
KR20190174117 | 2019-12-24 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021133087A1 true WO2021133087A1 (ko) | 2021-07-01 |
Family
ID=76576006
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2020/019069 WO2021133087A1 (ko) | 2019-12-24 | 2020-12-24 | Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물 |
Country Status (6)
Country | Link |
---|---|
US (1) | US20220362347A1 (ko) |
EP (1) | EP4082561A4 (ko) |
JP (1) | JP2023508175A (ko) |
KR (1) | KR20210082120A (ko) |
CN (1) | CN115052619A (ko) |
WO (1) | WO2021133087A1 (ko) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20230154336A (ko) | 2022-04-29 | 2023-11-08 | 경북대학교 산학협력단 | 글라이신 유도체를 유효성분으로 포함하는 골 재생 또는 골 형성 촉진용 약학 조성물 |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US20070135345A1 (en) * | 2000-09-18 | 2007-06-14 | Henriksen Dennis B | Use of GLP-2 for the treatment or prevention, of bone-related disorders |
KR20130078634A (ko) * | 2011-12-30 | 2013-07-10 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 위치 특이적 글루카곤 유사 펩타이드-2 약물 결합체 |
KR101964376B1 (ko) | 2017-09-29 | 2019-04-01 | 주식회사 나이벡 | 부갑상선호르몬(parathyroid hormone, PTH)에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물 및 생체재료 |
KR20190037181A (ko) | 2017-09-28 | 2019-04-05 | 한미약품 주식회사 | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 |
WO2019072963A1 (en) * | 2017-10-12 | 2019-04-18 | University Of Copenhagen | POLYTHERAPY FOR THE TREATMENT OF BONE DISEASES |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP5161412B2 (ja) * | 2000-09-18 | 2013-03-13 | サノス・バイオサイエンス・アクティーゼルスカブ | Glp−1及びglp−2ペプチドの使用方法 |
US20200254065A1 (en) * | 2019-02-11 | 2020-08-13 | Opko Biologics Ltd. | Long-acting glp-2 analogs |
-
2020
- 2020-12-24 KR KR1020200183241A patent/KR20210082120A/ko unknown
- 2020-12-24 CN CN202080095573.0A patent/CN115052619A/zh active Pending
- 2020-12-24 WO PCT/KR2020/019069 patent/WO2021133087A1/ko unknown
- 2020-12-24 EP EP20904974.1A patent/EP4082561A4/en active Pending
- 2020-12-24 JP JP2022539188A patent/JP2023508175A/ja active Pending
- 2020-12-24 US US17/788,488 patent/US20220362347A1/en active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US20070135345A1 (en) * | 2000-09-18 | 2007-06-14 | Henriksen Dennis B | Use of GLP-2 for the treatment or prevention, of bone-related disorders |
KR20130078634A (ko) * | 2011-12-30 | 2013-07-10 | 한미사이언스 주식회사 | 면역글로불린 단편을 이용한 위치 특이적 글루카곤 유사 펩타이드-2 약물 결합체 |
KR20190037181A (ko) | 2017-09-28 | 2019-04-05 | 한미약품 주식회사 | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 |
KR101964376B1 (ko) | 2017-09-29 | 2019-04-01 | 주식회사 나이벡 | 부갑상선호르몬(parathyroid hormone, PTH)에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물 및 생체재료 |
WO2019072963A1 (en) * | 2017-10-12 | 2019-04-18 | University Of Copenhagen | POLYTHERAPY FOR THE TREATMENT OF BONE DISEASES |
Non-Patent Citations (3)
Title |
---|
H. NEURATHR. L. HILL: "The Proteins", 1979, ACADEMIC PRESS |
HENRIKSEN, D.B. ; ALEXANDERSEN, P. ; HARTMANN, B. ; ADRIAN, C.L. ; BYRJALSEN, I. ; BONE, H.G. ; HOLST, J.J. ; CHRISTIANSEN, C.: "Four-month treatment with GLP-2 significantly increases hip BMD", BONE, PERGAMON PRESS., vol. 45, no. 5, 1 November 2009 (2009-11-01), GB, pages 833 - 842, XP026643724, ISSN: 8756-3282, DOI: 10.1016/j.bone.2009.07.008 * |
See also references of EP4082561A4 |
Also Published As
Publication number | Publication date |
---|---|
KR20210082120A (ko) | 2021-07-02 |
CN115052619A (zh) | 2022-09-13 |
US20220362347A1 (en) | 2022-11-17 |
JP2023508175A (ja) | 2023-03-01 |
EP4082561A1 (en) | 2022-11-02 |
EP4082561A4 (en) | 2024-02-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2017116205A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체 | |
AU2016287209B2 (en) | Glucagon derivative and a composition comprising a long acting conjugate of the same | |
WO2012173422A1 (en) | A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof | |
WO2018004283A2 (ko) | 글루카곤 유도체, 이의 결합체, 및 이를 포함하는 조성물, 및 이의 치료적 용도 | |
WO2014073845A1 (en) | A composition for treating diabetes or diabesity comprising oxyntomodulin analog | |
WO2017052321A1 (ko) | 다수의 생리활성 폴리펩타이드 및 면역글로불린 Fc 영역을 포함하는, 단백질 결합체 | |
WO2015152618A1 (ko) | 면역글로불린 fc 단편 결합을 이용한 단백질 및 펩타이드의 용해도를 개선시키는 방법 | |
WO2020130749A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물 | |
WO2022015082A1 (ko) | 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도 | |
WO2018174668A2 (ko) | 인슐린 수용체와의 결합력이 감소된 인슐린 아날로그의 결합체 및 이의 용도 | |
WO2021201654A1 (ko) | Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물 | |
WO2019066586A1 (ko) | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 | |
WO2021133087A1 (ko) | Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물 | |
WO2021066600A1 (ko) | 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도 | |
WO2023106845A1 (ko) | 신규한 아디포넥틴 아날로그 및 결합체 | |
WO2020071865A1 (ko) | 글루카곤 및 이를 포함하는 조합물의 치료학적 용도 | |
WO2022015115A1 (ko) | 3중 작용성 지속형 결합체 또는 3중 작용제를 포함하는 조합물의 치료학적 용도 | |
WO2021215801A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법 | |
WO2020214013A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도 | |
WO2022080987A1 (ko) | 글루카곤/glp-1/gip 삼중작용제 또는 이의 지속형 결합체를 포함하는 혈관염 예방 또는 치료용 약학적 조성물 | |
WO2020263063A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도 | |
WO2022065898A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 골 질환에 대한 예방 또는 치료용 약학적 조성물 | |
CN101522709A (zh) | 作为pth受体调节剂的聚乙二醇化的pth及其用途 | |
WO2023204556A1 (ko) | 장질환의 예방 또는 치료를 위한 GLP-2와, 인슐린 분비 펩타이드, TNFα 억제제, 또는 이 둘 모두의 병용 요법 | |
WO2022139552A1 (ko) | 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20904974 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2022539188 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2020904974 Country of ref document: EP Effective date: 20220725 |