WO2022139552A1 - 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법 - Google Patents

단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법 Download PDF

Info

Publication number
WO2022139552A1
WO2022139552A1 PCT/KR2021/019854 KR2021019854W WO2022139552A1 WO 2022139552 A1 WO2022139552 A1 WO 2022139552A1 KR 2021019854 W KR2021019854 W KR 2021019854W WO 2022139552 A1 WO2022139552 A1 WO 2022139552A1
Authority
WO
WIPO (PCT)
Prior art keywords
glp
insulin
derivative
pharmaceutical composition
exendin
Prior art date
Application number
PCT/KR2021/019854
Other languages
English (en)
French (fr)
Inventor
최재혁
이진봉
이상현
권현주
홍성희
유녕상
Original Assignee
한미약품 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한미약품 주식회사 filed Critical 한미약품 주식회사
Priority to CA3201916A priority Critical patent/CA3201916A1/en
Priority to AU2021409610A priority patent/AU2021409610A1/en
Priority to MX2023007498A priority patent/MX2023007498A/es
Priority to EP21911617.5A priority patent/EP4302776A1/en
Priority to CN202180094229.4A priority patent/CN116940370A/zh
Priority to IL303624A priority patent/IL303624A/en
Priority to US18/269,134 priority patent/US20240299500A1/en
Priority to JP2023537538A priority patent/JP2024503242A/ja
Publication of WO2022139552A1 publication Critical patent/WO2022139552A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/26—Glucagons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/2235—Secretins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/2278—Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/605—Glucagons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to a combination therapy of an insulin-secreting peptide and GLP-2 for the prevention or treatment of short bowel syndrome.
  • Short bowel syndrome is a dyspepsia caused by the congenital shortness of the small intestine or the loss of more than a certain percentage of the small intestine (reduction of the absorption area of the small intestine) acquired through surgery. , malabsorption, abdominal pain, diarrhea, fatty stool, lactose intolerance, dehydration, weight loss, lethargy, fatigue, etc. may appear.
  • Glucagon-like peptide-2 (GLP-2) is a peptide hormone composed of 33 amino acids produced by L-cells in the small intestine in response to ingested nutrients. GLP-2 induces mucosal growth in the small intestine and large intestine, promotes growth of enterocytes and crypt cells, and inhibits apoptosis. GLP-2 also increases the absorption of nutrients from the small intestine and decreases intestinal permeability. It inhibits gastric emptying and gastric acid secretion, increases intestinal blood flow rate, and relaxes intestinal smooth muscle.
  • GLP-2 enhances nutrient absorption and gastrointestinal absorption in a rodent experimental model with short bowel syndrome (Ljungmann K et al., Am. J. Physiol. Gastrointest Liver Physiol., 2001, 281(3): G779-85).
  • GLP-1 glucagon-like peptide 1
  • Exendin-4 a GLP-1 analogue purified from the salivary glands of the glia monster.
  • DPP-IV dipeptidyl peptidase-4
  • One object of the present invention is to provide a therapy for the prevention, improvement or treatment of short bowel syndrome using an insulin-secreting peptide and GLP-2 (Glucagon-like peptide-2, GLP-2) in combination.
  • GLP-2 Glucagon-like peptide-2, GLP-2
  • Another object of the present invention is to provide a pharmaceutical composition for the prevention or treatment of short bowel syndrome containing an insulin-secreting peptide, wherein the pharmaceutical composition is administered in combination with GLP-2. .
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating short bowel syndrome containing GLP-2, wherein the pharmaceutical composition is administered in combination with an insulin-secreting peptide. .
  • Another object of the present invention is to provide a combination comprising an insulin secreting peptide and GLP-2.
  • Another object of the present invention is to provide a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome, comprising the combination.
  • Another object of the present invention is to provide a pharmaceutical kit for the prevention, improvement or treatment of short bowel syndrome, comprising an insulin-secreting peptide and GLP-2.
  • Another object of the present invention is to provide a method for preventing, improving or treating short bowel syndrome, comprising administering and/or using the combination, pharmaceutical composition, or pharmaceutical kit to an individual in need thereof will be.
  • Another object of the present invention includes the steps of co-administering and/or using a composition containing a pharmaceutically effective amount of an insulin-secreting peptide and a composition containing a pharmaceutically effective amount of GLP-2 to an individual in need thereof It is to provide a method for preventing, improving or treating short bowel syndrome.
  • Another object of the present invention is the use of the combination, pharmaceutical composition, or pharmaceutical kit for the prevention, improvement or treatment of short bowel syndrome, and/or use for the manufacture of a medicament for the prevention, improvement or treatment of short bowel syndrome. is to provide
  • One aspect embodying the present invention is a therapy for the prevention, improvement or treatment of short bowel syndrome using an insulin-secreting peptide and GLP-2 in combination.
  • One embodiment embodying the present invention is a composition for the prevention, improvement or treatment of short bowel syndrome containing an insulin-secreting peptide, wherein the insulin-secreting peptide is administered in combination with GLP-2.
  • the present invention provides a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome containing a pharmaceutically effective amount of an insulin-secreting peptide, wherein the pharmaceutical composition is administered in combination with GLP-2. .
  • the present invention provides a food composition for preventing or improving short bowel syndrome containing an insulin-secreting peptide, wherein the food composition is administered in combination with GLP-2.
  • One embodiment embodying the present invention is a composition for the prevention, improvement or treatment of short bowel syndrome containing GLP-2, wherein the GLP-2 is administered in combination with an insulin-secreting peptide.
  • the present invention provides a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome containing a pharmaceutically effective amount of GLP-2, wherein the pharmaceutical composition is administered in combination with an insulin-secreting peptide. .
  • the present invention provides a food composition for preventing or improving short bowel syndrome containing GLP-2, wherein the food composition is administered in combination with an insulin-secreting peptide.
  • composition according to any one of the preceding embodiments, wherein the insulin-secreting peptide is glucagon-like peptide-1 (GLP-1), exendin-3, exendin-4, or an agonist thereof. , derivatives, fragments, variants, and combinations thereof.
  • GLP-1 glucagon-like peptide-1
  • exendin-3 exendin-4
  • exendin-4 or an agonist thereof.
  • derivatives, fragments, variants, and combinations thereof derivatives, fragments, variants, and combinations thereof.
  • composition according to any one of the preceding embodiments wherein, in the insulin-secreting peptide, the N-terminal histidine residue of the insulin-secreting peptide is imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N-dimethyl It is characterized as an insulin-secreting peptide derivative substituted with histidine or ⁇ -carboxyimidazopropionyldeshistidine.
  • exendin-4 derivative from which is removed exendin-4 derivative from which the N-terminal amino group of exendin-4 has been removed, exendin-4 derivative from which the N-terminal amino group of exendin-4 is substituted with a hydroxyl group
  • composition according to any one of the preceding embodiments, wherein the GLP-2 is a native GLP-2 or a GLP-2 derivative.
  • composition according to any one of the preceding embodiments, wherein the GLP-2 derivative includes substitution, addition, deletion, modification, and modification of at least one amino acid in the native GLP-2 sequence It is characterized in that it is a GLP-2 derivative with a modification selected from the group consisting of a combination of
  • composition according to any one of the preceding embodiments, wherein the GLP-2 derivative is characterized in that at least one amino acid among amino acids 1, 2, 30 and 33 in SEQ ID NO: 1 is modified. .
  • composition according to any one of the preceding embodiments, wherein the GLP-2 derivative comprises an amino acid sequence represented by the following general formula 1:
  • X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
  • X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
  • X 30 is lysine or arginine
  • X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidolysine or cysteine;
  • composition according to any one of the preceding embodiments, wherein the GLP-2 derivative comprises
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is cysteine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is lysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is arginine
  • X 34 is lysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is 6-azidolysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is arginine
  • X 34 is cysteine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is Aib
  • X 30 is lysine
  • X 34 is cysteine
  • X 1 is histidine
  • X 2 is Aib
  • X 30 is lysine
  • X 34 is cysteine.
  • composition according to any one of the preceding embodiments, wherein the GLP-2 derivative comprises an amino acid sequence represented by the following general formula 2:
  • X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
  • X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
  • X 30 is lysine or arginine
  • X 34 is one or more optional amino acids or one or more optional amino acids to which a modification has occurred;
  • composition when administered to a subject, is characterized in that it causes at least one of weight gain, an increase in the length of the small intestine, a decrease in gastrointestinal motility, and an increase in nutrient absorption.
  • composition according to any one of the preceding embodiments, wherein (i) the insulin-secreting peptide is in the form of a long-acting conjugate to which a biocompatible substance capable of increasing its in vivo half-life is bound, or
  • the GLP-2 is in the form of a long-acting conjugate to which a biocompatible material capable of increasing its in vivo half-life is bound, or
  • Each of the insulin-secreting peptide and GLP-2 is characterized in that it is in the form of a long-acting conjugate to which a biocompatible substance capable of increasing their in vivo half-life is bound.
  • X is an insulin secreting peptide or GLP-2
  • L is a linker containing an ethylene glycol repeating unit
  • a is 0 or a natural number, provided that when a is 2 or more, each L is independent of each other;
  • F is an immunoglobulin Fc region
  • the "-" is a covalent bond.
  • composition according to any one of the preceding embodiments, wherein the immunoglobulin Fc region is an aglycosylated IgG4 Fc region.
  • composition according to any one of the preceding embodiments, wherein L is polyethylene glycol.
  • composition according to any one of the preceding embodiments, wherein the composition further comprises a pharmaceutically acceptable carrier, excipient or diluent.
  • composition according to any one of the preceding embodiments, wherein the composition containing the insulin-secreting peptide is administered concurrently with the composition containing GLP-2, sequentially or in reverse order.
  • Another aspect embodying the present invention is a combination comprising an insulin-secreting peptide and GLP-2.
  • Another aspect embodying the present invention is a pharmaceutical composition for preventing, improving or treating short bowel syndrome, comprising the combination.
  • Another aspect embodying the present invention is a pharmaceutical kit for the prevention, improvement or treatment of short bowel syndrome, comprising the combination.
  • Another aspect embodying the present invention is a method for preventing, improving or treating short bowel syndrome, comprising administering and/or using the combination, pharmaceutical composition, or pharmaceutical kit to an individual in need thereof. .
  • a composition containing a pharmaceutically effective amount of an insulin-secreting peptide and a composition containing a pharmaceutically effective amount of GLP-2 are administered and/or used in combination to an individual in need thereof. It is a method for preventing, improving or treating short bowel syndrome, comprising the steps.
  • Another aspect embodying the present invention is for the prevention, improvement or treatment of short bowel syndrome of the combination, pharmaceutical composition, or pharmaceutical kit, and/or for the preparation of a medicament for the prevention or treatment of short bowel syndrome. is the use
  • the combination administration regimen of the insulin-secreting peptide and GLP-2 according to the present invention has an improved effect compared to a single administration regimen, and thus can be usefully used for the prevention, improvement or treatment of short bowel syndrome.
  • FIG. 1 is a diagram showing changes in body weight of mice according to the combined administration of an insulin-secreting peptide (GLP-1 derivative long-acting conjugate) and GLP-2 (GLP-2 derivative long-acting conjugate).
  • FIG. 2 is a diagram showing changes in the length of the small intestine in mice according to the combined administration of insulin-secreting peptide (GLP-1 derivative long-acting conjugate) and GLP-2 (GLP-2 derivative long-acting conjugate).
  • FIG. 3 is a diagram showing changes in gastrointestinal motility according to the combined administration of insulin-secreting peptide (GLP-1 derivative long-acting conjugate) and GLP-2 (GLP-2 derivative long-acting conjugate).
  • One aspect embodying the present invention is a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome (SBS) containing an insulin-secreting peptide, wherein the insulin-secreting peptide is a glucagon-like peptide-2 (Glucagon- like peptide-2, GLP-2) provides a pharmaceutical composition characterized in that it is administered in combination.
  • SBS short bowel syndrome
  • the pharmaceutical composition is a pharmaceutical composition for the prevention or treatment of short bowel syndrome containing an insulin-secreting peptide in a pharmaceutically effective amount, wherein the pharmaceutical composition is GLP-2 (eg, pharmaceutical composition). It may be characterized in that it is administered in combination with an effective amount of GLP-2), but is not limited thereto.
  • GLP-2 eg, pharmaceutical composition
  • Another aspect embodying the present invention is a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome containing GLP-2, wherein the GLP-2 is administered in combination with an insulin-secreting peptide.
  • the pharmaceutical composition is a pharmaceutical composition for the prevention, improvement or treatment of short bowel syndrome containing a pharmaceutically effective amount of GLP-2, wherein the pharmaceutical composition comprises an insulin-secreting peptide (eg, It may be characterized in that it is administered in combination with a pharmaceutically effective amount of an insulin-secreting peptide), but is not limited thereto.
  • an insulin-secreting peptide eg, It may be characterized in that it is administered in combination with a pharmaceutically effective amount of an insulin-secreting peptide, but is not limited thereto.
  • the co-administration is (i) co-administered using a pharmaceutical composition further comprising GLP-2 in the form of a mixture or separate form together with an insulin-secreting peptide, or (ii) )
  • the pharmaceutical composition containing the insulin-secreting peptide may be administered in combination with a separate pharmaceutical composition containing GLP-2 simultaneously, sequentially or in reverse order, but is not limited thereto.
  • Another aspect of the present invention provides a use for preventing, improving or treating short bowel syndrome using an insulin-secreting peptide and GLP-2 in combination.
  • Another embodiment provides a pharmaceutical composition for preventing, improving or treating short bowel syndrome using an insulin-secreting peptide and GLP-2 in combination.
  • one aspect of the present invention provides a combination, pharmaceutical composition, or pharmaceutical kit comprising an insulin-secreting peptide and GLP-2. In one embodiment, it provides a combination, pharmaceutical composition, or pharmaceutical kit for the prevention, improvement or treatment of short bowel syndrome.
  • the term “combination” refers to the use of the insulin-secreting peptide and GLP-2 for combined administration, and may be understood to have the same meaning as “combined use”. This includes, but is not limited to, a pharmaceutical composition characterized in that the insulin-secreting peptide and GLP-2 are used in combination and in the form of a pharmaceutical kit.
  • the insulin-secreting peptide and GLP-2 are administered as a mixture;
  • the insulin-secreting peptide and GLP-2 may be administered in a separate form, but is not limited thereto.
  • each of the insulin-secreting peptide and GLP-2 may be formulated as separate agents, and the separate agents may be administered simultaneously, separately, sequentially, or in reverse order.
  • “combination administration”, “combination”, or “in combination” does not only mean simultaneous administration, but also the insulin-secreting peptide and GLP-2 act together on the subject so that each substance has its own function It should be understood as a dosage form capable of performing at a level equivalent to or higher than that of Accordingly, herein, when the term “combination” is used, it is to be understood that it refers to simultaneous, separate, sequential, or reverse administration, and the order is not limited. When the administration is sequential, reversed or separate, the order of administration is not particularly limited, provided that the interval between administration of the secondary component should be such that the beneficial effect of the combination is not lost.
  • composition comprising a combination may be a combination itself comprising the insulin-secreting peptide and GLP-2, or it may contain the same and have therapeutic use, but is not limited thereto. .
  • composition may have a use for preventing, improving or treating short bowel syndrome, but is not limited thereto.
  • composition comprising a combination may be used interchangeably with “composition”.
  • composition comprising the combination according to the present invention is for co-administration of the insulin-secreting peptide and GLP-2, and the insulin-secreting peptide and GLP-2 may be formulated as one formulation or separately formulated. . Specifically, the insulin-secreting peptide and GLP-2 may be administered simultaneously, separately, sequentially, or in reverse order, but is not limited thereto.
  • the term "kit” may include a combination or composition according to the present invention for co-administration of the insulin-secreting peptide and GLP-2.
  • the kit according to the present invention includes an insulin-secreting peptide and GLP-2 formulated as a single agent; Alternatively, it may include individual preparations of the insulin-secreting peptide and GLP-2, and may additionally include a substance necessary for co-administration of the two substances, but is not limited thereto.
  • the present invention provides the combination therapy by confirming that the prevention, improvement or therapeutic effect of short bowel syndrome is dramatically increased compared to the insulin-secreting peptide alone when GLP-2 is additionally included in the insulin-secreting peptide and used in combination. became
  • insulin-secreting peptide refers to a peptide having an insulin-secreting function, and can stimulate the synthesis or expression of insulin in pancreatic beta cells.
  • the insulin-secreting peptide may be, for example, glucose like peptide-1 (GLP-1), exendin-3, or exendin-4, but is not limited thereto.
  • GLP-1 glucose like peptide-1
  • exendin-3 or exendin-4, but is not limited thereto.
  • the insulin-secreting peptide includes not only the native insulin-secreting peptide, but also precursors, agonists, derivatives, fragments, and variants thereof, and their in vivo half-lives. It also includes the form of a long-acting conjugate to which a biocompatible substance that can increase
  • the insulin-secreting peptide may be included in the pharmaceutical composition in a pharmaceutically effective amount.
  • GLP-1 is a hormone secreted from the small intestine and generally promotes insulin biosynthesis and secretion, suppresses glucagon secretion, and promotes intracellular glucose uptake.
  • the glucagon precursor is broken down into three peptides: glucagon, GLP-1, and GLP-2.
  • GLP-1 refers to GLP-1(1-37), which is a form without insulin secretion function, and is processed into GLP-1(7-37) form to become active GLP-1(7-37).
  • the GLP-1 (7-37) amino acid sequence is as follows.
  • Exendin-3 and Exendin-4 are GLP-1 analogs or derivatives composed of 39 amino acids that show 53% amino acid sequence similarity to GLP-1, and correspond to insulin-secreting peptides.
  • the amino acid sequences of exendin-3 and exendin-4 are as follows.
  • HSDGT FTSDL SKQME EEAVR LFIEW LKNGG PSSGA PPPS (SEQ ID NO: 33)
  • HGEGT FTSDL SKQME EEAVR LFIEW LKNGG PSSGA PPPS (SEQ ID NO: 34)
  • the insulin-secreting peptide derivative has an insulin-secreting function, and has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity with the native insulin-secreting peptide in amino acid sequence. and/or some group of amino acid residues in the insulin-secreting peptide are chemically substituted (eg, alpha-methylation, alpha-hydroxylation), removed (eg, deamination) or modified (eg, N-methylation). It may be in the form, but is not limited thereto.
  • the insulin-secreting peptide derivative of the present invention is synthesized by removing the alpha amino group of the N-terminal histidine, replacing the N-terminal amino group with a hydroxyl group or a carboxyl group, N -Removing the alpha carbon of the terminal histidine and the N-terminal amino group bonded to the alpha carbon to leave only imidazo-acetyl functionalities, or modifying the N-terminal amino group with two methyl groups, etc. can be manufactured.
  • the N-terminal histidine residue of the insulin-secreting peptide is imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or ⁇ - It may be an insulin-secreting peptide derivative substituted with carboxyimidazopropionyldeshistidine.
  • the insulin-secreting peptide derivative may be a GLP-1 derivative
  • the GLP-1 derivative includes, but is not limited to, exendin-3, exendin-4, or a derivative thereof.
  • an example of the insulin-secreting peptide derivative may be a derivative in which the N-terminal amino group or amino acid residue of Exendin-4 is chemically mutated.
  • imidazoacetyl deshistidyl exendin-4 imidazoacetyl-deshistidyl-exendin-4, CA-exendin-4) from which the bound N-terminal amino group has been removed, and desamino hiss from which the N-terminal amino group of exendin-4 has been removed
  • Tidyl exendin-4 (desaminohistidyl exendin-4, DA-exendin-4)
  • the insulin-secreting peptide fragment refers to a form in which one or more amino acids are removed and/or added to the N-terminus or C-terminus of the native insulin-secreting peptide, and the added amino acid is an amino acid that does not exist in nature (eg, D-type). amino acids) are also possible.
  • the insulin-secreting peptide variant is a peptide having one or more amino acids different from the native insulin-secreting peptide, and has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity. It means a peptide with insulin secretion function.
  • An insulin-secreting peptide agonist refers to a substance exhibiting the same biological activity as an insulin-secreting peptide by binding to an in vivo receptor of the insulin-secreting peptide regardless of the structure of the insulin-secreting peptide.
  • each of the preparation methods used in the derivatives, fragments, variants and agents of the present invention may be used independently or in combination.
  • insulin-secreting peptides differing in one or more amino acid sequences and deamination to the N-terminal amino acid residue are also included in the present invention.
  • glucagon-like peptide-2 or “GLP-2 (Glucagon-like peptide-2) is an agonist of a glucagon-like peptide-2 receptor, which can increase the half-life of a polypeptide form or its in vivo. It may be in the form of a long-acting conjugate to which a biocompatible material is bound, but is not limited thereto.
  • GLP-2 when referring to glucagon-like peptide-2 or GLP-2, not only sequences identical to native human GLP-2 but also GLP-2 derivatives are included, and biocompatible with native GLP-2 or GLP-2 derivatives. It also encompasses long-acting conjugates in which substances are bound.
  • the GLP-2 may be included in a pharmaceutically effective amount in the composition or a separate composition so that it can be administered or used in combination with a pharmaceutical composition containing an insulin-secreting peptide.
  • the amino acid sequence of native GLP-2 is as follows.
  • HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID NO: 1)
  • GLP-2 receptor agonist refers to a substance that binds to a human glucagon-like peptide-2 receptor in vivo or isolated and produces physiological activity equivalent to or similar to that of native GLP-2.
  • a GLP-2 agonist may include native GLP-2 or a GLP-2 derivative.
  • GLP-2 derivative refers to a peptide having at least one difference in amino acid sequence compared to native GLP-2; a peptide in which the native GLP-2 sequence is modified through modification; and/or a mimic of native GLP-2 having a preventive, therapeutic and/or ameliorating function of short bowel syndrome, such as native GLP-2.
  • the GLP-2 derivative is a modification selected from the group consisting of substitution, addition, deletion, modification, and combinations thereof to at least one amino acid in the native GLP-2 sequence. may have occurred, but is not limited thereto.
  • the added amino acid may be a non-natural amino acid (eg, D-type amino acid), and it is also possible to substitute a non-natural amino acid in addition to the natural amino acid.
  • the added amino acid sequence may be derived from native GLP-2, but is not limited thereto.
  • the modification of an amino acid is combined with substitution, addition, deletion, or a combination of at least one amino acid; Or independently, it means that some groups of amino acid residues are chemically substituted (eg, alpha-methylation, alpha-hydroxylation, or azido group), removed (eg, deamination) and/or modified (eg, N-methylation) can, but is not limited thereto.
  • the derivative of GLP-2 of the present invention contains at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of native GLP-2 and amino acid sequence.
  • an N-terminal amino group may be substituted, removed, or modified, but is not limited thereto.
  • GLP-2 of the present invention is a method of removing the alpha amino group of histidine at the N-terminus to prevent binding to the N-terminus, which is an important site for the in vivo activity of GLP-2, when preparing a long-acting conjugate; Synthesis method by substituting an amino group with a hydroxyl group or a carboxyl group, imidazo-acetyl action by removing the alpha carbon of the N-terminal histidine and the N-terminal amino group bonded to the alpha carbon It can be prepared through a method of leaving only a group, a method of modifying an N-terminal amino group with two methyl groups, and the like.
  • the GLP-2 derivative is imidazoacetyl-deshistidyl GLP-2 (imidazoacetyl-deshistidyl- GLP-2, CA-GLP-2), desaminohistidyl GLP-2 from which the N-terminal amino group of GLP-2 has been removed (desaminohistidyl GLP-2, DA-GLP-2), the N-terminal amino group of GLP-2 Beta-hydroxyimidazopropionyldeshistidyl GLP-2 ( ⁇ -hydroxyimidazopropionyldeshistidyl GLP-2, HY-GLP-2) substituted with a hydroxyl group, the N-terminal amino group of GLP-2 is modified with two methyl groups N-dimethylhistidyl GLP-2 (N-dimethylhistidyl GLP-2, DM-GLP-2), or beta-carboxyimidazopropionyldeshistidyl-GLP in which the N-terminal
  • imidazoacetyldeshistidyl (din), desaminohistidyl (din), beta-hydroxyimidazopropionyldeshistidyl (din), N-dimethylhistidyl (din), and beta-carboxyimidazo Propionyldeshistidyl (din) may be used in the same meaning as imidazoacetyl, des-amino-histidyl, beta-hydroxy-imidazopropionyl, dimethyl-histidyl, beta-carboxyl-imidazopropionyl, respectively. .
  • the GLP-2 derivative may be one in which at least one amino acid of amino acids 1, 2, 30 and 33 in SEQ ID NO: 1 is modified, but is not limited thereto.
  • the modification may be a modification selected from the group consisting of substitution, addition, deletion, modification, and combinations thereof of at least one amino acid, wherein the added amino acid is a non-natural amino acid (eg, a D-type amino acid) Also, it is possible to substitute non-natural amino acids in addition to natural amino acids.
  • the added amino acid sequence may be derived from native GLP-2, but is not limited thereto.
  • the modification of an amino acid is combined with substitution, addition, deletion, or a combination of at least one amino acid; Or independently, it means that some groups of amino acid residues are chemically substituted (eg, alpha-methylation, alpha-hydroxylation, or azido group), removed (eg, deamination) and/or modified (eg, N-methylation) can, but is not limited thereto.
  • the GLP-2 derivative may comprise, but is not limited to, the amino acid sequence of the following general formula 1:
  • X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
  • X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
  • X 30 is lysine or arginine
  • X 34 is absent or is lysine, arginine, glutamine, histidine, 6-azidolysine, or cysteine.
  • the GLP-2 derivative may include, but is not limited to, an amino acid sequence of the following general formula 2:
  • X 1 is histidine, imidazoacetyldeshistidine, desaminohistidine, ⁇ -hydroxyimidazopropionyldeshistidine, N -dimethylhistidine, or ⁇ -carboxyimidazopropionyldeshistidine;
  • X 2 is alanine, glycine, or Aib (2-aminoisobutyric acid);
  • X 30 is lysine or arginine
  • X 34 is one or more optional amino acids or one or more optional amino acids to which a modification has occurred.
  • the amino acid may be a natural amino acid or a non-natural amino acid, and the modification of the amino acid is as described above.
  • sequence identical to SEQ ID NO: 1 among the amino acid sequences of Formula 1 or 2 may be excluded from the GLP-2 derivative, but is not limited thereto.
  • the GLP-2 derivative of the present invention is a substitution of glycine or Aib (2-aminoisobutyric acid) for alanine, which is the second amino acid of native GLP-2, substitution of lysine, which is the 30th amino acid, with arginine, or these It may have a combination of, but is not limited thereto.
  • the GLP-2 derivative is a thiol group (eg, cysteine), an amino group (eg, lysine, arginine, glutamine or histidine) at the C-terminus (eg, the 33rd amino acid), or an azide group ( For example, 6-azidolysine) may be introduced, but is not limited thereto.
  • a GLP-2 conjugate with a selectively controlled binding site can be prepared using this.
  • one end of the linker is bound to a hydroxyl group, a thiol group, an amino group, or an azide group of the GLP-2 derivative, and a substance capable of increasing the half-life in vivo to the other end of the linker (e.g., immunoglobulin) Fc region) may be bound.
  • the thiol group, amino group, or azide group may be introduced by adding an amino acid to GLP-2, but is not limited thereto.
  • the thiol group is introduced by adding cysteine (C) to GLP-2; Amino groups are introduced by addition of lysine (K), arginine (R), glutamine (Q) or histidine (H); The azide group may be introduced by adding 6-azidolysine ( AZ K), but is not limited thereto.
  • At least one residue may be cysteine, lysine, arginine, glutamine, histidine or 6-azidolysine, but is not limited thereto.
  • the GLP-2 derivative of the present invention includes substitution of alanine, the second amino acid of native GLP-2, with glycine, and introduction of a thiol group (eg, cysteine) at the C-terminus, more specifically N - May include imidazoacetyl deshistidine in which the alpha carbon of the histidine residue, which is the first amino acid at the terminal, and the N-terminal amino group bonded to the alpha carbon are removed, for example, it may have the amino acid sequence of SEQ ID NO: 2, but is not limited thereto does not
  • the GLP-2 derivative of the present invention includes substitution of alanine, which is the second amino acid of native GLP-2, with glycine and introduction of an amino group (eg, lysine) at the C-terminus, more specifically N - May include imidazoacetyldeshistidine in which the alpha carbon of the histidine residue, which is the first amino acid at the terminal, and the N-terminal amino group bonded to the alpha carbon have been removed, for example, it may have the amino acid sequence of SEQ ID NO: 3, but is not limited thereto does not
  • the GLP-2 derivative of the present invention contains alanine as the second amino acid of native GLP-2 and glycine, lysine at the 30th amino acid of native GLP-2 with arginine, and the C-terminal It includes the introduction of an amino group (eg, lysine), and more specifically, may include imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed. and, for example, may have the amino acid sequence of SEQ ID NO: 4, but is not limited thereto.
  • the GLP-2 derivative of the present invention includes substitution of alanine, the second amino acid of native GLP-2, with glycine, and introduction of an azide group (eg, 6-azidolysine) at the C-terminus, , more specifically, may include imidazoacetyl deshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed, for example, it may have the amino acid sequence of SEQ ID NO: 5
  • the present invention is not limited thereto.
  • the GLP-2 derivative of the present invention contains alanine as the second amino acid of native GLP-2 and glycine, lysine at the 30th amino acid of native GLP-2 with arginine, and the C-terminal It may include introduction of a thiol group (eg, cysteine), more specifically imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed. and, for example, may have the amino acid sequence of SEQ ID NO: 6, but is not limited thereto.
  • a thiol group eg, cysteine
  • imidazoacetyldeshistidine more specifically imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed.
  • SEQ ID NO: 6 but is not
  • the GLP-2 derivative of the present invention comprises substitution of alanine, the second amino acid of native GLP-2, with 2-aminoisobutyric acid, and introduction of a thiol group (eg, cysteine) at the C-terminus,
  • a thiol group eg, cysteine
  • it may have the amino acid sequence of SEQ ID NO: 8, and more specifically, may include imidazoacetyldeshistidine in which the N-terminal amino group bonded to the alpha carbon and the alpha carbon of the histidine residue, which is the first N-terminal amino acid, has been removed.
  • the GLP-2 derivatives of SEQ ID Nos: 2 to 8 are shown in Table 1 below.
  • ca H is substituted with imidazoacetyl deshistidine instead of histidine
  • Aib is 2-aminoisobutyric acid
  • AZ K is 6-azido-L-lysine (6-azido- L-lysyine).
  • GLP-2 may be a peptide comprising the specific sequence described above, or a peptide comprising (or essentially consisting of) the specific sequence described above, but is not limited thereto.
  • X 2 is glycine or Aib
  • X 30 is lysine or arginine
  • X 2 is glycine or Aib
  • X 30 may be lysine or arginine, but is not limited thereto.
  • the GLP-2 derivative is represented by Formula 1 or 2
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is cysteine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is lysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is arginine
  • X 34 is lysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is lysine
  • X 34 is 6-azidolysine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is glycine
  • X 30 is arginine
  • X 34 is cysteine
  • X 1 is imidazoacetyldeshistidine
  • X 2 is Aib
  • X 30 is lysine
  • X 34 is cysteine
  • X 1 may be histidine
  • X 2 may be Aib
  • X 30 may be lysine
  • X 34 may be cysteine, but is not limited thereto.
  • modifications for the preparation of agonists, fragments, variants and derivatives of native GLP-2 include modifications using L-form or D-form amino acids, and/or non-natural amino acids; and/or modifying the native sequence by modification or post-translational modification (eg, methylation, acylation, ubiquitination, intramolecular covalent bonding, etc.).
  • the GLP-2 or GLP-2 derivative is protected from proteolytic enzymes in vivo and its N-terminus and/or C-terminus is chemically modified or protected with an organic group to increase stability,
  • the GLP-2 or GLP-2 derivative may be in a modified form by adding amino acids to the terminal and the like.
  • the N-terminus is acetylated and/or the C-terminal amidation is performed to remove these charges.
  • it is not particularly limited thereto.
  • GLP-2 or a GLP-2 derivative may have its C-terminus unmodified or amidated, but is not limited thereto.
  • the insulin-secreting peptide and/or GLP-2 may be in the form of a long-acting conjugate to which a biocompatible substance capable of increasing each in vivo half-life is bound, but is not limited thereto.
  • the long-acting conjugate may exhibit increased potency persistence compared to an insulin-secreting peptide or a derivative of GLP-2 to which a biocompatible material (eg, an immunoglobulin Fc region) is not bound, and in the present invention, an insulin-secreting peptide or GLP A conjugate containing an insulin-secreting peptide or GLP-2, which has an increased half-life by binding of a biocompatible substance to -2, is respectively referred to as “insulin-secreting peptide long-acting conjugate or insulin-secreting peptide long-acting conjugate” or “GLP-2 long-acting conjugate”, respectively. conjugate or a long-acting conjugate of GLP-2.
  • the long-acting binder is used interchangeably with the
  • the insulin-secreting peptide is in the form of a long-acting conjugate to which a biocompatible substance capable of increasing its in vivo half-life is bound, or
  • the GLP-2 is in the form of a long-acting conjugate to which a biocompatible material capable of increasing its in vivo half-life is bound, or
  • Each of the insulin-secreting peptide and GLP-2 may be in the form of a long-acting conjugate to which a biocompatible substance capable of increasing their in vivo half-life is bound.
  • the combination may be non-naturally occurring.
  • connection between the insulin-secreting peptide or GLP-2 and the biocompatible material may be a physical or chemical bond, a non-covalent bond or a covalent bond, and specifically a covalent bond.
  • the present invention is not limited thereto.
  • the method for linking the insulin-secreting peptide or GLP-2 and the biocompatible material (eg, immunoglobulin Fc region) in the long-acting conjugate is not particularly limited, but the insulin-secreting peptide or GLP-2 and the biocompatible material (eg, through a linker)
  • the insulin-secreting peptide or GLP-2 and the biocompatible material eg, through a linker
  • immunoglobulin Fc regions may be linked to each other.
  • Korean Patent Application Laid-Open No. 10-2019-0037181 relating to a long-acting conjugate of GLP-2 is incorporated herein by reference.
  • the long-acting conjugate of the insulin-secreting peptide or GLP-2 of the present invention may have the structure of Formula 1 below, but is not limited thereto.
  • X is an insulin secreting peptide or GLP-2
  • L is a linker (eg, a linker containing ethylene glycol repeat units
  • a is 0 or a natural number, provided that when a is 2 or more, each L is independent of each other;
  • F is a biocompatible substance capable of increasing the in vivo half-life of X (eg, an immunoglobulin Fc region);
  • the “-” is a chemical bond (eg, a covalent bond).
  • X and L, and L and F may be connected to each other by a covalent bond, and in this case, the conjugate may be a conjugate in which X, L, and F are each connected through a covalent bond in the order of Formula 1 .
  • F may be directly connected to X (ie, a is 0 in Formula 1) or connected through a linker (L).
  • F is X, that is, a substance capable of increasing the half-life of the insulin-secreting peptide or GLP-2 according to the present invention, and corresponds to one component of a moiety constituting the conjugate of the present invention.
  • the F may be bonded to each other by a covalent chemical bond or a non-covalent chemical bond with X, and F and X may be bonded to each other through L through a covalent chemical bond, a non-covalent chemical bond, or a combination thereof.
  • the F is a material capable of increasing the in vivo half-life of X is a biocompatible material, for example, a high molecular polymer, fatty acid, cholesterol, albumin and fragments thereof, an albumin binding material, a polymer of a repeating unit of a specific amino acid sequence, an antibody , antibody fragments, FcRn binding materials, in vivo connective tissue, nucleotides, fibronectin, transferrin, saccharides, heparin, and elastin may be selected from the group consisting of, but is not particularly limited thereto.
  • a biocompatible material for example, a high molecular polymer, fatty acid, cholesterol, albumin and fragments thereof, an albumin binding material, a polymer of a repeating unit of a specific amino acid sequence, an antibody , antibody fragments, FcRn binding materials, in vivo connective tissue, nucleotides, fibronectin, transferrin, saccharides, heparin, and elastin
  • the elastin may be human tropoelastin, a water-soluble precursor, and may be a polymer of some sequences or some repeating units of these, for example, all cases of an elastin-like polypeptide, but is not particularly limited thereto. .
  • polymer polymer examples include polyethylene glycol (PEG), polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitin, and a high molecular polymer selected from the group consisting of hyaluronic acid, oligonucleotides, and combinations thereof, and the polysaccharide may include dextran, but is not particularly limited thereto.
  • PEG polyethylene glycol
  • polypropylene glycol ethylene glycol-propylene glycol copolymer
  • polyoxyethylated polyol polyvinyl alcohol
  • polysaccharide polyvinyl ethyl ether
  • biodegradable polymer lipid polymer
  • chitin examples of the polysaccharide may include dextran, but is not particularly limited thereto.
  • polyethylene glycol is a term encompassing all forms of ethylene glycol homopolymer, PEG copolymer, or monomethyl-substituted PEG polymer (mPEG), but is not particularly limited thereto.
  • biocompatible material includes, but is not limited to, poly-amino acids such as poly-lysine, poly-aspartic acid and poly-glutamic acid.
  • the fatty acid may have a binding force with albumin in vivo, but is not particularly limited thereto.
  • the F may be an FcRn-binding substance, and specifically, the FcRn-binding substance may be an immunoglobulin Fc region, more specifically an IgG Fc region, more specifically an aglycosylated IgG4 Fc area, but is not particularly limited thereto.
  • the F eg, immunoglobulin Fc region
  • the F is a dimer consisting of two polypeptide chains, and one end of L is linked to only one of the two polypeptide chains.
  • the long-acting conjugate of the present invention may be one in which an insulin-secreting peptide or GLP-2 and an immunoglobulin Fc region are linked, but is not limited thereto.
  • immunoglobulin Fc region refers to a heavy chain constant region excluding the heavy chain and light chain variable regions of an immunoglobulin.
  • the immunoglobulin Fc region may include a heavy chain constant region 2 (CH2) and/or heavy chain constant region 3 (CH3) portion, and more specifically, a hinge region (means all or part of the hinge region). .) may be further included.
  • the immunoglobulin Fc region may be one component constituting a moiety of the conjugate of the present invention. Specifically, it corresponds to F in Formula 1 above.
  • the Fc region not only the native sequence obtained from papain digestion of immunoglobulin, but also derivatives and substitutions thereof, for example, one or more amino acid residues in the native sequence are transformed by deletion, insertion, non-conservative or conservative substitution, or a combination thereof. It includes even modified variants such as sequences that are different from the natural form due to the The above derivatives, substituents and variants are premised on retaining the ability to bind FcRn.
  • the F (eg, immunoglobulin Fc region) has a structure in which two polypeptide chains are linked by a disulfide bond, and may be a structure in which only one of the two chains is linked through a nitrogen atom, but is limited thereto doesn't happen
  • the linkage through the nitrogen atom may be connected through reductive amination to the epsilon amino atom or the N-terminal amino group of lysine.
  • Reductive amination reaction means a reaction in which an amine group or an amino group of a reactant reacts with an aldehyde (i.e., a functional group capable of reductive amination) of another reactant to form an amine, and then forms an amine bond by a reduction reaction, It is an organic synthesis reaction well known in the art.
  • aldehyde i.e., a functional group capable of reductive amination
  • the immunoglobulin Fc region may be linked through its N-terminal nitrogen atom.
  • the immunoglobulin Fc region may include a hinge region in the heavy chain constant region, but is not limited thereto.
  • the immunoglobulin Fc region may include a specific hinge sequence at the N-terminus.
  • flankinge sequence refers to a region that is located on a heavy chain and forms a dimer of an immunoglobulin Fc region through an inter disulfide bond.
  • the hinge sequence may be mutated to have only one cysteine residue by deleting a portion of the hinge sequence having the following amino acid sequence, but is not limited thereto:
  • the hinge sequence may include only one cysteine residue by deleting the 8th or 11th cysteine residue in the hinge sequence of SEQ ID NO: 11.
  • the hinge sequence of the present invention may be composed of 3 to 12 amino acids, including only one cysteine residue, but is not limited thereto.
  • the hinge sequence of the present invention may have the following sequence: Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro (SEQ ID NO: 12), Glu-Ser- Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Pro (SEQ ID NO: 13), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser (SEQ ID NO: 14), Glu- Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Pro (SEQ ID NO: 15), Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser (SEQ ID NO: 16), Glu-Ser-Lys- Tyr-Gly-Pro-Pro-Cys (SEQ ID NO: 17), Glu-Lys-Tyr-Gly-Pro-Pro-Cys (SEQ ID NO: 18),
  • the hinge sequence may include the amino acid sequence of SEQ ID NO: 21 (Pro-Ser-Cys-Pro) or SEQ ID NO: 30 (Ser-Cys-Pro), but is not limited thereto.
  • the N-terminal of the immunoglobulin Fc region in the conjugate is proline, and in this conjugate, the Fc region is linked to a linker through the nitrogen atom of the proline.
  • the immunoglobulin Fc region may be in the form of a dimer in which two chains of the immunoglobulin Fc region form a homodimer or a heterodimer due to the presence of a hinge sequence.
  • the conjugate of Formula 1 of the present invention may be in a form in which one end of the linker is linked to one chain of the immunoglobulin Fc region of the dimer, but is not limited thereto.
  • N-terminus refers to the amino terminus of a protein or polypeptide, and 1, 2, 3, 4, 5, 6, It may include up to 7, 8, 9, or 10 or more amino acids.
  • the immunoglobulin Fc region of the present invention may include a hinge sequence at the N-terminus, but is not limited thereto.
  • part or all of the heavy chain constant region 1 (CH1) and/or the light chain constant region except for only the heavy and light chain variable regions of immunoglobulin 1 (CL1) may be an extended Fc region. Also, it may be a region in which some fairly long amino acid sequences corresponding to CH2 and/or CH3 have been removed.
  • the immunoglobulin Fc region of the present invention comprises 1) a CH1 domain, a CH2 domain, a CH3 domain and a CH4 domain, 2) a CH1 domain and a CH2 domain, 3) a CH1 domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, 5) a combination of one or two or more of the CH1 domain, the CH2 domain, the CH3 domain and the CH4 domain with an immunoglobulin hinge region (or a part of the hinge region), or 6) a dimer of each domain of the heavy chain constant region and the light chain constant region
  • the present invention is not limited thereto.
  • the immunoglobulin Fc region may be in a dimeric form, and one molecule of X may be covalently linked to one Fc region in the dimeric form. , wherein the immunoglobulin Fc and X may be linked to each other by one and the same linker.
  • the immunoglobulin Fc and X may be connected to each other by a linker.
  • the immunoglobulin Fc region of the present invention includes a native amino acid sequence as well as a sequence derivative thereof.
  • An amino acid sequence derivative means that one or more amino acid residues in a natural amino acid sequence have a different sequence by deletion, insertion, non-conservative or conservative substitution, or a combination thereof.
  • amino acid residues 214 to 238, 297 to 299, 318 to 322, or 327 to 331 known to be important for binding may be used as suitable sites for modification.
  • various types of derivatives are possible, such as a site capable of forming a disulfide bond is removed, some amino acids at the N-terminus of native Fc are removed, or a methionine residue may be added to the N-terminus of native Fc do.
  • the complement binding site eg, the C1q binding site
  • the ADCC antibody dependent cell mediated cytotoxicity
  • the above-described Fc derivative may exhibit biological activity equivalent to that of the Fc region of the present invention, and may have increased structural stability to heat, pH, etc. of the Fc region.
  • the Fc region may be obtained from a native type isolated in vivo from animals such as humans, cows, goats, pigs, mice, rabbits, hamsters, rats or guinea pigs, or obtained from transformed animal cells or microorganisms. It may be recombinant or a derivative thereof.
  • the method of obtaining from the native type may be a method of obtaining whole immunoglobulin by isolating it from a living body of a human or animal and then treating it with a proteolytic enzyme. When treated with papain, it is cleaved into Fab and Fc, and when treated with pepsin, it is cleaved into pF'c and F(ab)2.
  • Fc or pF'c may be separated using size-exclusion chromatography or the like.
  • it is a recombinant immunoglobulin Fc region obtained from a human-derived Fc region from a microorganism.
  • the immunoglobulin Fc region may have a native sugar chain, an increased sugar chain compared to the native type, a decreased sugar chain compared to the native type, or a form in which the sugar chain is removed.
  • Conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms may be used for the increase or decrease or removal of such immunoglobulin Fc sugar chains.
  • the immunoglobulin Fc region from which the sugar chains are removed from the Fc has significantly reduced binding to complement (c1q) and reduced or eliminated antibody-dependent cytotoxicity or complement-dependent cytotoxicity, so that unnecessary immune responses in vivo are not induced. does not In this respect, a form more suitable for the original purpose as a drug carrier will be an immunoglobulin Fc region in which sugar chains are removed or non-glycosylated.
  • deglycosylation refers to an Fc region from which sugars have been removed with an enzyme
  • aglycosylation refers to an Fc region that is not glycosylated by production in prokaryotes, in a more specific embodiment, in E. coli. .
  • the immunoglobulin Fc region may be of human or animal origin, such as cattle, goats, pigs, mice, rabbits, hamsters, rats, guinea pigs, and in a more specific embodiment, human origin.
  • the immunoglobulin Fc region may be an Fc region derived from IgG, IgA, IgD, IgE, or IgM, or a combination or hybrid thereof. In a more specific embodiment, it is derived from IgG or IgM, which is most abundant in human blood, and in a more specific embodiment it is derived from IgG, which is known to enhance the half-life of ligand binding proteins. In an even more specific embodiment, the immunoglobulin Fc region is an IgG4 Fc region, and in the most specific embodiment, the immunoglobulin Fc region is a non-glycosylated Fc region derived from human IgG4, but is not limited thereto.
  • the immunoglobulin Fc region is a fragment of human IgG4 Fc, and is a homodimer in which two monomers are linked through a disulfide bond (inter-chain form) between cysteine, the 3rd amino acid of each monomer.
  • the homodimer may have/have a disulfide bond between cysteines at positions 35 and 95 and between cysteines at positions 141 and 199 in each monomer, i.e., two disulfide bonds (intra-chain form).
  • the number of amino acids of each monomer may consist of 221 amino acids, and the amino acids forming a homodimer may consist of a total of 442 amino acids, but is not limited thereto.
  • the immunoglobulin Fc region is a homodimer comprising the amino acid sequence of SEQ ID NO: 35 (consisting of 442 amino acids) (wherein, two monomers having the amino acid sequence of SEQ ID NO: 31 (consisting of 221 amino acids) are 3 of each monomer A homodimer is formed through a disulfide bond between cysteines, which are amino acids, and the monomers of the homodimer each independently form an internal disulfide bond between cysteines at positions 35 and 95 and an internal disulfide bond between cysteines at positions 141 and 199. ), but is not limited thereto.
  • the term "combination" with respect to an immunoglobulin Fc region means that when a dimer or multimer is formed, a polypeptide encoding a single-chain immunoglobulin Fc region of the same origin forms a bond with a single-chain polypeptide of a different origin. means to do That is, it is possible to prepare a dimer or multimer from two or more Fc regions selected from the group consisting of IgG Fc, IgA Fc, IgM Fc, IgD Fc and IgE Fc region.
  • hybrid is a term meaning that sequences corresponding to immunoglobulin Fc regions of two or more different origins exist in a single-chain immunoglobulin constant region.
  • various types of hybrids are possible. That is, a hybrid of domains consisting of 1 to 4 domains from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is possible, and may include a hinge.
  • IgG can also be divided into subclasses of IgG1, IgG2, IgG3 and IgG4, and in the present invention, a combination thereof or hybridization thereof is also possible. Specifically, the subclasses of IgG2 and IgG4, and most specifically, the Fc region of IgG4 having little effector function such as complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • the above-described conjugate may have an increased duration of effect compared to the native insulin-secreting peptide or native GLP-2, or compared to X in which F is not modified. It includes, but is not limited to, the form encapsulated in nanoparticles.
  • the linker L may be a peptidic linker or a non-peptidyl linker (eg, a linker containing an ethylene glycol repeating unit).
  • L is a peptidic linker
  • it may include one or more amino acids, for example, 1 to 1000 amino acids, but is not particularly limited thereto.
  • various known peptide linkers may be used in the present invention to link F and X, and examples thereof include a [GS]x linker, [GGGS]x linker, and [GGGGS]x linker, where x is It may be 1 or more natural numbers. However, it is not limited to the above example.
  • non-peptidyl linker includes a biocompatible polymer in which two or more repeating units are bonded. The repeating units are linked to each other through any covalent bond other than a peptide bond.
  • the non-peptidyl linker may be one component constituting a moiety of the conjugate of the present invention, and corresponds to L in Formula 1 above.
  • the non-peptidyl linker that can be used in the present invention may be used without limitation as long as it is a polymer resistant to proteolytic enzymes in vivo.
  • the non-peptidyl linker may be used in combination with a non-peptidyl polymer.
  • non-peptidyl linker may include polyethylene glycol, polypropylene glycol, copolymers of ethylene glycol and propylene glycol, polyoxyethylated polyols, polyvinyl alcohol, polysaccharides (eg, dextran, etc.), poly It may be selected from the group consisting of vinyl ethyl ether, biodegradable polymers such as polylactic acid (PLA) and polylactic-glycolic acid (PLGA), lipid polymers, chitin, hyaluronic acid, oligonucleotides, and combinations thereof.
  • PLA polylactic acid
  • PLGA polylactic-glycolic acid
  • lipid polymers chitin, hyaluronic acid, oligonucleotides, and combinations thereof.
  • the non-peptidyl linker that can be used in the present invention can be used without limitation as long as it is a polymer resistant to protease in vivo.
  • the molecular weight of the non-peptidyl polymer is in the range of more than 0 to about 100 kDa, from about 1 to about 100 in the range of kDa, specifically in the range of about 1 to 50 kDa, in the range of about 1 to about 20 kDa, in the range of about 1 to about 10 kDa, or in the range of about 3.4 kDa to 10 kDa.
  • non-peptidyl linker may be a linker containing an ethylene glycol repeating unit, for example, polyethylene glycol, and also derivatives thereof known in the art and easily at the level of skill in the art. Derivatives that can be prepared are also included in the scope of the present invention.
  • the repeating unit of the non-peptidyl linker may be an ethylene glycol repeating unit, and specifically, the non-peptidyl linker may include an ethylene glycol repeating unit and a functional group used in the preparation of the conjugate at the terminal thereof.
  • the long-acting conjugate according to the present invention may be in a form in which X and F are linked through the functional group, but is not limited thereto.
  • the non-peptidyl linker may include two, or three or more functional groups, and each functional group may be the same or different from each other, but is not limited thereto.
  • the linker may be polyethylene glycol (PEG) represented by the following formula (4), but is not limited thereto:
  • the PEG moiety in the long-acting conjugate may include not only the -(CH 2 CH 2 O) n -structure, but also an oxygen atom intervening between the linking element and the -(CH 2 CH 2 O) n -, but this It is not limited.
  • the conjugate may have a structure in which the insulin-secreting peptide or GLP-2 and the immunoglobulin Fc region (F) are covalently linked through a linker containing an ethylene glycol repeating unit, but is limited thereto not.
  • the polyethylene glycol is a term encompassing all forms of ethylene glycol homopolymer, PEG copolymer, or monomethyl-substituted PEG polymer (mPEG), but is not particularly limited thereto.
  • the ethylene glycol repeating unit may be represented by, for example, [OCH2CH2]n, and the value of n is a natural number, and the average molecular weight of the [OCH2CH2]n site in the peptide conjugate, for example, the number average molecular weight is greater than 0. It may be set to be about 100 kDa, but is not limited thereto.
  • the n value is a natural number
  • the average molecular weight of the [OCH2CH2]n site in the peptide conjugate is about 1 to about 100 kDa, about 1 to about 80 kDa, about 1 to about 50 kDa, about 1 to about 30 kDa, about 1 to about 25 kDa, about 1 to about 20 kDa, about 1 to about 15 kDa, about 1 to about 13 kDa, about 1 to about 11 kDa, about 1 to about 10 kDa, about 1 to about 8 kDa, about 1 to about 5 kDa, about 1 to about 3.4 kDa, about 3 to about 30 kDa, about 3 to about 27 kDa, about 3 to about 25 kDa, about 3 to about 22 kDa, about 3 to about 20 kDa, about 3 to about 18 kDa, about 3 to about 16 kDa, about 3 to about 100 kDa, about 1 to about 80 k
  • the term “about” includes all values within a range including ⁇ 0.5, ⁇ 0.4, ⁇ 0.3, ⁇ 0.2, ⁇ 0.1, etc., and includes all values in a range equal to or similar to the value following the term about, but not limited
  • non-peptidyl linker of the present invention to be coupled to the immunoglobulin Fc region, not only one type of polymer but also a combination of different types of polymers may be used.
  • both ends of the non-peptidyl linker may bind to a thiol group, an amino group, a hydroxyl group of the immunoglobulin Fc region, and a thiol group, an amino group, an azide group, or a hydroxyl group of GLP-2. , but not limited thereto.
  • the non-peptidyl linker includes a reactive group capable of binding to immunoglobulin Fc and insulin-secreting peptide or GLP-2 at both ends, specifically, a thiol group of a cysteine in the immunoglobulin Fc region; an amino group located at the N-terminus, lysine, arginine, glutamine and/or histidine; and/or a thiol group of a cysteine of GLP-2 combined with a hydroxyl group located at the C-terminus; amino groups of lysine, arginine, glutamine and/or histidine; azide group of azidolysine; and/or a reactive group capable of bonding to a hydroxyl group, but is not limited thereto.
  • the reactive group of the non-peptidyl polymer may be at least one selected from the group consisting of an aldehyde group, a maleimide group, and a succinimide derivative, but is not limited thereto.
  • a propion aldehyde group or a butyl aldehyde group may be exemplified as the aldehyde group, but the present invention is not limited thereto.
  • succinimidyl carboxymethyl, succinimidyl valerate, succinimidyl methylbutanoate, succinimidyl methylpropionate, succinimidyl butanoate, succinimidyl propionate, N -Hydroxysuccinimide, hydroxy succinimidyl or succinimidyl carbonate may be used, but not limited thereto.
  • the non-peptidyl linker may be connected to a biocompatible material (eg, immunoglobulin Fc) and an insulin-secreting peptide or GLP-2 through the above-described reactive group to be converted into a non-peptidyl polymer linkage.
  • a biocompatible material eg, immunoglobulin Fc
  • an insulin-secreting peptide or GLP-2 through the above-described reactive group to be converted into a non-peptidyl polymer linkage.
  • the final product resulting from reductive alkylation with aldehyde bonds is much more stable than those linked with amide bonds.
  • the aldehyde reactive group selectively reacts with the N-terminus at a low pH, and can form a covalent bond with a lysine residue at a high pH, for example, pH 9.0.
  • the terminal reactive groups of the non-peptidyl linker of the present invention may be the same as or different from each other.
  • the non-peptidyl linker may have an aldehyde group reactive group at the terminal, and the non-peptidyl linker may have an aldehyde group and a maleimide reactive group at the terminal, respectively, or have an aldehyde group and a succinimide reactive group at the terminal, respectively can, but is not limited thereto.
  • it may have a maleimide group at one end and an aldehyde group, propionaldehyde group or butyl aldehyde group at the other end.
  • it may have a succinimidyl group at one end and a propionaldehyde group or a butyl aldehyde group at the other end.
  • the hydroxyl group can be activated into the various reactive groups by a known chemical reaction, or a commercially available polyethylene glycol having a modified reactive group is used. It can be used to prepare the conjugate of the present invention.
  • the reactive group of the non-peptidyl linker may be linked to a cysteine residue of an insulin-secreting peptide or GLP-2, more specifically, a -SH group of cysteine, but is not limited thereto.
  • maleimide-PEG-aldehyde is used, the maleimide group is linked to the -SH group of the insulin-secreting peptide or GLP-2 by a thioether bond, and the aldehyde group is reductively alkylated with the -NH 2 group of immunoglobulin Fc. It may be connected through a reaction, but is not limited thereto, and this corresponds to one example.
  • the N-terminal amino group of the immunoglobulin Fc region is linked to an oxygen atom located at one end of PEG through a linker functional group having a structure of -CH 2 CH 2 CH 2 -, -PEG-O -CH 2 CH 2 CH 2 NH-Can form the same structure as immunoglobulin Fc, and form a structure in which one end of PEG is linked to a sulfur atom located at GLP-2 or cysteine of GLP-2 through a thioether bond.
  • the above-mentioned thioether bond is may contain the structure of
  • the reactive group of the non-peptidyl linker may be linked to -NH 2 located at the N-terminus of the immunoglobulin Fc region, but this corresponds to one example.
  • the insulin-secreting peptide or GLP-2 may be linked to a non-peptidyl linker having a reactive group through the C-terminus, but this corresponds to one example.
  • C-terminal refers to the carboxy terminus of a peptide, and refers to a position capable of binding to a non-peptide polymer for the purpose of the present invention.
  • it may include all amino acid residues around the C-terminus as well as the most terminal amino acid residue at the C-terminus, and specifically include the first to 20th amino acid residues from the most terminal.
  • the conjugate of Formula 1 may have a structure of Formula 2 or 3 below.
  • X is the peptide of Formula 1 described above;
  • F is an immunoglobulin Fc fragment
  • n may be a natural number. In this case, the description of n is the same as described above.
  • the long-acting conjugate of Formula 2 has a structure in which X of the insulin-secreting peptide or GLP-2 and F of the immunoglobulin Fc region are covalently linked through an ethylene glycol repeat, and each X is represented by Formula 2 In the succinimide ring of , F may be linked to an oxypropylene group of Formula 2.
  • the long-acting conjugate of Formula 3 is a structure in which X of the insulin-secreting peptide or GLP-2 and F of the immunoglobulin Fc region are covalently linked through an ethylene glycol repeat, wherein each X is an oxypropylene group of Formula 3 , F may be in a form connected to another oxypropylene group of Formula 3.
  • n is determined such that the average molecular weight of the [OCH 2 CH 2 ]n site in the peptide conjugate, such as a number average molecular weight, is 1 to 100 kDa, or 1 to 20 kDa or 10 kDa. may be, but is not limited thereto.
  • the moiety at which X is connected to the succinimide ring of Formula 2 or the succinimide ring of Formula 2 may be a sulfur atom of the C-terminal cysteine of X.
  • the site at which X is connected to the oxypropylene group of Formula 3 or the oxypropylene group of Formula 3 may be a sulfur atom of the C-terminal cysteine of X.
  • the site connected to the oxypropylene group of Formula 2 or Formula 3 in F is not particularly limited.
  • the moiety of F connected to the oxypropylene group may be an N-terminal nitrogen or a nitrogen atom of an F internal moiety (eg, epsilon nitrogen of lysine).
  • the moiety where F is connected to the oxypropylene group of Formula 2 or Formula 3 may be the N-terminal proline of F, but is not limited thereto.
  • the insulin-secreting peptide, GLP-2, or a long-acting conjugate thereof includes all forms of itself, a salt (eg, a pharmaceutically acceptable salt) thereof, or a solvate thereof.
  • insulin-secreting peptide GLP-2, or a long-acting conjugate thereof may be in any pharmaceutically acceptable form.
  • the type of the salt is not particularly limited. However, it is preferable that the form is safe and effective for an individual, such as a mammal, but is not particularly limited thereto.
  • salts derived from pharmaceutically acceptable inorganic acids, organic acids, or bases include hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, perchloric acid, fumaric acid, maleic acid, phosphoric acid, glycolic acid, lactic acid, salicylic acid, succinic acid, toluene-p-sulfonic acid, tartaric acid, acetic acid, citric acid, methanesulfonic acid, formic acid , benzoic acid, malonic acid, naphthalene-2-sulfonic acid, benzenesulfonic acid, and the like.
  • Salts derived from suitable bases may include alkali metals such as sodium and potassium, alkaline earth metals such as magnesium, and ammonium.
  • solvate refers to a compound in which the peptide, compound, or salt thereof according to the present invention forms a complex with a solvent molecule.
  • the native insulin-secreting peptide and the modified insulin-secreting peptide of the present invention, GLP-2 can be synthesized through a solid phase synthesis method, can also be produced by a recombinant method, and can be commercially commissioned.
  • the combination, pharmaceutical composition, or pharmaceutical kit of the present invention comprises
  • (i) comprises an insulin-secreting peptide and GLP-2;
  • an insulin-secreting peptide long-acting conjugate to which a biocompatible substance capable of increasing the in vivo half-life is bound; and a GLP-2 long-acting conjugate to which a biocompatible material capable of increasing the in vivo half-life is bound.
  • the combination, pharmaceutical composition or pharmaceutical kit of the present invention can be used for the prevention, improvement or treatment of short bowel syndrome.
  • prevention refers to any action that inhibits or delays the onset of a target disease, such as short bowel syndrome, by administration of a combination or composition comprising an insulin-secreting peptide and GLP-2
  • treatment refers to any action of insulin It refers to any action in which the symptoms of a target disease, such as short bowel syndrome, are improved or beneficial by administration of a combination or composition comprising a secreted peptide and GLP-2.
  • improved means any action that at least reduces the severity of a parameter, eg, a symptom, associated with the condition to be treated by administration of a combination or composition of the present invention.
  • the term "administration" means introducing a predetermined substance to a patient by any suitable method, and the route of administration of the composition is not particularly limited thereto, but any general route through which the composition can reach an in vivo target It can be administered through, for example, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, etc. can be .
  • the insulin-secreting peptide and GLP-2 may be used in combination to prevent or treat short bowel syndrome.
  • SBS short bowel syndrome
  • the combination or composition according to the present invention can prevent, ameliorate or treat short bowel syndrome by causing one or more of weight gain, increase in small intestine length, decrease in gastrointestinal motility, and increase in nutrient absorption when administered to a subject.
  • the present invention is not limited thereto.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, excipient or diluent.
  • a pharmaceutically acceptable carrier excipient or diluent.
  • Such pharmaceutically acceptable carriers, excipients, or diluents may be non-naturally occurring.
  • the term "pharmaceutically acceptable” means a sufficient amount to exhibit a therapeutic effect and does not cause side effects, and the type of disease, the patient's age, weight, health, sex, and the patient's sensitivity to the drug , administration route, administration method, frequency of administration, treatment period, combination or drugs used at the same time can be easily determined by those skilled in the art according to factors well known in the medical field.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable excipient.
  • the excipient is not particularly limited thereto, but in the case of oral administration, a binder, a lubricant, a disintegrant, a solubilizer, a dispersing agent, a stabilizer, a suspending agent, a dye, a flavoring agent, etc. may be used, and in the case of an injection, a buffer, a preservative, An analgesic agent, a solubilizer, an isotonic agent, a stabilizer, etc. can be mixed and used, and in the case of topical administration, a base, excipient, lubricant, preservative, etc. can be used.
  • the formulation of the composition of the present invention can be prepared in various ways by mixing with the pharmaceutically acceptable excipients as described above.
  • it may be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like, and in the case of injections, it may be prepared in the form of unit dose ampoules or multiple doses.
  • it can be formulated as a solution, suspension, tablet, pill, capsule, sustained release formulation, and the like.
  • suitable carriers, excipients and diluents for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, Microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or mineral oil may be used.
  • it may further include a filler, an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, a preservative, and the like.
  • the pharmaceutical composition of the present invention is any one selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, internal solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solvents, freeze-dried preparations and suppositories may have the form of
  • composition is formulated in a dosage form suitable for administration in a patient's body according to a conventional method in the pharmaceutical field, specifically, a formulation useful for administration of a protein drug, and administration commonly used in the art.
  • the conjugate can be used by mixing with various pharmaceutically acceptable carriers such as physiological saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran, ascorbic acid (ascorbic acid) to increase stability or absorption acid) or antioxidants such as glutathione, chelating agents, low molecular weight proteins or other stabilizers, etc. may be used as agents.
  • various pharmaceutically acceptable carriers such as physiological saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran, ascorbic acid (ascorbic acid) to increase stability or absorption acid) or antioxidants such as glutathione, chelating agents, low molecular weight proteins or other stabilizers, etc.
  • the dosage and frequency of administration of the pharmaceutical composition of the present invention is determined according to the type of drug as the active ingredient, together with several related factors such as the disease to be treated, the route of administration, the age, sex and weight of the patient, and the severity of the disease. .
  • the composition of the present invention may include the peptide or a long-acting conjugate comprising the same in a pharmaceutically effective amount, but is not limited thereto.
  • the inclusion of the insulin-secreting peptide or GLP-2 in a pharmaceutically effective amount means the degree to which a desired pharmacological activity can be obtained due to the insulin-secreting peptide or GLP-2, and no toxicity or side effects do not occur in the administered subject, or It may mean a pharmaceutically acceptable level as an insignificant level, but is not limited thereto. Such a pharmaceutically effective amount may be determined by comprehensively considering the number of administration, patient, formulation, and the like.
  • the pharmaceutical composition of the present invention may contain the component (active ingredient) in an amount of 0.01 to 99% by weight to volume.
  • the total effective amount of the composition of the present invention may be administered to a patient as a single dose, or may be administered by a fractionated treatment protocol in which multiple doses are administered for a long period of time.
  • the pharmaceutical composition of the present invention may vary the content of the active ingredient according to the severity of the disease.
  • the preferred total dose of the peptide or conjugate of the present invention may be about 0.0001 mg to 500 mg per 1 kg of the patient's body weight per day, but is not limited thereto.
  • the dosage of the conjugate is determined by considering various factors such as the age, weight, health status, sex, severity of disease, diet and excretion rate of the patient, as well as the administration route and number of treatments of the pharmaceutical composition, and the effective dosage for the patient is determined.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route and administration method as long as the effect of the present invention is exhibited.
  • the pharmaceutical composition of the present invention has excellent in vivo persistence and potency, and can significantly reduce the number and frequency of administration of the pharmaceutical preparation of the present invention, but is not limited thereto.
  • Another aspect embodying the present invention provides a pharmaceutical composition for preventing, improving or treating short bowel syndrome, comprising the insulin-secreting peptide, characterized in that it is used in combination with GLP-2.
  • the insulin-secreting peptide, GLP-2, prevention, treatment, improvement, combination, short bowel syndrome and pharmaceutical composition are as described above.
  • Another embodiment of the present invention provides a food composition for preventing or improving short bowel syndrome containing an insulin-secreting peptide, wherein the insulin-secreting peptide is administered in combination with GLP-2.
  • the insulin-secreting peptide, GLP-2, prevention, improvement, combination, and short bowel syndrome are the same as described above.
  • the food composition may be used as a health functional food.
  • the composition of the present invention is used as a food additive, the insulin-secreting peptide, GLP-2, a long-acting conjugate comprising the same, or a combination thereof can be added as it is or used with other foods or food ingredients, and can be used in a conventional method. can be used appropriately.
  • the mixing amount of the active ingredient may be appropriately determined according to the purpose of use (prevention, health or therapeutic treatment).
  • the term "health functional food” refers to a food manufactured and processed by extracting, concentrating, refining, mixing, etc., a specific ingredient as a raw material or a specific ingredient contained in a food raw material for the purpose of health supplementation, It refers to a food designed and processed to sufficiently exert biological control functions such as biological defense, regulation of biological rhythm, prevention and recovery of disease, etc., by the above ingredients, and the composition for health food is used for prevention of diseases and prevention of diseases. It can perform functions related to recovery, etc.
  • Another aspect embodying the present invention provides a method for preventing, improving or treating short bowel syndrome, comprising administering an insulin-secreting peptide and GLP-2 to an individual in need thereof.
  • it may be a method for preventing, improving or treating short bowel syndrome, comprising administering and/or using the combination, pharmaceutical composition, or pharmaceutical kit of the present invention to an individual in need thereof.
  • compositions containing a pharmaceutically effective amount of an insulin-secreting peptide, and a composition containing a pharmaceutically effective amount of GLP-2 comprising the step of co-administering and/or using the composition to an individual in need thereof
  • a method for preventing, improving or treating short bowel syndrome comprising the step of co-administering and/or using the composition to an individual in need thereof
  • the insulin-secreting peptide, GLP-2, prevention, treatment, improvement, short bowel syndrome, combination, combination, pharmaceutical composition and pharmaceutical kit are as described above.
  • the subject is a subject suspected of short bowel syndrome
  • the subject suspected of short bowel syndrome refers to mammals including rats, livestock, etc. including humans that have or may develop the disease, but with the composition of the present invention. Treatable subjects are included without limitation.
  • the composition of the present invention to a subject suspected of short bowel syndrome disease, the subject can be efficiently treated.
  • Short bowel syndrome is the same as described above.
  • the method of the present invention may comprise administering a combination or pharmaceutical composition comprising an insulin secreting peptide and GLP-2 in a pharmaceutically effective amount.
  • the method according to the present invention may include, but is not limited to, administering the insulin-secreting peptide and GLP-2 as a single agent, or administering the separate agents simultaneously, separately, sequentially or in reverse order.
  • a suitable total daily amount may be determined by a treating physician within the scope of sound medical judgment, and may be administered once or divided into several doses.
  • a specific therapeutically effective amount for a particular patient depends on the type and extent of the response to be achieved, the specific composition, including whether other agents are used, if necessary, the specific composition, the patient's age, weight, general health, It is preferable to apply differently depending on various factors including sex and diet, administration time, administration route and secretion rate of the composition, treatment period, drugs used together or concurrently with a specific composition, and similar factors well known in the pharmaceutical field.
  • Another aspect embodying the present invention is the use of the combination, pharmaceutical composition, or pharmaceutical kit for the prevention, improvement or treatment of short bowel syndrome, and/or for the preparation of a medicament for the prevention or treatment of short bowel syndrome. is the use
  • CA-Exendin4 N-[2-(1H-Imidazol-5-yl)acetyl]-Exendin4, Hanmi Fine Chemicals, Korea) having an amine group at the 27th lysine residue in the peptide and an aldehyde group at both ends
  • a peptide conjugate (mono-PEGylated CA-Exendin-4) PEGylated through a covalent bond between polyethylene glycol (3.4 kDa, ALD(2) PEG, Hanmi Fine Chemical, Korea) was prepared.
  • the molar ratio of CA-Exendin-4: ALD(2) PEG is 1:5 to 1:15
  • the concentration of CA-Exendin-4 is 6 to 12 mg/ml
  • at 4 to 10°C to room temperature about It was made to react for 4 to 12 hours.
  • the reaction was carried out in 0.1 M HEPES pH 7.0 to 8.5, about 45% isopropanol, and sodium cyanoborohydride (NaCNBH 3 ) at a concentration of 2 to 50 mM was added and reacted.
  • the reaction solution was purified using a Source 15S (Cytiva, USA) column using a buffer containing sodium citrate (pH 2.0 to 3.5), about 45% ethanol, and a potassium chloride concentration gradient.
  • CA-Exendin-4-PEG-Fc conjugate In order to prepare a CA-Exendin-4-PEG-Fc conjugate, an immunoglobulin Fc fragment was added to the mono-pegylated CA-Exendin-4 obtained in Example 1-1 to increase the total protein concentration to 10-50 mg/ ml, and then reacted for about 12 to 17 hours at 4 to 10 °C to room temperature. At this time, the reaction solution was 0.1 M potassium phosphate pH 5.5 to 8.5, and 2 to 50 mM sodium cyanoborohydride as a reducing agent was added. After completion of the reaction, the CA-Exendin-4-PEG-Fc conjugate in the reaction solution was purified using two types of hydrophobic bonding and anion exchange columns.
  • Source 15Phenyl which is a hydrophobic binding column
  • unreacted immunoglobulin Fc fragments were isolated and purified using Tris-HCl (pH 7.5) buffer and NaCl concentration gradient
  • Source 15Q (Cytiva, USA)
  • the CA-Exendin-4-PEG-Fc conjugate was isolated and purified by removing the over-reacted impurities using a Tris-HCl (pH 7.5) buffer and a NaCl concentration gradient.
  • the GLP-2 derivative CA GLP-2 RK of SEQ ID NO: 4 in Table 1 is modified polyethylene glycol ALD (2) PEG (hydrogens at both ends are substituted with propionaldehyde groups (3-oxopropyl groups), respectively, and ethylene glycol repeating units For pegylation with modified polyethylene glycol having a moiety formula weight of 3.4 kDa, NOF, Japan), the molar ratio of the GLP-2 derivative and ALD(2) PEG was 1:5 to 1:20, GLP-2 The concentration of the derivative was 5 to 10 mg/ml, and the reaction was carried out at 2 to 8° C. for 4 to 16 hours.
  • reaction was made in 20 mM HEPES (HEPES) pH 7.5 and ethanol, and 20 mM sodium cyanoborohydride as a reducing agent was added to the reaction.
  • the reaction solution was a monopegylated GLP-2 derivative was purified using a Source 15S (GE, USA) column using a buffer solution containing sodium citrate pH 2.0, ethanol, and a concentration gradient of potassium chloride.
  • the molar ratio of the purified monopegylated GLP-2 derivative to the immunoglobulin Fc fragment is 1:2 to 1:6, and the total protein concentration is 30 to 35 mg/mL and heated at 2 to 8°C.
  • the reaction was carried out for 12 to 20 hours.
  • 20 mM sodium cyanoborohydride as a reducing agent was added to the reaction solution in 100 mM potassium phosphate buffer (pH 6.0) and isopropanol.
  • the reaction solution was applied to a Source 15Q (GE, USA) column using a bis-Tris pH 6.5 buffer and a sodium chloride concentration gradient, and a concentration gradient of ammonium sulfate and sodium citrate pH 5.0 to 5.2 was applied to Source 15 ISO (GE, USA), and a long-acting conjugate of the GLP-2 derivative, which is a conjugate in which the GLP-2 derivative is covalently linked to an immunoglobulin Fc fragment by a polyethylene glycol linker, was purified.
  • Source 15Q GE, USA
  • Example 3 Confirmation of increase in mouse body weight and small intestine length by co-administration of GLP-1 derivative long-acting conjugate and GLP-2 derivative long-acting conjugate
  • mice were used to measure the effect of improving in vivo body weight and small intestine length following the co-administration of the GLP-1 derivative long-acting conjugate and the GLP-2 derivative long-acting conjugate. Specifically, 7-week-old male mice (C57BL/6) were divided into 5 mice per group as follows:
  • GLP-1 derivative long-acting conjugate 0.039 mg/kg/Q2D
  • GLP-1 derivative long-acting conjugate 0.039 mg/kg/Q2D, 2 weeks
  • G3 group administered with GLP-2 derivative long-acting conjugate (0.889 mg/kg/Q2D) (GLP-2 derivative long-acting conjugate 0.889 mg/kg/Q2D, 2 weeks);
  • GLP-1 derivative long-acting conjugate 0.039 mg/kg/Q2D
  • GLP-2 derivative long-acting conjugate 0.889 mg/kg/Q2D
  • 2 weeks GLP-1 derivative long-acting conjugate 0.039 mg/ kg/Q2D + GLP-2 derivative long-acting conjugate 0.889 mg/kg/Q2D
  • the numerical value expressed as the dose of the GLP-1 derivative long-acting conjugate or the GLP-2 derivative long-acting conjugate is the polyethylene glycol linker site in the total mass of the GLP-1 derivative long-acting conjugate or GLP-2 derivative long-acting conjugate used. It is a numerical value excluding the mass of , that is, a numerical value expressed based on the sum of the masses of only the polypeptide regions.
  • mice The weight of the mice was observed while repeating administration for 2 weeks (D0 to D14: the first day the drug was administered is designated as day 0). Thereafter, the length of the small intestine was measured through an autopsy at D14.
  • Example 4 Decreased gastrointestinal motility by co-administration of a GLP-1 derivative long-acting conjugate and a GLP-2 derivative long-acting conjugate
  • mice were used to measure the effect of co-administration of the GLP-1 derivative long-acting conjugate and the GLP-2 derivative long-acting conjugate to reduce gastrointestinal motility in vivo .
  • 7-week-old male mice (C57BL/6) were divided into 6 mice per group as follows:
  • GLP-1 derivative long-acting conjugate (0.136 mg/kg) (GLP-1 derivative long-acting conjugate 0.136 mg/kg);
  • GLP-1 derivative long-acting conjugate (0.136 mg/kg) and GLP-2 derivative long-acting conjugate (3.111 mg/kg) administered group (GLP-1 derivative long-acting conjugate 0.136 mg/kg + GLP-2) Derivative long-acting conjugate 3.111 mg/kg).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Vascular Medicine (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Diabetes (AREA)
  • Child & Adolescent Psychology (AREA)
  • Nutrition Science (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 단장증후군의 예방, 개선 또는 치료를 위한 인슐린 분비 펩타이드 및 GLP-2의 병용 요법에 관한 것이다.

Description

단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 GLP-2의 병용 요법
본 발명은 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 GLP-2의 병용 요법에 관한 것이다.
단장증후군(short bowel syndrome, SBS)는 선천적으로 소장의 길이가 짧거나 또는 수술 등으로 인해 후천적으로 소장의 일정 비율 이상이 소실(소장의 흡수면적 감소)되어 발생하는 소화흡수불량증으로서, 영양 흡수 부족, 영양 흡수 장애, 복통, 설사, 지방변, 유당불내증, 탈수, 체중 감소, 무기력, 피로 등의 증상이 나타날 수 있다.
글루카곤 유사 펩타이드-2(GLP-2)는 섭취된 영양분에 반응하여 소장의 L-세포에서 생성되는 33개의 아미노산으로 구성된 펩타이드 호르몬이다. GLP-2는 소장, 대장에서 점막 성장을 유도하고, 장세포와 crypt 세포의 성장 촉진 및 세포사멸(apoptosis)을 억제한다. 또한 GLP-2는 소장에서 영양분의 흡수를 증가시키고 장 투과성을 감소시킨다. 위 배출(Gastric emptying) 및 위산 분비를 억제하고, 장 혈류 속도를 증가시키고, 장평활근을 이완시킨다. 또한, GLP-2는 단장증후군을 갖는 설치류 실험모델에서 영양 흡수 및 소화관 흡수를 증진시키는 것이 보고되었다(Ljungmann K et al., Am. J. Physiol. Gastrointest Liver Physiol., 2001, 281(3):G779-85).
한편, 인슐린 분비 펩타이드의 일종인 글루카곤 유사 펩타이드-1(Glucagon like peptide 1, GLP-1)은 회장과 대장의 L-세포에서 분비되는 인크레틴(incretin) 호르몬이다. GLP-1의 주요한 작용은 인슐린 분비를 증가시키며, 포도당의 농도에 따른 인슐린 분비(Glucose dependent secretion)가 이루어져 저혈당이 발생하지 않는다. 이런 특징으로 제 2형 당뇨병의 치료방법으로 적용되나, 혈중 반감기가 2분 내외로 매우 짧기 때문에 약제로 개발하는데 큰 제약을 갖고 있다. 이에 따라 개발되어 시판되는 GLP-1 작용제로서는 글리아 몬스터 도마뱀(glia monster)의 침샘으로부터 정제된 GLP-1 유사체인 엑센딘-4(Exendin-4)가 있다. 이는 DPP-IV(Dipeptidyl peptidase-4)에 대한 저항성과 함께 GLP-1 보다 높은 생리 활성을 가지며, 따라서 체내 반감기가 2-4시간으로 GLP-1에 비해 길어진 체내 반감기를 가진다(US 5,424,286). 그러나 DPP-IV의 저항성을 증가시키는 방법만으로는 충분한 생리활성의 지속기간을 기대할 수 없는데, 예를 들어 현재 시판되고 있는 엑센딘-4(엑세나티드, exenatide)의 경우 환자에게 하루 2회 주사를 통해 투여되어야 하며, 투여에 따른 구토유발 및 메스꺼움 현상이 환자에게 큰 부담으로 작용되는 단점이 여전히 남아있다.
현재까지 GLP-2를 이용한 단장증후군 치료제 개발은 미비한 상태인바, 지속적인 치료제 개발의 필요성이 있다.
본 발명의 하나의 목적은 인슐린 분비 펩타이드 및 GLP-2(Glucagon-like peptide-2, GLP-2)를 병용하는 단장증후군(short bowel syndrome)의 예방, 개선 또는 치료를 위한 요법을 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 GLP-2와 병용 투여되는 것을 특징으로 하는 약학적 조성물을 제공하는 것이다.
본 발명의 또 하나의 목적은 GLP-2를 함유하는 단장증후군의 예방 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 하는 약학적 조성물을 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 분비 펩타이드 및 GLP-2를 포함하는, 조합물을 제공하는 것이다.
본 발명의 또 하나의 목적은 상기 조합물을 포함하는, 단장증후군의 예방, 개선 또는 치료를 위한 약학적 조성물을 제공하는 것이다.
본 발명의 또 하나의 목적은 인슐린 분비 펩타이드 및 GLP-2를 포함하는, 단장증후군의 예방, 개선 또는 치료를 위한 약학적 키트를 제공하는 것이다.
본 발명의 또 하나의 목적은 상기 조합물, 약학적 조성물, 또는 약학적 키트를 이를 필요로 하는 개체에 투여 및/또는 사용하는 단계를 포함하는, 단장증후군의 예방, 개선 또는 치료 방법을 제공하는 것이다.
본 발명의 또 하나의 목적은 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 조성물, 및 약학적 유효량의 GLP-2를 함유하는 조성물을 이를 필요로 하는 개체에 병용 투여 및/또는 병용 사용하는 단계를 포함하는, 단장증후군의 예방, 개선 또는 치료 방법을 제공하는 것이다.
본 발명의 또 하나의 목적은 상기 조합물, 약학적 조성물, 또는 약학적 키트의 단장증후군의 예방, 개선 또는 치료 용도, 및/또는 단장증후군의 예방, 개선 또는 치료를 위한 약제의 제조를 위한 용도를 제공하는 것이다.
본 발명을 구현하는 하나의 양태는 인슐린 분비 펩타이드 및 GLP-2를 병용하는 단장증후군의 예방, 개선 또는 치료를 위한 요법이다.
본 발명을 구현하는 하나의 양태는 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 조성물로서, 상기 인슐린 분비 펩타이드는 GLP-2와 병용 투여되는 것을 특징으로 하는 조성물이다.
하나의 구체예로서, 본 발명은 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 GLP-2와 병용 투여되는 것을 특징으로 한다.
다른 하나의 구체예로서, 본 발명은 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방 또는 개선을 위한 식품 조성물로서, 상기 식품 조성물은 GLP-2와 병용 투여되는 것을 특징으로 한다.
본 발명을 구현하는 하나의 양태는 GLP-2를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 조성물로서, 상기 GLP-2는 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 하는 조성물이다.
하나의 구체예로서, 본 발명은 약학적 유효량의 GLP-2를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 한다.
다른 하나의 구체예로서, 본 발명은 GLP-2를 함유하는 단장증후군의 예방 또는 개선을 위한 식품 조성물로서, 상기 식품 조성물은 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 인슐린 분비 펩타이드는 글루카곤 유사 펩타이드-1(Glucagon-like peptide-1, GLP-1), 엑센딘-3, 엑센딘-4, 이들의 작용제(agonist), 유도체, 단편, 변이체, 및 이들의 조합으로 구성되는 군으로부터 선택되는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 인슐린 분비 펩타이드는 인슐린 분비 펩타이드의 N-말단 히스티딘 잔기가 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘으로 치환된 인슐린 분비 펩타이드 유도체인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 인슐린 분비 펩타이드는 천연형 엑센딘-4, 엑센딘-4의 N-말단 첫 번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 제거된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 하이드록실기로 치환된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 2개의 메틸기로 수식된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 카복실기로 치환된 엑센딘-4 유도체, 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 유도체, 또는 엑센딘-4의 열두 번째 아미노산(라이신)이 아르으로 치환된 엑센딘-4 유도체인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2는 천연형 GLP-2 또는 GLP-2 유도체인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 천연형 GLP-2 서열에서 적어도 하나의 아미노산에 치환(substitution), 추가(addition), 제거(deletion), 수식(modification) 및 이들의 조합으로 이루어지는 군에서 선택된 변형이 일어난 GLP-2 유도체인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 약학적 조성물로서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 33번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 하기 일반식 1로 표시되는 아미노산 서열을 포함하는 것을 특징으로 한다:
[일반식 1]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신 또는 시스테인이고;
다만, 일반식 1의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 제외한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는
(1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,
(2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,
(3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,
(4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,
(5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,
(6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는
(7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 하기 일반식 2로 표시되는 아미노산 서열을 포함하는 것을 특징으로 한다:
[일반식 2]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산이고;
다만, 일반식 2의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 제외한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 GLP-2 유도체는 서열번호 2 내지 8로 이루어진 군으로부터 선택된 아미노산 서열의 펩타이드인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 조성물은 개체에 투여 시 체중 증가, 소장 길이 증가, 위장관 운동성 감소, 및 영양분 흡수 증가 중 하나 이상을 야기하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 인슐린 분비 펩타이드 및 GLP-2는 이의 C-말단이 변형되지 않았거나 아미드화된 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, (i) 상기 인슐린 분비 펩타이드는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
(ii) 상기 GLP-2는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
(iii) 상기 인슐린 분비 펩타이드 및 GLP-2 각각은 이들의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 결합체는 하기 화학식 1로 표시되는 것을 특징으로 한다:
[화학식 1]
X - La - F
여기서,
X는 인슐린 분비 펩타이드 또는 GLP-2이고;
L은, 에틸렌글리콜 반복 단위를 함유하는 링커이며;
a는, 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;
F는, 면역글로불린 Fc 영역이며;
상기 "-"는 공유결합이다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 면역글로불린 Fc 영역은 비당쇄화된 IgG4 Fc 영역인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 F는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 개의 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 L은 폴리에틸렌글리콜인 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 L 내의 에틸렌글리콜 반복 단위 부위의 화학식량은 1 내지 100 kDa 범위에 있는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 조성물은 약학적으로 허용가능한 담체, 부형제 또는 희석제를 추가로 포함하는 것을 특징으로 한다.
앞선 구체예 중 어느 하나에 따른 조성물로서, 상기 인슐린 분비 펩타이드를 함유하는 조성물은 GLP-2를 함유하는 조성물과 동시에, 순차적으로 또는 역순으로 병용 투여되는 것을 특징으로 한다.
본 발명을 구현하는 다른 하나의 양태는, 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물이다.
본 발명을 구현하는 다른 하나의 양태는, 상기 조합물을 포함하는, 단장증후군의 예방, 개선 또는 치료용 약학적 조성물이다.
본 발명을 구현하는 다른 하나의 양태는, 상기 조합물을 포함하는, 단장증후군의 예방, 개선 또는 치료용 약학적 키트이다.
본 발명을 구현하는 다른 하나의 양태는, 상기 조합물, 약학적 조성물, 또는 약학적 키트를 이를 필요로 하는 개체에 투여 및/또는 사용하는 단계를 포함하는 단장증후군의 예방, 개선 또는 치료 방법이다.
본 발명을 구현하는 다른 하나의 양태는, 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 조성물, 및 약학적 유효량의 GLP-2를 함유하는 조성물을 이를 필요로 하는 개체에 병용 투여 및/또는 병용 사용하는 단계를 포함하는 단장증후군의 예방, 개선 또는 치료 방법이다.
본 발명을 구현하는 다른 하나의 양태는, 상기 조합물, 약학적 조성물, 또는 약학적 키트의 단장증후군의 예방, 개선 또는 치료 용도, 및/또는 단장증후군의 예방 또는 치료를 위한 약제의 제조를 위한 용도이다.
본 발명에 따른 인슐린 분비 펩타이드 및 GLP-2의 병용 투여 요법은 단일 투여 요법에 비해 향상된 효과를 가져서 단장증후군의 예방, 개선 또는 치료에 유용하게 사용할 수 있다.
도 1은 인슐린 분비 펩타이드(GLP-1 유도체 지속형 결합체) 및 GLP-2(GLP-2 유도체 지속형 결합체)의 병용 투여에 따른 마우스의 체중 변화를 나타낸 도이다.
도 2는 인슐린 분비 펩타이드(GLP-1 유도체 지속형 결합체) 및 GLP-2(GLP-2 유도체 지속형 결합체)의 병용 투여에 따른 마우스의 소장 길이 변화를 나타낸 도이다.
도 3은 인슐린 분비 펩타이드(GLP-1 유도체 지속형 결합체) 및 GLP-2(GLP-2 유도체 지속형 결합체)의 병용 투여에 따른 위장관 운동성 변화를 나타낸 도이다.
이하에서는, 본 발명을 더욱 상세히 설명한다.
한편, 본원에서 개시되는 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본원에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술되는 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 할 수 없다.
또한, 당해 기술분야의 통상의 지식을 가진 자는 통상의 실험만을 사용하여 본 출원에 기재된 본 발명의 특정 양태에 대한 다수의 등가물을 인지하거나 확인할 수 있다. 또한, 이러한 등가물은 본 발명에 포함되는 것으로 의도된다.
본 명세서 전반을 통하여, 천연적으로 존재하는 아미노산에 대한 통상의 1문자 및 3문자 코드가 사용될 뿐만 아니라 Aib(2-aminoisobutyric acid), AZK(6-azidolysine) 등과 같은 다른 아미노산에 대해 일반적으로 허용되는 3문자 코드가 사용된다. 또한 본 명세서에서 약어로 언급된 아미노산은 IUPAC-IUB 명명법에 따라 기재되었다.
알라닌 Ala, A 아르지닌 Arg, R
아스파라긴 Asn, N 아스파르트산 Asp, D
시스테인 Cys, C 글루탐산 Glu, E
글루타민 Gln, Q 글라이신 Gly, G
히스티딘 His, H 이소류신 Ile, I
류신 Leu, L 라이신 Lys, K
메티오닌 Met, M 페닐알라닌 Phe, F
프롤린 Pro, P 세린 Ser, S
트레오닌 Thr, T 트립토판 Trp, W
티로신 Tyr, Y 발린 Val, V
본 발명을 구현하는 하나의 양태는 인슐린 분비 펩타이드를 함유하는 단장증후군(short bowel syndrome, SBS)의 예방, 개선 또는 치료를 위한 약학적 조성물로서, 상기 인슐린 분비 펩타이드는 글루카곤 유사 펩타이드-2(Glucagon-like peptide-2, GLP-2)와 병용 투여되는 것을 특징으로 하는 약학적 조성물을 제공한다.
본 발명의 하나의 구체예에서, 상기 약학적 조성물은 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 GLP-2(예컨대, 약학적 유효량의 GLP-2)와 병용 투여되는 것을 특징으로 할 수 있으나, 이에 제한되지 않는다.
본 발명을 구현하는 또 하나의 양태는 GLP-2를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 약학적 조성물로서, 상기 GLP-2는 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 하는 약학적 조성물을 제공한다.
본 발명의 하나의 구체예에서, 상기 약학적 조성물은 약학적 유효량의 GLP-2를 함유하는 단장증후군의 예방, 개선 또는 치료를 위한 약학적 조성물로서, 상기 약학적 조성물은 인슐린 분비 펩타이드(예컨대, 약학적 유효량의 인슐린 분비 펩타이드)와 병용 투여되는 것을 특징으로 할 수 있으나, 이에 제한되지 않는다.
본 발명의 하나의 구체예는 상기 병용 투여는 (i) 인슐린 분비 펩타이드와 함께 GLP-2를 혼합물의 형태 또는 별개의 분리된 형태로 더 포함하는 약학적 조성물을 이용하여 병용 투여하거나, 또는 (ii) 상기 인슐린 분비 펩타이드를 함유하는 약학적 조성물을 GLP-2를 함유하는 별개의 약학적 조성물과 동시, 순차적 또는 역순으로 병용 투여하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명의 또 하나의 양태는 인슐린 분비 펩타이드 및 GLP-2를 병용하는 단장증후군의 예방, 개선 또는 치료 용도를 제공한다.
또 하나의 구체예는 인슐린 분비 펩타이드 및 GLP-2를 병용하는 단장증후군의 예방, 개선 또는 치료용 약학적 조성물을 제공한다.
구체적으로, 본 발명의 일 양태는 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물, 약학적 조성물, 또는 약학적 키트를 제공한다. 일 구체예로, 단장증후군의 예방, 개선 또는 치료용 조합물, 약학적 조성물, 또는 약학적 키트를 제공한다.
본 발명에서 용어 "조합물(combination)"은 인슐린 분비 펩타이드 및 GLP-2의 병용 투여 용도를 갖는 것으로, "병용 용도(combined used)"와 같은 의미로 이해될 수 있다. 이는 인슐린 분비 펩타이드 및 GLP-2가 병용되는 것을 특징으로 하는 약학적 조성물 및 약학적 키트 형태도 포함하나, 이에 제한되지 않는다.
상기 조합물은
a) 인슐린 분비 펩타이드 및 GLP-2가 혼합된 하나의 혼합물(mixture)로 투여되는 것이거나; 또는
b) 인슐린 분비 펩타이드 및 GLP-2가 분리된 형태로 투여되는 것일 수 있으나, 이에 제한되지 않는다.
인슐린 분비 펩타이드 및 GLP-2가 분리된 형태일 경우, 인슐린 분비 펩타이드 및 GLP-2 각각이 별개의 제제로 제제화되어, 별개의 제제가 동시, 개별, 순차, 또는 역순으로 투여될 수 있다.
본 발명에서, "병용 투여", "병용되는", 또는 "병용하는"은 단지 동시의 투여를 의미하는 것뿐만이 아니라, 인슐린 분비 펩타이드 및 GLP-2가 개체에 함께 작용하여 각 물질이 본연의 기능과 동등하거나 그 이상의 수준을 수행할 수 있는 투여 형태로 이해되어야 한다. 따라서, 본원에서, "병용"이란 용어가 사용될 경우 이는 동시, 개별, 순차, 또는 역순 투여를 나타내는 것으로 그 순서가 무제한인 것으로 이해되어야 한다. 상기 투여가 순차, 역순 또는 개별적인 경우, 투여의 순서는 특별히 제한되지 않고 다만 2차 성분 투여의 간격은 상기 병용의 이로운 효과를 잃지 않도록 하는 것이어야 한다.
본 발명에서 용어 "조합물을 포함하는 조성물(composition)"은 상기 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물 그 자체이거나, 이를 포함하고, 치료학적 용도를 갖는 것일 수 있으나, 이에 제한되지 않는다. 그 예로, 단장증후군의 예방, 개선 또는 치료 용도를 갖는 것일 수 있으나, 이에 제한되지 않는다. 본원에서 "조합물을 포함하는 조성물"은 "조성물"과 상호 교환적으로 사용될 수 있다.
본 발명에 따른 조합물을 포함하는 조성물은 인슐린 분비 펩타이드 및 GLP-2를 병용 투여하기 위한 것으로, 인슐린 분비 펩타이드 및 GLP-2가 하나의 제제로 제제화된 것이거나, 또는 개별적으로 제제화된 것일 수 있다. 구체적으로, 인슐린 분비 펩타이드 및 GLP-2를 동시, 개별, 순차, 또는 역순으로 투여하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서 용어 "키트"는 인슐린 분비 펩타이드 및 GLP-2를 병용 투여하기 위해, 본 발명에 따른 조합물 또는 조성물을 포함하는 것일 수 있다. 구체적으로, 본 발명에 따른 키트에는 하나의 제제로 제제화된 인슐린 분비 펩타이드와 GLP-2; 또는 인슐린 분비 펩타이드 및 GLP-2 각각의 개별 제제를 포함하는 것일 수 있고, 두 물질의 병용 투여에 필요한 물질을 추가적으로 포함하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명은 인슐린 분비 펩타이드에 GLP-2를 추가로 포함하여 병용하여 사용할 경우, 인슐린 분비 펩타이드 단독에 비해 단장증후군의 예방, 개선 또는 치료 효과가 획기적으로 증가되는 것을 확인하여 상기 병용 사용 요법을 제공하게 되었다.
상기 "인슐린 분비 펩타이드"는 인슐린 분비 기능을 보유한 펩타이드를 의미하며, 췌장 베타세포의 인슐린의 합성 또는 발현을 자극할 수 있다. 상기 인슐린 분비 펩타이드는 그 예로, GLP-1(Glucagon like peptide-1), 엑센딘-3 (exendin-3) 또는 엑센딘-4(exendin-4)일 수 있으나, 이에 제한되지 않는다. 상기 인슐린 분비 펩타이드는 천연형 인슐린 분비 펩타이드뿐만 아니라, 그의 전구물질(precursors), 작용제(agonist), 유도체(derivatives), 단편(fragments) 및 변이체(variants) 등을 포함하며, 또한 이들의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된 지속형 결합체의 형태도 포함한다. 상기 인슐린 분비 펩타이드는 약학적 유효량으로 약학적 조성물에 포함될 수 있다.
GLP-1은 소장에서 분비되는 호르몬으로서 일반적으로 인슐린 생합성 및 분비를 촉진하고 글루카곤 분비를 억제하며 세포 내 글루코스 흡수를 촉진한다. 소장에서 글루카곤 전구체는 3개의 펩타이드로 분해되는데, 글루카곤, GLP-1, GLP-2이다. 여기서 GLP-1 은 GLP-1(1-37)을 의미하며 인슐린 분비기능이 없는 형태이고, GLP-1(7-37) 형태로 프로세싱되어 활성형 GLP-1(7-37)이 된다. GLP-1(7-37) 아미노산 서열은 아래와 같다.
GLP-1(7-37):
HAEGT FTSDV SSYLE GQAAK EFIAW LVKGR G (서열번호 32)
엑센딘-3과 엑센딘-4는, GLP-1과 53%의 아미노산 서열 유사성을 보이는 39 개 아미노산으로 이루어진 GLP-1 유사체 또는 유도체로서, 인슐린분비 펩타이드에 해당한다. 엑센딘-3과 엑센딘-4의 아미노산서열은 아래와 같다.
엑센딘-3:
HSDGT FTSDL SKQME EEAVR LFIEW LKNGG PSSGA PPPS (서열번호 33)
엑센딘-4:
HGEGT FTSDL SKQME EEAVR LFIEW LKNGG PSSGA PPPS (서열번호 34)
인슐린 분비 펩타이드 유도체는, 인슐린 분비 기능을 가지며, 천연형 인슐린 분비 펩타이드와 아미노산 서열에서 적어도 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 이상의 상동성 또는 동일성을 보이는 것일 수 있고/있거나, 인슐린 분비 펩타이드의 아미노산 한 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation), 제거(예; deamination) 또는 수식(예; N-methylation) 된 형태일 수 있으나, 이에 제한되는 것은 아니다.
하나의 구체적인 실시 형태에서 본 발명의 인슐린 분비 펩타이드 유도체는 N-말단 히스티딘의 알파 아미노기를 제거하는 방법, N-말단 아미노기를 하이드록실(hydroxyl)기 또는 카복실(carboxyl)기로 치환하여 합성하는 방법, N-말단 히스티딘의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기를 제거하여 이미다조-아세틸(imidazo-acetyl) 작용기만을 남겨두는 방법, N-말단 아미노기를 2개의 메틸기로 수식하는 방법 등을 통해 제조될 수 있다. 상기 방법을 통해 제조된 인슐린 분비 펩타이드 유도체는 인슐린 분비 펩타이드의 N-말단 히스티딘 잔기가 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘으로 치환된 인슐린 분비 펩타이드 유도체일 수 있다.
하나의 구체적인 예로서, 인슐린분비 펩타이드 유도체는 GLP-1 유도체일 수 있고, GLP-1 유도체는 엑센딘-3, 엑센딘-4, 또는 이들의 유도체를 포함하나, 이에 제한되지 않는다.
또한, 인슐린분비 펩타이드 유도체의 예로 엑센딘-4의 N-말단 아미노기 또는 아미노산 잔기를 화학적으로 변이시킨 유도체일 수 있으며, 엑센딘-4의 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딜 엑센딘-4 (imidazoacetyl-deshistidyl-exendin-4, CA-exendin-4), 엑센딘-4의 N-말단 아미노기가 제거된 데스아미노히스티딜 엑센딘-4(desaminohistidyl exendin-4, DA-exendin-4), 엑센딘-4의 N-말단 아미노기가 하이드록실기로 치환된 베타-히드록시이미다조프로피온일데스히스티딜 엑센딘-4(β-hydroxyimidazopropionyldeshistidyl exendin-4, HY-exendin-4), 엑센딘-4의 N-말단 아미노기가 2개의 메틸기로 수식된 N-디메틸히스티딜 엑센딘-4(N-dimethylhistidyl exendin-4, DM-exendin-4), 또는 엑센딘-4의 N-말단 아미노기가 카복실기로 치환된 베타-카복시이미다조프로피온일데스히스티딜-엑센딘-4(β-carboxyimidazopropionyl-deshistidyl exendin-4, CX-exendin-4), 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 유도체, 또는 엑센딘-4의 열두 번째 아미노산(라이신)이 아르지닌으로 치환된 엑센딘-4 유도체일 수 있으나, 이에 제한되지 않는다.
인슐린 분비 펩타이드 단편은, 천연형 인슐린 분비 펩타이드의 N-말단 또는 C-말단에 하나 이상의 아미노산이 제거 및/또는 추가된 형태를 의미하며, 추가된 아미노산은 천연에 존재하지 않는 아미노산(예; D형 아미노산)도 가능하다.
인슐린 분비 펩타이드 변이체는, 천연형 인슐린 분비 펩타이드와 아미노산이 하나 이상 다른 펩타이드로서, 적어도 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 이상의 상동성 또는 동일성을 보이며, 인슐린 분비기능을 보유한 펩타이드를 의미한다.
인슐린 분비 펩타이드 작용제는 인슐린 분비 펩타이드의 구조와 상관없이 인슐린 분비 펩타이드의 생체 내 수용체에 결합하여 인슐린 분비 펩타이드와 동일한 생물학적 활성을 나타내는 물질을 의미한다.
본 발명의 유도체, 단편, 변이체 및 작용제에서 각각 사용된 제조방법은 독립적으로 사용될 수 있고 조합도 가능하다. 예를 들어 아미노산 서열이 하나 이상 다르고 N-말단 아미노산 잔기에 탈아미노화(deamination)된 인슐린 분비 펩타이드도 본 발명에 포함한다.
본 발명에서 용어 “글루카곤 유사 펩타이드-2” 또는 "GLP-2(Glucagon-like peptide-2)"는 글루카곤 유사 펩타이드-2 수용체의 작용제(agonist)로서, 폴리펩타이드 형태 또는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된 지속형 결합체의 형태일 수 있으나, 이에 제한되지 않는다. 본 발명에서, 글루카곤 유사 펩타이드-2 또는 GLP-2라고 가리킬 때에는 천연형 사람 GLP-2와 일치하는 서열뿐만 아니라, GLP-2 유도체도 포함되며, 천연형 GLP-2 또는 GLP-2 유도체에 생체적합성 물질이 결합된 형태의 지속형 결합체도 망라한다. 상기 GLP-2는 인슐린 분비 펩타이드를 함유하는 약학적 조성물과 병용 투여 또는 사용될 수 있도록, 상기 조성물에 또는 이와 별개의 조성물에 약학적 유효량으로 포함될 수 있다.
천연형 GLP-2의 아미노산 서열은 아래와 같다.
GLP-2(1-33)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD (서열번호 1)
본 발명에서 "GLP-2 수용체 작용제"는 생체 내 또는 분리된 사람 글루카곤 유사 펩타이드-2 수용체와 결합하여 천연형 GLP-2와 동등한 혹은 유사한 생리활성을 일으키는 물질을 말한다. 예를 들어, GLP-2 작용제에는 천연형 GLP-2 또는 GLP-2 유도체가 포함될 수 있다.
본 발명에서 "GLP-2 유도체"는 천연형 GLP-2와 비교하여 아미노산 서열에 하나 이상의 차이가 있는 펩타이드; 천연형 GLP-2 서열을 개질(modification)을 통하여 변형시킨 펩타이드; 및/또는 천연형 GLP-2와 같이 단장증후군의 예방, 치료 및/또는 개선 기능을 가진 천연형 GLP-2의 모방체를 포함한다. 구체적으로, 상기 GLP-2 유도체는 천연형 GLP-2 서열에서 적어도 하나 이상의 아미노산에 치환(substitution), 추가(addition), 제거(deletion), 수식(modification) 및 이들의 조합으로 이루어지는 군에서 선택된 변형이 일어난 것일 수 있으나, 이에 제한되지 않는다.
추가되는 아미노산은 비 천연형 아미노산(예; D형 아미노산)도 가능하며, 천연형 아미노산 이외에 비 천연형 아미노산의 치환도 가능하다. 상기 추가되는 아미노산 서열은 천연형 GLP-2에서 유래된 것일 수 있으나, 이에 제한되지 않는다. 또한, 본 발명에서 아미노산의 변형은, 적어도 하나의 아미노산의 치환, 추가, 제거, 또는 이들의 조합과 함께; 또는 이와 독립적으로, 아미노산 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation, azido 기로 치환), 제거(예; deamination) 및/또는 수식(예; N-methylation)된 것을 의미할 수 있으나, 이에 제한되는 것은 아니다.
하나의 구체적인 실시 형태에서, 본 발명의 GLP-2의 유도체는 천연형 GLP-2와 아미노산 서열에서 적어도 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 이상의 상동성 또는 동일성을 보이는 것일 수 있고/있거나, GLP-2의 아미노산 한 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation, azido 기로 치환), 제거(예; deamination) 및/또는 수식(예; N-methylation) 된 형태일 수 있으나, 이에 제한되는 것은 아니다.
하나의 구체적인 실시 형태에서 본 발명의 GLP-2는 N-말단 아미노기가 치환, 제거, 또는 수식될 수 있으나, 이에 제한되지 않는다. 본 발명의 GLP-2는 지속형 결합체 제조 시 GLP-2의 생체 내 활성에 중요한 부위인 N-말단에 결합이 일어나는 것을 방지하기 위해, N-말단 히스티딘의 알파 아미노기를 제거하는 방법, N-말단 아미노기를 하이드록실(hydroxyl)기 또는 카복실(carboxyl)기로 치환하여 합성하는 방법, N-말단 히스티딘의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기를 제거하여 이미다조-아세틸(imidazo-acetyl) 작용기만을 남겨두는 방법, N-말단 아미노기를 2개의 메틸기로 수식하는 방법 등을 통해 제조될 수 있다.
구체적으로, GLP-2 유도체는 GLP-2의 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딜 GLP-2(imidazoacetyl-deshistidyl-GLP-2, CA-GLP-2), GLP-2의 N-말단 아미노기가 제거된 데스아미노히스티딜 GLP-2(desaminohistidyl GLP-2, DA-GLP-2), GLP-2의 N-말단 아미노기가 하이드록실기로 치환된 베타-히드록시이미다조프로피온일데스히스티딜 GLP-2(β-hydroxyimidazopropionyldeshistidyl GLP-2, HY-GLP-2), GLP-2의 N-말단 아미노기가 2개의 메틸기로 수식된 N-디메틸히스티딜 GLP-2(N-dimethylhistidyl GLP-2, DM-GLP-2), 또는 GLP-2의 N-말단 아미노기가 카복실기로 치환된 베타-카복시이미다조프로피온일데스히스티딜-GLP-2(β-carboxyimidazopropionyl-deshistidyl GLP-2, CX-GLP-2)일 수 있으나, 이에 제한되지 않는다. 하나의 비제한적 예시로서 GLP-2 유도체 제조에 사용된 물질 구조는 아래와 같다.
Figure PCTKR2021019854-appb-img-000001
본원에서 이미다조아세틸데스히스티딜(딘), 데스아미노히스티딜(딘), 베타-히드록시이미다조프로피온일데스히스티딜(딘), N-디메틸히스티딜(딘), 및 베타-카복시이미다조프로피온일데스히스티딜(딘)은 각각 이미다조아세틸, 데스-아미노-히스티딜, 베타-히드록시-이미다조프로피온일, 디메틸-히스티딜, 베타-카복실-이미다조프로피온일과 동일한 의미로 사용될 수 있다.
하나의 구체적인 실시 형태에서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 33번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것일 수 있으나, 이에 제한되지 않는다. 구체적으로, 상기 변형은 적어도 하나의 아미노산의 치환, 추가, 제거, 수식, 및 이들의 조합으로 이루어지는 군에서 선택된 변형일 수 있으며, 이 때 추가되는 아미노산은 비 천연형 아미노산(예; D형 아미노산)도 가능하며, 천연형 아미노산 이외에 비 천연형 아미노산의 치환도 가능하다. 상기 추가되는 아미노산 서열은 천연형 GLP-2에서 유래된 것일 수 있으나, 이에 제한되지 않는다. 또한, 본 발명에서 아미노산의 변형은, 적어도 하나의 아미노산의 치환, 추가, 제거, 또는 이들의 조합과 함께; 또는 이와 독립적으로, 아미노산 잔기의 일부 그룹이 화학적으로 치환(예; alpha-methylation, alpha-hydroxylation, azido 기로 치환), 제거(예; deamination) 및/또는 수식(예; N-methylation)된 것을 의미할 수 있으나, 이에 제한되는 것은 아니다.
하나의 구체적인 실시 형태에서, GLP-2 유도체는 하기 일반식 1의 아미노산 서열을 포함할 수 있으나, 이에 제한되지 않는다:
[일반식 1]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신, 또는 시스테인임.
다른 하나의 구체적인 실시 형태에서, GLP-2 유도체는 하기 일반식 2의 아미노산 서열을 포함할 수 있으나, 이에 제한되지 않는다:
[일반식 2]
X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)
여기서,
X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
X30은 라이신 또는 아르지닌이고;
X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산임.
구체적으로, 상기 아미노산은 천연형 아미노산 또는 비 천연형 아미노산일 수 있으며, 상기 아미노산의 변형은 전술한 바와 같다.
또한, 상기 일반식 1 또는 2의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 GLP-2 유도체에서 제외될 수 있으나, 이에 제한되지 않는다
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신 또는 Aib(2-aminoisobutyric acid)으로의 치환, 30번째 아미노산인 라이신의 아르지닌으로의 치환, 또는 이들의 조합을 가질 수 있으나, 이에 제한되지 않는다. 또한, 상기 GLP-2 유도체는 C-말단(예들 들어, 33번째 아미노산)에 티올기(예들 들어, 시스테인), 아미노기(예를 들어, 라이신, 아르지닌, 글루타민 또는 히스티딘), 또는 아지드기(예들 들어, 6-아지도라이신)가 도입될 수 있으나, 이에 제한되지 않는다.
GLP-2 유도체의 지속형 결합체 제조 시 상기 도입된 그룹에서 결합이 일어나므로, 이를 이용하여 결합 위치가 선택적으로 조절된 GLP-2 결합체를 제조할 수 있다. 구체적으로, GLP-2 유도체의 하이드록실기, 티올기, 아미노기 또는 아지드기에 링커의 한 쪽 말단이 결합되고, 링커의 다른 말단에 생체 내 반감기를 증가시킬 수 있는 물질(예를 들어, 면역글로불린 Fc 영역)이 결합될 수 있다. 상기 티올기, 아미노기 또는 아지드기는 GLP-2에 아미노산을 추가하여 도입시킬 수 있으나, 이에 제한되지 않는다. 상기 티올기는 GLP-2에 시스테인(C)을 추가시켜 도입되고; 아미노기는 라이신(K), 아르지닌(R), 글루타민(Q) 또는 히스티딘(H)을 추가시켜 도입되고; 아지드기는 6-아지도라이신(6-azidolysine, AZK)을 추가시켜 도입될 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명에 따른 GLP-2 유도체는 적어도 하나의 잔기가 시스테인, 라이신, 아르지닌, 글루타민, 히스티딘 또는 6-아지도라이신일 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 2의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 아미노기(예를 들어, 라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 3의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환, 천연형 GLP-2의 30번째 아미노산인 라이신의 아르지닌으로의 치환 및 C-말단에 아미노기(예를 들어, 라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 4의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환 및 C-말단에 아지드기(예들 들어, 6-아지도라이신)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 5의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 글라이신으로의 치환, 천연형 GLP-2의 30번째 아미노산인 라이신의 아르지닌으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 6의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
구체적으로, 본 발명의 GLP-2 유도체는 천연형 GLP-2의 2번째 아미노산인 알라닌의 2-아미노이소부티르산으로의 치환 및 C-말단에 티올기(예들 들어, 시스테인)의 도입을 포함하며, 그 예로 서열번호 8의 아미노산 서열을 가질 수 있고, 더욱 구체적으로 N-말단 첫번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 이미다조아세틸데스히스티딘을 포함할 수 있으며, 그 예로 서열번호 7의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
상기 서열번호 2 내지 8의 GLP-2 유도체를 하기 표 1에 나타내었다.
Figure PCTKR2021019854-appb-img-000002
상기 표 1에서 caH는 히스티딘 대신 이미다조아세틸데스히스티딘으로 치환된 것을, Aib는 2-아미노이소부티르산(2-aminoisobutyric acid)을, AZK는 6-아지도-L-라이신(6-azido-L-lysyine)을 가리킨다.
본 발명에 따른 GLP-2는 상기 기술된 특정 서열을 포함하는 펩타이드, 상기 기술된 특정 서열로 구성된(또는 필수적으로 구성된) 펩타이드일 수 있으나, 이에 제한되는 것은 아니다.
한편, 본원에서 '특정 서열번호로 구성되는 (이루어진)' 펩타이드 또는 GLP-2라고 기재되어 있다 하더라도, 해당 서열번호의 아미노산 서열로 이루어진 펩타이드 또는 GLP-2와 동일 혹은 상응하는 활성을 가지는 경우라면 해당 서열번호의 아미노산 서열 앞뒤의 무의미한 서열 추가 또는 자연적으로 발생할 수 있는 돌연변이, 혹은 이의 잠재성 돌연변이(silent mutation)를 제외하는 것이 아니며, 이러한 서열 추가 혹은 돌연변이를 가지는 경우에도 본원의 범위 내에 속하는 것이 자명하다.
구체적으로, GLP-2 유도체는 일반식 1 또는 2에서 (1) X2가 글라이신 또는 Aib이거나, (2) X30이 라이신 또는 아르지닌이거나, 또는 (3) X2가 글라이신 또는 Aib이고, X30이 라이신 또는 아르지닌일 수 있으나, 이에 제한되지 않는다.
구체적으로, GLP-2 유도체는 일반식 1 또는 2에서
(1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,
(2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,
(3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,
(4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,
(5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,
(6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는
(7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인 일 수 있으나, 이에 제한되지 않는다.
본 발명에서 천연형 GLP-2의 작용제, 단편, 변이체 및 유도체의 제조를 위한 이러한 변형은 L-형 혹은 D-형 아미노산, 및/또는 비-천연형 아미노산을 이용한 변형; 및/또는 천연형 서열을 개질 혹은 번역 후 변형 (예, 메틸화, 아실화, 유비퀴틴화, 분자 내 공유결합 등) 함으로써 변형하는 것을 모두 포함한다.
본 발명에서, 상기 GLP-2 또는 GLP-2 유도체는 생체 내의 단백질 절단 효소들로부터 보호하고 안정성을 증가시키기 위하여 이의 N-말단 및/또는 C-말단 등이 화학적으로 수식되거나 유기단으로 보호되거나, 또는 GLP-2 또는 GLP-2 유도체는 말단 등에 아미노산이 추가되어 변형된 형태일 수 있다.
특히, 화학적으로 합성한 펩타이드의 경우, N- 및 C-말단이 전하를 띠고 있기 때문에, 이러한 전하를 제거하기 위하여 N-말단을 아세틸화(acetylation) 및/또는 C-말단을 아미드화(amidation)할 수 있으나, 특별히 이에 제한되지는 않는다.
구체적으로, 본 발명에서, GLP-2 또는 GLP-2 유도체는 이의 C-말단이 변형되지 않았거나 아미드화된 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서, 인슐린 분비 펩타이드 및/또는 GLP-2는 각각의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된 지속형 결합체의 형태일 수 있으나, 이에 제한되지 않는다. 상기 지속형 결합체는 생체적합성물질(예로서, 면역글로불린 Fc 영역)이 결합되지 않은 인슐린 분비 펩타이드 또는 GLP-2의 유도체에 비하여 증가된 효력의 지속성을 나타낼 수 있으며, 본 발명에서는 인슐린 분비 펩타이드 또는 GLP-2에 생체적합성 물질이 결합하여 반감기가 증가된, 인슐린 분비 펩타이드 또는 GLP-2를 포함하는 결합체를 각각 "인슐린 분비 펩타이드 지속형 결합체 또는 인슐린 분비 펩타이드의 지속형 결합체" 또는 "GLP-2 지속형 결합체 또는 GLP-2의 지속형 결합체"로 지칭한다. 본 발명에서 지속형 결합체는 결합체와 혼용된다.
하나의 구체예에서,
(i) 상기 인슐린 분비 펩타이드는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
(ii) 상기 GLP-2는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
(iii) 상기 인슐린 분비 펩타이드 및 GLP-2 각각은 이들의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태일 수 있다.
한편, 이러한 결합체는 비자연적인(non-naturally occurring) 것일 수 있다.
또한, 지속형 결합체에 있어서 인슐린 분비 펩타이드 또는 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)의 연결은 물리 또는 화학 결합이거나, 비공유 또는 공유 결합일 수 있으며, 구체적으로 공유 결합일 수 있으나 이에 제한되지 않는다.
또한, 지속형 결합체에서 인슐린 분비 펩타이드 또는 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)의 연결 방법은 특별히 제한되지 않으나, 링커를 통해 인슐린 분비 펩타이드 또는 GLP-2와 생체적합성물질(예로서, 면역글로불린 Fc 영역)이 서로 연결된 것일 수 있다.
또한, GLP-2의 지속형 결합체에 관한 한국 공개특허 제10-2019-0037181호는 참조로 본원에 포함된다
하나의 구체적인 실시 형태에서, 본 발명의 인슐린 분비 펩타이드 또는 GLP-2의 지속형 결합체는 하기 화학식 1의 구조를 가질 수 있으나, 이에 제한되지 않는다.
[화학식 1]
X - La - F
여기서,
X는 인슐린 분비 펩타이드 또는 GLP-2이고;
L은 링커(예를 들어, 에틸렌글리콜 반복 단위를 함유하는 링커이고;
a는 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;
F는 X의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질(예를 들어, 면역글로불린 Fc 영역)이며;
상기 “-“는 화학적 결합(예를 들어, 공유결합)이다.
보다 구체적으로, X와 L, 및 L과 F는 공유결합으로 서로 연결되는 것일 수 있으며, 이때 상기 결합체는 화학식 1의 순서로, X, L, 및 F가 공유결합을 통하여 각각 연결된 결합체일 수 있다.
또한, 상기 F는 X와 직접적으로 연결되거나 (즉, 상기 화학식 1에서 a가 0이거나), 또는 링커 (L)를 통해 연결된 것일 수 있다.
본 발명에 따른 결합체에서 F는 X, 즉 본 발명에 따른 인슐린 분비 펩타이드 또는 GLP-2의 반감기를 증가시킬 수 있는 물질로서, 본 발명의 결합체를 구성하는 모이어티의 일 구성에 해당한다.
상기 F는 X와 공유 화학결합 또는 비공유 화학결합으로 서로 결합되는 것일 수 있으며, 공유 화학결합, 비공유 화학결합 또는 이들의 조합으로 L을 통하여 F와 X가 서로 결합되는 것일 수 있다.
상기 F는 X의 생체 내 반감기를 증가시킬 수 있는 물질은 생체적합성 물질로서, 예를 들어, 고분자 중합체, 지방산, 콜레스테롤, 알부민 및 이의 단편, 알부민 결합물질, 특정 아미노산 서열의 반복단위의 중합체, 항체, 항체 단편, FcRn 결합물질, 생체 내 결합조직, 뉴클레오타이드, 파이브로넥틴, 트랜스페린(Transferrin), 사카라이드(saccharide), 헤파린, 및 엘라스틴으로 이루어진 군에서 선택되는 것일 수 있으나, 특별히 이에 제한되지 않는다.
상기 엘라스틴의 경우 수용성 전구체인 인간 트로포엘라스틴(tropoelastin) 일 수 있으며, 이들 중 일부 서열 혹은 일부 반복단위의 중합체일 수 있으며, 예컨대, 엘라스틴 유사 폴리펩타이드인 경우를 모두 포함하나, 특별히 이에 제한되는 것은 아니다.
상기 고분자 중합체의 예로, 폴리에틸렌글리콜(PEG), 폴리프로필렌글리콜, 에틸렌글리콜-프로필렌글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 올리고뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 고분자 중합체를 들 수 있고, 상기 다당류로는 덱스트란이 포함될 수 있으나, 특별히 이에 제한되지 않는다.
본 명세서에서 폴리에틸렌글리콜은 에틸렌글리콜 동종 중합체, PEG 공중합체, 또는 모노메틸-치환된 PEG 중합체(mPEG)의 형태를 모두 포괄하는 용어이나, 특별히 이에 제한되는 것은 아니다.
또한, 상기 생체적합성 물질은 폴리-라이신, 폴리-아스파르트산 및 폴리-글루탐산과 같은 폴리-아미노산을 포함하나, 이에 제한되는 것은 아니다.
또한, 지방산은 생체 내 알부민과 결합력을 갖는 것일 수 있으나, 특별히 이에 제한되지 않는다.
상기 F의 한 예로서, 상기 F는 FcRn 결합 물질일 수 있고, 구체적으로, 상기 FcRn 결합물질은 면역글로불린 Fc 영역일 수 있으며, 보다 구체적으로 IgG Fc 영역, 더 구체적으로는 비당쇄화된 IgG4 Fc 영역일 수 있으나, 특별히 이에 제한되지 않는다.
본 발명의 구체적인 한 예로, 상기 F(예를 들어, 면역글로불린 Fc 영역)는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 구조를 가질 수 있으나, 이에 제한되지 않는다.
하나의 구체적인 실시 형태에서, 본 발명의 지속형 결합체는 인슐린 분비 펩타이드 또는 GLP-2와 면역글로불린 Fc 영역이 연결된 것일 수 있으나, 이에 제한되지 않는다.
본 발명에서, "면역글로불린 Fc 영역"은, 면역글로불린의 중쇄와 경쇄 가변영역을 제외한, 중쇄 불변영역을 의미한다. 구체적으로, 상기 면역글로불린 Fc 영역은 중쇄 불변영역 2(CH2) 및/또는 중쇄 불변영역 3(CH3)부분을 포함하는 것일 수 있고, 보다 더 구체적으로, 힌지 영역 (힌지 영역 전체 또는 일부를 의미한다.)을 더 포함하는 것일 수 있다. 상기 면역글로불린 Fc 영역은 본 발명의 결합체의 모이어티를 이루는 일 구성일 수 있다. 구체적으로, 상기 화학식 1에서 F에 해당한다.
본 명세서에서 Fc 영역이라고 하면 면역글로불린의 파파인 소화에서 얻는 천연형 서열뿐 아니라 그 유도체, 치환체, 예컨대 천연 서열 중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 변환되어 천연형과 상이하게 된 서열 등 변형체까지 망라하여 포함된다. 상기 유도체, 치환체, 변형체는 FcRn에 결합하는 능력을 보유하는 것을 전제로 한다.
상기 F(예를 들어, 면역글로불린 Fc 영역)는, 2개의 폴리펩타이드 사슬이 이황화결합으로 연결되어 있는 구조이며, 상기 두 사슬 중 한 사슬의 질소 원자를 통해서만 연결되어 있는 구조일 수 있으나, 이에 제한되지 않는다. 상기 질소 원자를 통한 연결은 라이신의 입실론 아미노 원자나 N-말단 아미노기에 환원적 아민화를 통하여 연결될 수 있다.
환원적 아민화 반응이란 반응물의 아민기 또는 아미노기가 다른 반응물의 알데히드(즉, 환원적 아민화가 가능한 작용기)와 반응하여 아민을 생성한 다음, 환원 반응에 의해 아민 결합을 형성시키는 반응을 의미하여, 당해 기술 분야에 널리 알려져 있는 유기합성 반응이다.
하나의 구체예로서, 상기 면역글로불린 Fc 영역이 그 N-말단 질소 원자를 통하여 연결된 것일 수 있다.
이러한 면역글로불린 Fc 영역은 중쇄 불변영역에 힌지(hinge) 부분을 포함할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, 면역글로불린 Fc 영역은 N-말단에 특정 힌지 서열을 포함할 수 있다.
본 발명의 용어, "힌지 서열"은 중쇄에 위치하여 이황화결합(inter disulfide bond)를 통하여 면역글로불린 Fc 영역의 이량체를 형성하는 부위를 의미한다.
본 발명에서, 상기 힌지 서열은 하기의 아미노산 서열을 갖는 힌지 서열 중 일부가 결실되어 하나의 시스테인 잔기만을 갖도록 변이된 것일 수 있으나, 이에 제한되지 않는다:
Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Cys-Pro(서열번호 11).
상기 힌지 서열은 서열번호 11의 힌지 서열 중 8번째 또는 11번째 시스테인 잔기가 결실되어 하나의 시스테인 잔기만을 포함하는 것일 수 있다. 본 발명의 힌지 서열은 하나의 시스테인 잔기만을 포함하는, 3 내지 12개의 아미노산으로 구성된 것일 수 있으나, 이에 제한되지 않는다. 보다 구체적으로, 본 발명의 힌지 서열은 다음과 같은 서열을 가질 수 있다: Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro(서열번호 12), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Pro(서열번호 13), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser(서열번호 14), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Pro(서열번호 15), Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser(서열번호 16), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 17), Glu-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 18), Glu-Ser-Pro-Ser-Cys-Pro(서열번호 19), Glu-Pro-Ser-Cys-Pro(서열번호 20), Pro-Ser-Cys-Pro(서열번호 21), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Ser-Cys-Pro(서열번호 22), Lys-Tyr-Gly-Pro-Pro-Pro-Ser-Cys-Pro(서열번호 23), Glu-Ser-Lys-Tyr-Gly-Pro-Ser-Cys-Pro(서열번호 24), Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys(서열번호 25), Lys-Tyr-Gly-Pro-Pro-Cys-Pro(서열번호 26), Glu-Ser-Lys-Pro-Ser-Cys-Pro(서열번호 27), Glu-Ser-Pro-Ser-Cys-Pro(서열번호 28), Glu-Pro-Ser-Cys(서열번호 29), Ser-Cys-Pro(서열번호 30).
더욱 구체적으로는 상기 힌지 서열은 서열번호 21(Pro-Ser-Cys-Pro)또는 서열번호 30(Ser-Cys-Pro)의 아미노산 서열을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명의 지속형 결합체의 더욱 구체적인 형태에서, 상기 결합체 내 면역글로불린 Fc 영역의 N-말단은 프롤린이고, 이 결합체는 상기 프롤린의 질소 원자를 통하여 Fc 영역이 링커에 연결된 것이다.
하나의 구체적인 실시 형태에서, 면역글로불린 Fc 영역은 힌지 서열이 존재함으로써 면역글로불린 Fc 영역의 사슬 두 개가 동종이합체(homodimer)나 이종이합체(heterodimer)를 형성한 이합체 형태일 수 있다. 본 발명의 화학식 1의 결합체는 링커의 일 말단이 이합체의 면역글로불린 Fc 영역의 한 사슬에 연결된 형태일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 용어, "N-말단"은 단백질 또는 폴리펩티드의 아미노 말단을 의미하는 것으로, 아미노 말단의 최말단, 또는 최말단으로부터 1개, 2개, 3개, 4개, 5개, 6개, 7개, 8개, 9개, 또는 10개 이상의 아미노산까지 포함하는 것일 수 있다. 본 발명의 면역글로불린 Fc 영역은 힌지 서열을 N-말단에 포함할 수 있으나, 이에 제한되지 않는다.
또한 본 발명의 면역글로불린 Fc 영역은 천연형과 실질적으로 동등하거나 향상된 효과를 갖는 한, 면역 글로불린의 중쇄와 경쇄 가변영역만을 제외하고, 일부 또는 전체 중쇄 불변영역 1(CH1) 및/또는 경쇄불변영역 1(CL1)을 포함하는 확장된 Fc 영역일 수 있다. 또한, CH2 및/또는 CH3에 해당하는 상당히 긴 일부 아미노산 서열이 제거된 영역일 수도 있다.
예컨대, 본 발명의 면역글로불린 Fc 영역은 1) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인, 2) CH1 도메인 및 CH2 도메인, 3) CH1 도메인 및 CH3 도메인, 4) CH2 도메인 및 CH3 도메인, 5) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인 중 1개 또는 2개의 이상의 도메인과 면역글로불린 힌지 영역(또는 힌지 영역의 일부)와의 조합, 또는 6) 중쇄 불변 영역 각 도메인과 경쇄 불변영역의 이합체일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명의 지속형 결합체의 하나의 실시 형태로서, 상기 면역글로불린 Fc 영역은 이합체 형태(dimeric form)일 수 있으며, 이합체 형태의 하나의 Fc 영역에 X 한 분자가 공유결합적으로 연결될 수 있으며, 이때 상기 면역글로불린 Fc와 X는 하나의 동일한 링커에 의해 서로 연결될 수 있다. 한편, 이합체 형태의 하나의 Fc 영역에 X 두 분자가 대칭적으로 결합하는 것 역시 가능하다. 이때 상기 면역글로불린 Fc와 X는 링커에 의해 서로 연결될 수 있다. 그러나, 상기 기술된 예에 제한되는 것은 아니다.
또한, 본 발명의 면역글로불린 Fc 영역은 천연형 아미노산 서열뿐만 아니라 이의 서열 유도체를 포함한다. 아미노산 서열 유도체란 천연 아미노산 서열 중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 상이한 서열을 가지는 것을 의미한다.
예를 들면, IgG Fc의 경우 결합에 중요하다고 알려진 214 내지 238, 297 내지 299, 318 내지 322 또는 327 내지 331번 아미노산 잔기들이 변형을 위해 적당한 부위로서 이용될 수 있다.
또한, 이황화 결합을 형성할 수 있는 부위가 제거되거나, 천연형 Fc에서 N-말단의 몇몇 아미노산이 제거되거나 또는 천연형 Fc의 N-말단에 메티오닌 잔기가 부가될 수도 있는 등 다양한 종류의 유도체가 가능하다. 또한, 이펙터 기능을 없애기 위해 보체결합부위, 예로 C1q 결합부위가 제거될 수도 있고, ADCC (antibody dependent cell mediated cytotoxicity) 부위가 제거될 수도 있다. 이러한 면역글로불린 Fc 영역의 서열 유도체를 제조하는 기술은 국제특허공개 제WO 97/34631호, 국제특허공개 제96/32478호 등에 개시되어 있다.
분자의 활성을 전체적으로 변경시키지 않는 단백질 및 펩타이드에서의 아미노산 교환은 당해 분야에 공지되어 있다 (H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation), 아세틸화(acetylation) 및 아미드화(amidation) 등으로 수식(modification)될 수도 있다.
상기 기술한 Fc 유도체는 본 발명의 Fc 영역과 동등한 생물학적 활성을 나타내며 Fc 영역의 열, pH 등에 대한 구조적 안정성을 증대시킨 것일 수 있다.
또한, 이러한 Fc 영역은 인간, 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트 또는 기니아 픽 등의 동물의 생체 내에서 분리한 천연형으로부터 얻어질 수도 있고, 형질전환된 동물세포 또는 미생물로부터 얻어진 재조합형 또는 이의 유도체일 수 있다. 여기서, 천연형으로부터 획득하는 방법은 전체 면역글로불린을 인간 또는 동물의 생체로부터 분리한 후, 단백질 분해효소를 처리하여 획득하는 방법일 수 있다. 파파인을 처리할 경우에는 Fab 및 Fc로 절단되고, 펩신을 처리할 경우에는 pF'c 및 F(ab)2로 절단된다. 이를 크기 배제 크로마토그래피 (size-exclusion chromatography) 등을 이용하여 Fc 또는 pF'c를 분리할 수 있다. 더 구체적인 실시 형태에서는 인간 유래의 Fc 영역을 미생물로부터 수득한 재조합형 면역글로불린 Fc 영역이다.
또한, 면역글로불린 Fc 영역은 천연형 당쇄, 천연형에 비해 증가된 당쇄, 천연형에 비해 감소한 당쇄 또는 당쇄가 제거된 형태일 수 있다. 이러한 면역글로불린 Fc 당쇄의 증감 또는 제거에는 화학적 방법, 효소학적 방법 및 미생물을 이용한 유전 공학적 방법과 같은 통상적인 방법이 이용될 수 있다. 여기서, Fc에서 당쇄가 제거된 면역글로불린 Fc 영역은 보체(c1q)와의 결합력이 현저히 저하되고, 항체-의존성 세포독성 또는 보체-의존성 세포 독성이 감소 또는 제거되므로, 생체 내에서 불필요한 면역 반응을 유발하지 않는다. 이런 점에서 약물의 캐리어로서의 본래의 목적에 보다 부합하는 형태는 당쇄가 제거되거나 비당쇄화된 면역글로불린 Fc 영역이라 할 것이다.
본 발명에서 "당쇄의 제거(Deglycosylation)"는 효소로 당을 제거한 Fc 영역을 말하며, 비당쇄화(Aglycosylation)는 원핵동물, 더 구체적인 실시 형태에서는 대장균에서 생산하여 당쇄화되지 않은 Fc 영역을 의미한다.
한편, 면역글로불린 Fc 영역은 인간 또는 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트, 기니아 픽 등의 동물기원일 수 있으며, 더 구체적인 실시 형태에서는 인간 기원이다.
또한, 면역글로불린 Fc 영역은 IgG, IgA, IgD, IgE, IgM 유래 또는 이들의 조합(combination) 또는 이들의 혼성(hybrid)에 의한 Fc 영역일 수 있다. 더 구체적인 실시 형태에서는 인간 혈액에 가장 풍부한 IgG 또는 IgM유래이며 보다 더 구체적인 실시 형태에서는 리간드 결합 단백질의 반감기를 향상시키는 것으로 공지된 IgG 유래이다. 더욱 더 구체적인 실시 형태에서 상기 면역글로불린 Fc 영역은 IgG4 Fc 영역이며, 가장 구체적인 실시 형태에서 상기 면역글로불린 Fc 영역은 인간 IgG4 유래의 비-당쇄화된 Fc 영역이나, 이에 제한되는 것은 아니다.
또한, 하나의 구체예로서, 면역글로불린 Fc 영역은 인간 IgG4 Fc의 단편으로서, 각 단량체의 3번 아미노산인 시스테인 사이의 이황화 결합(inter-chain 형태)을 통해 2개의 단량체가 연결된 동종이합량체일 수 있으며, 이 때 동종이합체는 각 단량체에서 35번 및 95번의 시스테인 사이 및 141번 및 199번의 시스테인 사이에 이황화 결합, 즉 2개의 이황화 결합(intra-chain 형태)을 가지거나/가질 수 있다.
각 단량체의 아미노산 수는 221개의 아미노산으로 구성될 수 있므며, 동종이합체를 형성하는 아미노산은 전체 442개의 아미노산으로 이루어질 수 있으나, 이에 제한되지 않는다. 구체적으로 면역글로불린 Fc 영역은 서열번호 35의 아미노산 서열(442개의 아미노산으로 구성됨)을 포함하는 동종이합체(여기서, 서열번호 31의 아미노산 서열(221개의 아미노산으로 구성됨)을 갖는 단량체 2개가 각 단량체의 3번 아미노산인 시스테인 사이에 이황화 결합을 통해 동종이합체를 형성하고, 상기 동종이합체의 단량체는 각각 독립적으로 35번 및 95번의 시스테인 간의 내부의 이황화 결합 및 141번 및 199번의 시스테인 간의 내부의 이황화 결합을 형성함)일 수 있으나, 이에 제한되지 않는다.
한편, 본 발명에서 면역글로불린 Fc 영역과 관련된 "조합(combination)"이란 이합체 또는 다합체를 형성할 때, 동일 기원 단쇄 면역글로불린 Fc 영역을 암호화하는 폴리펩타이드가 상이한 기원의 단쇄 폴리펩타이드와 결합을 형성하는 것을 의미한다. 즉, IgG Fc, IgA Fc, IgM Fc, IgD Fc 및 IgE의 Fc 영역으로 이루어진 그룹으로부터 선택된 2개 이상의 Fc 영역으로부터 이합체 또는 다합체의 제조가 가능하다.
본 발명에서 "하이브리드(hybrid)"란 단쇄의 면역글로불린 불변영역 내에 2개 이상의 상이한 기원의 면역글로불린 Fc 영역에 해당하는 서열이 존재함을 의미하는 용어이다. 본 발명의 경우 여러 형태의 하이브리드가 가능하다. 즉, IgG Fc, IgM Fc, IgA Fc, IgE Fc 및 IgD Fc의 CH1, CH2, CH3 및 CH4로 이루어진 그룹으로부터 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하며, 힌지를 포함할 수 있다.
한편, IgG 역시 IgG1, IgG2, IgG3 및 IgG4의 서브클래스로 나눌 수 있고 본 발명에서는 이들의 조합 또는 이들의 혼성화도 가능하다. 구체적으로는 IgG2 및 IgG4 서브클래스이며, 가장 구체적으로는 보체 의존적 독성(CDC, Complement dependent cytotoxicity)과 같은 이펙터 기능(effector function)이 거의 없는 IgG4의 Fc 영역이다.
또한, 상술한 결합체는 효력의 지속성이 천연형 인슐린 분비 펩타이드 또는 천연형 GLP-2에 비해, 또는 F가 수식되지 않은 X에 비해 증가된 것일 수 있으며, 이러한 결합체는 상술한 형태뿐만 아니라, 생분해성 나노파티클에 봉입된 형태 등을 모두 포함하나 이에 제한되지 않는다.
상기 화학식 1에서 링커 L은 펩타이드성 링커 또는 비펩타이드성 링커( 예를 들어 에틸렌글리콜 반복 단위를 함유하는 링커)일 수 있다.
상기 L이 펩타이드성 링커일 때, 1개 이상의 아미노산을 포함할 수 있으며, 예컨대 1개부터 1000개의 아미노산을 포함할 수 있으나, 특별히 이에 제한되는 것은 아니다. 본 발명에서 F와 X를 연결하기 위하여 공지의 다양한 펩타이드 링커가 본 발명에 사용될 수 있으며, 그 예로 [GS]x 링커, [GGGS]x 링커 및 [GGGGS]x 링커 등을 포함하며, 여기서 x는 1 이상의 자연수일 수 있다. 그러나, 상기 예에 제한되는 것은 아니다.
본 발명에서 "비펩타이드성 링커"는 반복 단위가 2개 이상 결합된 생체 적합성 중합체를 포함한다. 상기 반복 단위들은 펩타이드 결합이 아닌 임의의 공유결합을 통해 서로 연결된다. 상기 비펩타이드성 링커는 본 발명의 결합체의 모이어티를 이루는 일 구성일 수 있으며, 상기 화학식 1에서 L에 해당된다.
본 발명에서 사용될 수 있는 비펩타이드성 링커는 생체 내 단백질 분해 효소에 저항성 있는 중합체이면 제한 없이 사용될 수 있다. 본 발명에서 상기 비펩타이드성 링커는 비펩타이드성 중합체와 혼용되어 사용될 수 있다.
또한, 특별히 이에 제한되지 않으나, 상기 비펩타이드성 링커는 폴리에틸렌 글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜과 프로필렌 글리콜의 공중합체, 폴리옥시 에틸화 폴리올, 폴리비닐 알콜, 다당류(예, 덱스트란 등), 폴리비닐 에틸에테르, PLA(polylactic acid) 및 PLGA(polylactic-glycolic acid)와 같은 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 올리고뉴클레오타이드 및 이들의 조합으로 구성된 군으로부터 선택되는 것일 수 있다.
또한, 본 발명에서 사용될 수 있는 비펩타이드성 링커는 생체 내 단백질분해효소에 저항성 있는 중합체이면 제한 없이 사용될 수 있으나, 구체적으로 비펩타이드성 중합체의 분자량은 0 초과 약 100 kDa 범위, 약 1 내지 약 100 kDa 범위, 구체적으로 약 1 내지 50 kDa 범위, 약 1 내지 약 20 kDa 범위, 약 1 내지 약 10 kDa 범위, 또는 약 3.4kDa 내지 10 kDa이나, 이에 제한되지 않는다.
특별히 이에 제한되지 않으나, 상기 비펩타이드성 링커는 에틸렌글리콜 반복 단위를 함유하는 링커, 예를 들어, 폴리에틸렌글리콜일 수 있고, 또한, 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.
상기 비펩타이드성 링커의 반복 단위는 에틸렌글리콜 반복 단위일 수 있고, 구체적으로, 상기 비펩타이드성 링커는 에틸렌글리콜 반복 단위를 포함하면서, 결합체의 제조에 이용되는 작용기를 말단에 포함하는 것일 수 있다. 본 발명에 따른 지속형 결합체는 상기 작용기를 통해 X와 F가 연결된 형태일 수 있으나 이에 제한되지 않는다. 본 발명에서, 상기 비펩타이드성 링커는 2개, 또는 3개 이상의 작용기를 포함할 수 있고, 각 작용기는 동일하거나, 서로 상이할 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 링커는 하기 화학식 4로 표시되는 폴리에틸렌글리콜(PEG)일 수 있으나, 이에 제한되는 것은 아니다:
[화학식 4]
Figure PCTKR2021019854-appb-img-000003
여기서, n= 10 내지 2400, n= 10 내지 480, 또는 n = 50 내지 250이나, 이에 제한되지 않는다.
상기 지속형 결합체에서 PEG 모이어티는, -(CH2CH2O)n-구조 뿐만 아니라 연결 요소와 이 -(CH2CH2O)n- 사이에 개재하는 산소 원자도 포함할 수 있으나, 이에 제한되는 것은 아니다.
또한, 하나의 구체적인 실시 형태에서 상기 결합체는 인슐린 분비 펩타이드 또는 GLP-2와 면역글로불린 Fc 영역(F)이 에틸렌글리콜 반복 단위를 함유하는 링커를 통해 공유 결합으로 연결된 구조 일 수 있으나, 이에 제한되는 것은 아니다.
상기 폴리에틸렌글리콜은, 에틸렌 글리콜 동종 중합체, PEG 공중합체, 또는 모노메틸-치환된 PEG 중합체(mPEG)의 형태를 모두 포괄하는 용어이나, 특별히 이에 제한되는 것은 아니다.
하나의 구체예로 상기 에틸렌글리콜 반복 단위는 그 예로, [OCH2CH2]n로 표시될 수 있으며, n 값은 자연수로 상기 펩타이드 결합체 내의 [OCH2CH2]n 부위의 평균 분자량, 예컨대 수평균 분자량이 O 초과 내지 약 100 kDa이 되도록 정해질 수 있으나, 이에 제한되지 않는다. 또 하나의 예로, 상기 n 값은 자연수로 상기 펩타이드 결합체 내의 [OCH2CH2]n 부위의 평균 분자량, 예컨대 수평균 분자량이 약 1 내지 약 100 kDa, 약 1 내지 약 80 kDa, 약 1 내지 약 50 kDa, 약 1 내지 약 30 kDa, 약 1 내지 약 25 kDa, 약 1 내지 약 20 kDa, 약 1 내지 약 15 kDa, 약 1 내지 약 13 kDa, 약 1 내지 약 11 kDa, 약 1 내지 약 10 kDa, 약 1 내지 약 8 kDa, 약 1 내지 약 5 kDa, 약 1 내지 약 3.4 kDa, 약 3 내지 약 30 kDa, 약 3 내지 약 27 kDa, 약 3 내지 약 25 kDa, 약 3 내지 약 22 kDa, 약 3 내지 약 20 kDa, 약 3 내지 약 18 kDa, 약 3 내지 약 16 kDa, 약 3 내지 약 15 kDa, 약 3 내지 약 13 kDa, 약 3 내지 약 11 kDa, 약 3 내지 약 10 kDa, 약 3 내지 약 8 kDa, 약 3 내지 약 5 kDa, 약 3 내지 약 3.4 kDa, 약 8 내지 약 30 kDa, 약 8 내지 약 27 kDa, 약 8 내지 약 25 kDa, 약 8 내지 약 22 kDa, 약 8 내지 약 20 kDa, 약 8 내지 약 18 kDa, 약 8 내지 약 16 kDa, 약 8 내지 약 15 kDa, 약 8 내지 약 13 kDa, 약 8 내지 약 11 kDa, 약 8 내지 약 10 kDa, 약 9 내지 약 15 kDa, 약 9 내지 약 14 kDa, 약 9 내지 약 13 kDa, 약 9 내지 약 12 kDa, 약 9 내지 약 11 kDa, 약 9.5 내지 약 10.5 kDa, 약 3.4 kDa 또는 약 10 kDa일 수 있으나, 이에 제한되지 않는다.
본 발명에서 용어, "약"은 ±0.5, ±0.4, ±0.3, ±0.2, ±0.1 등을 모두 포함하는 범위로, 약 이란 용어 뒤에 나오는 수치와 동등하거나 유사한 범위의 수치를 모두 포함하나, 이에 제한되지 않는다.
또한, 면역글로불린 Fc 영역과 결합되는 본 발명의 비펩타이드성 링커는 한 종류의 중합체뿐만 아니라 상이한 종류의 중합체들의 조합이 사용될 수도 있다.
하나의 구체적인 실시 형태에서 상기 비펩타이드성 링커의 양 말단은 면역글로불린 Fc 영역의 티올기, 아미노기, 하이드록실기 및 GLP-2의 티올기, 아미노기, 아지드기, 하이드록실기에 결합할 수 있으나, 이에 제한되지 않는다.
구체적으로, 상기 비펩타이드성 링커는 양쪽 말단에 각각 면역글로불린 Fc와 인슐린 분비 펩타이드 또는 GLP-2에 결합될 수 있는 반응기, 구체적으로는 면역글로불린 Fc 영역의 시스테인의 티올기; N-말단, 라이신, 아르지닌, 글루타민 및/또는 히스티딘에 위치한 아미노기; 및/또는 C-말단에 위치한 하이드록실기와 결합되고, GLP-2의 시스테인의 티올기; 라이신, 아르지닌, 글루타민 및/또는 히스티딘의 아미노기; 아지도라이신의 아지드기; 및/또는 하이드록실기와 결합될 수 있는 반응기를 포함할 수 있으나, 이에 제한되지 않는다.
보다 구체적으로, 상기 비펩타이드성 중합체의 반응기는 알데히드 그룹, 말레이미드 그룹 및 석시니미드 유도체로 이루어진 군으로부터 선택되는 하나 이상일 수 있으나, 이에 제한되지 않는다.
상기에서, 알데히드 그룹으로 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 예로서 들 수 있으나, 이에 제한되지 않는다.
상기에서, 석시니미드 유도체로는 석시니미딜 카르복시메틸, 석시니미딜 발레르에이트, 석시니미딜 메틸부타노에이트, 석시니미딜 메틸프로피온에이트, 석시니미딜 부타노에이트, 석시니미딜 프로피온에이트, N-하이드록시석시니미드, 히드록시 석시니미딜 또는 석시니미딜 카보네이트가 이용될 수 있으나, 이에 제한되지 않는다.
상기 비펩타이드성 링커는 상기와 같은 반응기를 통해 생체적합성 물질(예를 들어, 면역글로불린 Fc)와 인슐린 분비 펩타이드 또는 GLP-2에 연결되어, 비펩타이드성 중합체 연결부로 전환될 수 있다.
또한, 알데히드 결합에 의한 환원성 알킬화로 생성된 최종 산물은 아미드 결합으로 연결된 것보다 훨씬 안정적이다. 알데히드 반응기는 낮은 pH에서 N-말단에 선택적으로 반응하며, 높은 pH, 예를 들어 pH 9.0 조건에서는 라이신 잔기와 공유결합을 형성할 수 있다.
본 발명의 비펩타이드성 링커의 말단 반응기는 서로 같거나 다를 수 있다. 상기 비펩타이드성 링커는 말단에 알데히드 그룹 반응기를 갖는 것일 수 있고, 또한 상기 비펩타이드성 링커는 말단에 각각 알데히드 그룹 및 말레이미드 반응기를 가질 수 있거나, 말단에 각각 알데히드 그룹 및 석시니미드 반응기를 가질 수 있으나, 이에 제한되지 않는다.
예를 들어, 한쪽 말단에는 말레이미드 그룹을, 다른 쪽 말단에는 알데히드 그룹, 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 가질 수 있다. 또 한 가지 예로, 한쪽 말단에는 석시니미딜 그룹을, 다른 쪽 말단에는 프로피온 알데히드 그룹 또는 부틸 알데히드 그룹을 가질 수 있다.
프로피온쪽 말단에 하이드록시 반응기를 갖는 폴리에틸렌글리콜을 비펩타이드성 링커로 이용하는 경우에는, 공지의 화학반응에 의해 상기 하이드록시기를 상기 다양한 반응기로 활성화하거나, 상업적으로 입수가능한 변형된 반응기를 갖는 폴리에틸렌글리콜을 이용하여 본 발명의 결합체를 제조할 수 있다.
하나의 구체적인 실시 형태에서 상기 비펩타이드성 링커의 반응기가 인슐린 분비 펩타이드 또는 GLP-2의 시스테인 잔기, 보다 구체적으로 시스테인의 -SH 기에 연결되는 것일 수 있으나, 이에 제한되지 않는다.
만약, 말레이미드-PEG-알데히드를 사용하는 경우, 말레이미드기는 인슐린 분비 펩타이드 또는 GLP-2의 -SH 기와 티오에테르(thioether) 결합으로 연결하고, 알데히드기는 면역글로불린 Fc의 -NH2 기와 환원적 알킬화 반응을 통해 연결할 수 있으나, 이에 제한되지 않으며, 이는 하나의 일례에 해당한다.
이와 같은 환원적 알킬화를 통하여 PEG의 한쪽 말단에 위치한 산소 원자에 면역글로불린 Fc 영역의 N-말단 아미노기가 -CH2CH2CH2-의 구조를 가지는 링커 작용기를 통해 서로 연결되어, -PEG-O-CH2CH2CH2NH-면역글로불린 Fc와 같은 구조를 형성할 수 있고, 티오에테르 결합을 통하여 PEG의 한쪽 말단이 GLP-2 또는 GLP-2의 시스테인에 위치한 황 원자에 연결된 구조를 형성할 수 있다. 상술한 티오에테르 결합은
Figure PCTKR2021019854-appb-img-000004
의 구조를 포함할 수 있다.
그러나, 상술한 예에 특별히 제한되는 것은 아니며, 이는 하나의 일례에 해당한다.
또한, 상기 결합체에서, 비펩타이드성 링커의 반응기가 면역글로불린 Fc 영역의 N-말단에 위치한 -NH2와 연결된 것일 수 있으나, 이는 하나의 일례에 해당한다.
또한, 상기 결합체에서, 인슐린 분비 펩타이드 또는 GLP-2는 반응기를 갖는 비펩타이드성 링커와 C-말단을 통해 연결될 수 있으나, 이는 하나의 일례에 해당한다.
본 발명에서 "C-말단"은, 펩타이드의 카르복시 말단을 의미하는 것으로, 본 발명의 목적상 비펩타이드성 중합체와 결합할 수 있는 위치를 말한다. 그 예로, 이에 제한되지는 않으나, C-말단의 최말단 아미노산 잔기뿐만 아니라 C-말단 주위의 아미노산 잔기를 모두 포함할 수 있으며, 구체적으로는 최말단으로부터 첫 번째 내지 20 번째의 아미노산 잔기를 포함할 수 있다.
하나의 구체예로, 상기 화학식 1의 결합체는 하기 화학식 2 또는 3의 구조를 가질 수 있다.
[화학식 2]
Figure PCTKR2021019854-appb-img-000005
[화학식 3]
Figure PCTKR2021019854-appb-img-000006
상기 화학식 2 또는 3에서 X는 상기에서 설명한 화학식 1의 펩타이드이고;
F는 면역글로불린 Fc 절편이며;
n은 자연수일 수 있다. 이때, n에 대한 설명은 상기에서 설명한 바와 같다.
하나의 구체예로, 상기 화학식 2의 지속형 결합체는, 인슐린 분비 펩타이드 또는 GLP-2의 X와 면역글로불린 Fc　영역의 F가　에틸렌글리콜 반복부를 개재하여 공유결합으로 연결된 구조로서, 각각 X는 화학식 2의 숙신이미드 고리에, F는 화학식 2의 옥시프로필렌기에 연결된 형태일 수 있다. 또한, 상기 화학식 3의 지속형 결합체는, 인슐린 분비 펩타이드 또는 GLP-2의 X와 면역글로불린 Fc　영역의 F가　에틸렌글리콜 반복부를 개재하여 공유결합으로 연결된 구조로서, 각각 X는 화학식 3의 옥시프로필렌기에, F는 화학식 3의 다른 옥시프로필렌기에 연결된 형태일 수 있다.
상기 화학식 2 또는 3에서, 상기 n의 값은 상기 펩타이드 결합체 내 [OCH2CH2]n 부위의 평균 분자량, 예컨대 수평균 분자량이 1 내지 100 kDa, 또는 1 내지 20 kDa 또는 10 kDa이 되도록 정해지는 것일 수 있으나, 이에 제한되지 않는다.
한 실시 형태에서　화학식 2의 숙신이미드 고리 또는 화학식 2의 숙신이미드 고리에 X가 연결되는 부위는 X의 C-말단 시스테인의 황 원자일 수 있다. 또한, 화학식 3의 옥시프로필렌기 또는 화학식 3의 옥시프로필렌기에 X가 연결되는 부위는 X의 C-말단 시스테인의 황 원자일 수 있다.
F 내에서 화학식 2 또는 화학식 3의 옥시프로필렌기에 연결되는 부위는 특별히 한정되지 않는다. 본 발명의 한 실시 형태에서 상기 옥시프로필렌기에 연결되는 F의 부위는 N-말단 질소 또는 F 내부　잔기의 질소 원자(예컨대 리신의 입실론 질소)일 수 있다.　본 발명의 한 구체적인　실시 형태에서, F가 화학식 2 또는 화학식 3의 옥시프로필렌기에 연결되는 부위는 F의 N-말단 프롤린일 수 있으나, 이에 제한되지 않는다.
한편, 본 발명에 따른 인슐린 분비 펩타이드, GLP-2, 또는 이들의 지속형 결합체는 그 자체, 이들의 염 (예컨대, 약학적으로 허용가능한 염), 또는 이들의 용매화물의 형태를 모두 포함한다.
또한, 인슐린 분비 펩타이드, GLP-2, 또는 이들의 지속형 결합체는 약학적으로 허용되는 임의의 형태일 수 있다.
상기 염의 종류는 특별히 제한되지는 않는다. 다만, 개체, 예컨대 포유류에게 안전하고 효과적인 형태인 것이 바람직하나, 특별히 이에 제한되는 것은 아니다.
본 발명에서 용어, "약학적으로 허용가능한 염" 이란 약학적으로 허용되는 무기산, 유기산, 또는 염기로부터 유도된 염을 포함한다. 적합한 산의 예로는 염산, 브롬산, 황산, 질산, 과염소산, 푸마르산，말레산, 인산, 글리콜산, 락트산, 살리실산，숙신산, 톨루엔-p-설폰산, 타르타르산, 아세트산，시트르산, 메탄설폰산，포름산, 벤조산, 말론산, 나프탈렌-2-설폰산， 벤젠설폰산 등을 들 수 있다. 적합한 염기로부터 유도된 염은 나트륨, 칼륨 등의 알칼리 금속，마그네슘 등의 알칼리 토금속，및 암모늄 등을 포함할 수 있다.
또한, 본 발명에서 사용된 용어 "용매화물"은 본 발명에 따른 펩타이드, 화합물 또는 이의 염이 용매 분자와 복합체를 형성한 것을 말한다.
본 발명의 천연형 인슐린 분비 펩타이드와 변형된 인슐린 분비 펩타이드, GLP-2는 Solid phase 합성법을 통하여 합성될 수 있으며, 재조합 방법으로도 생산 가능하고, 상업적으로 의뢰하여 제조할 수 있다.
또 하나의 구체예로서, 본 발명의 조합물, 약학적 조성물, 또는 약학적 키트는
(i) 인슐린 분비 펩타이드 및 GLP-2를 포함하거나,
(ii) 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 인슐린 분비 펩타이드 지속형 결합체; 및 GLP-2를 포함하거나,
(iii) 인슐린 분비 펩타이드; 및 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, GLP-2 지속형 결합체를 포함하거나,
(iv) 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 인슐린 분비 펩타이드 지속형 결합체; 및 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, GLP-2 지속형 결합체를 포함할 수 있다.
본 발명의 조합물, 약학적 조성물 또는 약학적 키트는 단장증후군의 예방, 개선 또는 치료에 사용될 수 있다.
본 발명에서 용어 "예방"은 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물 또는 조성물의 투여로 목적하는 질환, 예컨대 단장증후군의 발병을 억제 또는 지연시키는 모든 행위를 의미하며, "치료"는 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물 또는 조성물의 투여로 목적하는 질환, 예컨대 단장증후군의 증세가 호전되거나 이롭게 되는 모든 행위를 의미한다. 또한, "개선"은 본 발명의 조합물 또는 조성물의 투여로 치료되는 상태와 관련된 파라미터, 예를 들면 증상의 정도를 적어도 감소시키는 모든 행위를 의미한다.
본 발명에서 용어 "투여"는 어떠한 적절한 방법으로 환자에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 특별히 이에 제한되지 않으나, 상기 조성물이 생체 내 표적에 도달할 수 있는 어떠한 일반적인 경로를 통하여 투여될 수 있으며, 예를 들어 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비 내 투여, 폐 내 투여, 직장 내 투여 등이 될 수 있다.
상기 인슐린 분비 펩타이드 및 GLP-2는 병용으로 이용되어 단장증후군의 예방 또는 치료에 사용될 수 있다.
본 발명에서, "단장증후군(short bowel syndrome, SBS)"는 선천적으로 소장의 길이가 짧거나 또는 수술 등으로 인해 후천적으로 소장의 일정 비율 이상(예: 50% 이상)이 소실(소장의 흡수면적 감소)되어 발생하는 소화흡수불량증으로서, 영양 흡수 부족, 영양 흡수 장애, 복통, 설사, 지방변, 유당불내증, 탈수, 체중 감소, 무기력, 또는 피로 등의 증상이 나타날 수 있다.
본 발명에 따른 조합물 또는 조성물은 개체에 투여 시 체중 증가, 소장 길이 증가, 위장관 운동성 감소, 및 영양분 흡수 증가 중 하나 이상을 야기하여 단장증후군을 예방, 개선 또는 치료할 수 있다. 그러나, 이에 제한되는 것은 아니다.
본 발명의 약학적 조성물은 약학적으로 허용가능한 담체, 부형제 또는 희석제를 추가로 포함할 수 있다. 이러한 약학적으로 허용가능한 담체, 부형제, 또는 희석제는 비자연적으로 발생된 것일 수 있다.
본 발명에서 용어 "약학적으로 허용가능한"이란 치료효과를 나타낼 수 있을 정도의 충분한 양과 부작용을 일으키지 않는 것을 의미하며, 질환의 종류, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 투여 경로, 투여 방법, 투여횟수, 치료 기간, 배합 또는 동시 사용되는 약물 등 의학 분야에 잘 알려진 요소에 따라 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 약학적 조성물은 약학적으로 허용가능한 부형제를 추가로 포함할 수 있다. 상기 부형제는 특별히 이에 제한되지는 않으나, 경구 투여 시에는 결합제, 활택제, 붕해제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장화제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.
본 발명의 조성물의 제형은 상술한 바와 같은 약학적으로 허용가능한 부형제와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여 시에는 정제, 트로키, 캡슐, 엘릭서, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 환약, 캡슐, 서방형 제제 등으로 제형화할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로스, 메틸 셀룰로스, 미정질 셀룰로스, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 방부제 등을 추가로 포함할 수 있다.
또한, 본 발명의 약학적 조성물은 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
또한, 상기 조성물은 약학적 분야에서 통상의 방법에 따라 환자의 신체 내 투여에 적합한 단위 투여형의 제제, 구체적으로는 단백질 의약품의 투여에 유용한 제제 형태로 제형화시켜 당업계에서 통상적으로 사용하는 투여 방법을 이용하여 경구, 또는 피부, 정맥 내, 근육 내, 동맥 내, 골수 내, 수막강 내, 심실 내, 폐, 경피, 피하, 복 내, 비강 내, 소화관 내, 국소, 설하, 질 내 또는 직장 경로를 포함하는 비경구 투여 경로에 의하여 투여될 수 있으나, 이들에 한정되는 것은 아니다.
또한, 상기 결합체는 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 탄수화물, 아스코르브산(ascorbic acid) 또는 글루타티온과 같은 항산화제(antioxidants), 킬레이트제, 저분자 단백질 또는 다른 안정화제(stabilizers) 등이 약제로 사용될 수 있다.
본 발명의 약학적 조성물의 투여량과 횟수는 치료할 질환, 투여 경로, 환자의 연령, 성별 및 체중 및 질환의 중등도 등의 여러 관련 인자와 함께, 활성성분인 약물의 종류에 따라 결정된다. . 구체적으로, 본 발명의 조성물은 상기 펩타이드 또는 이를 포함하는 지속형 결합체를 약학적 유효량으로 포함하는 것일 수 있으나, 이에 제한되지 않는다.
상기 인슐린 분비 펩타이드 또는 GLP-2를 약학적 유효량으로 포함하는 것은, 인슐린 분비 펩타이드 또는 GLP-2로 인한 목적하는 약리 활성을 얻을 수 있는 정도를 의미하고, 또한 투여되는 개체에서 독성 또는 부작용이 일어나지 않거나 미미한 수준으로서 약학적으로 허용되는 수준을 의미할 수 있으나, 이에 제한되지 않는다. 이와 같은 약학적 유효량은 투여 횟수, 환자, 제형 등을 종합적으로 고려하여 결정될 수 있다.
특별히 이에 제한되지 않으나, 본 발명의 상기 약학적 조성물은 상기 성분 (유효성분)을 0.01 내지 99% 중량 대 부피로 함유할 수 있다.
본 발명의 조성물의 총 유효량은 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)으로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 본 발명의 약학적 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 구체적으로, 본 발명의 펩타이드 또는 결합체의 바람직한 전체 용량은 하루에 환자 체중 1 kg당 약 0.0001 mg 내지 500 mg일 수 있으나, 이에 제한되지 않는다. 그러나 상기 결합체의 용량은 약학적 조성물의 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당분야의 통상적인 지식을 가진 자라면 상기 본 발명의 조성물의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
본 발명의 약학적 조성물은 생체 내 지속성 및 역가가 우수하여, 본 발명의 약학적 제제의 투여 횟수 및 빈도를 현저하게 감소시킬 수 있으나 이에 제한되지 않는다.
본 발명을 구현하는 다른 하나의 양태는 GLP-2와 병용하는 것을 특징으로 하는 상기 인슐린 분비 펩타이드를 포함하는, 단장증후군의 예방, 개선 또는 치료용 약학적 조성물을 제공한다.
상기 인슐린 분비 펩타이드, GLP-2, 예방, 치료, 개선, 병용, 단장증후군 및 약학적 조성물에 대해서는 앞서 설명한 바와 같다.
본 발명을 구현하는 다른 하나의 양태는 인슐린 분비 펩타이드를 함유하는 단장증후군의 예방 또는 개선을 위한 식품 조성물로서, 상기 인슐린 분비 펩타이드는 GLP-2와 병용 투여되는 것을 특징으로 하는 식품 조성물을 제공한다.
상기 인슐린 분비 펩타이드, GLP-2, 예방, 개선, 병용, 및 단장증후군에 대해서는 앞서 설명한 바와 같다.
상기 식품 조성물은 건강기능식품으로 사용될 수 있다. 본 발명의 조성물을 식품 보조첨가제로 사용할 경우, 인슐린 분비 펩타이드, GLP-2, 이를 포함하는 지속형 결합체, 또는 이들의 조합을 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효 성분의 혼합량은 사용목적(예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다.
본 발명에서의 용어 "건강기능식품"이란, 건강보조의 목적으로 특정성분을 원료로 하거나 식품 원료에 들어있는 특정성분을 추출, 농축, 정제, 혼합 등의 방법으로 제조, 가공한 식품을 말하며, 상기 성분에 의해 생체방어, 생체리듬의 조절, 질병의 방지와 회복 등 생체조절기능을 생체에 대하여 충분히 발휘할 수 있도록 설계되고 가공된 식품을 말하는 것으로서, 상기 건강식품용 조성물은 질병의 예방 및 질병의 회복 등과 관련된 기능을 수행할 수 있다.
본 발명을 구현하는 다른 하나의 양태는 인슐린 분비 펩타이드 및 GLP-2 를 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 단장증후군의 예방, 개선 또는 치료 방법을 제공한다.
또 하나의 구체예로, 본 발명의 조합물, 약학적 조성물, 또는 약학적 키트를 이를 필요로 하는 개체에 투여 및/또는 사용하는 단계를 포함하는 단장증후군의 예방, 개선 또는 치료 방법일 수 있다.
또 하나의 구체예로, 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 조성물, 및 약학적 유효량의 GLP-2를 함유하는 조성물을 이를 필요로 하는 개체에 병용 투여 및/또는 병용 사용하는 단계를 포함하는 단장증후군의 예방, 개선 또는 치료 방법이다.
상기 인슐린 분비 펩타이드, GLP-2, 예방, 치료, 개선, 단장증후군, 병용, 조합물, 약학적 조성물 및 약학적 키트에 대해서는 앞서 설명한 바와 같다.
본 발명에서 상기 개체는 단장증후군이 의심되는 개체로서, 상기 단장증후군 의심 개체는 해당 질환이 발병하였거나 발병할 수 있는 인간을 포함한 쥐, 가축 등을 포함하는 포유 동물을 의미하나, 본 발명의 조성물로 치료 가능한 개체는 제한 없이 포함된다. 또한, 본 발명의 조성물을 단장증후군 질환 의심 개체에 투여함으로써, 개체를 효율적으로 치료할 수 있다. 단장증후군에 대해서는 상기에서 설명한 바와 같다.
본 발명의 방법은 인슐린 분비 펩타이드 및 GLP-2를 포함하는 조합물 또는 약학적 조성물을 약학적 유효량으로 투여하는 것을 포함할 수 있다. 본 발명에 따른 방법은 인슐린 분비 펩타이드 및 GLP-2를 하나의 제제로서 투여하거나, 또는 개별 제제를 동시, 개별, 순차 또는 역순으로 투여하는 것일 수 있으나, 이에 제한되지 않는다.
적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있으며, 1회 또는 수회로 나누어 투여할 수 있다. 그러나 본 발명의 목적상, 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다.
본 발명을 구현하는 또 하나의 양태는, 상기 조합물, 약학적 조성물, 또는 약학적 키트의 단장증후군의 예방, 개선 또는 치료 용도, 및/또는 단장증후군의 예방 또는 치료를 위한 약제의 제조를 위한 용도이다.
이하, 하기 실시예에 의하여 본 발명을 보다 상세하게 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐 본 발명의 범위가 이들로 한정되는 것은 아니다.
실시예 1: GLP-1 유도체 지속형 결합체의 제조
1-1. CA-Exendin-4-PEG 결합체 제조
CA-Exendin4(N-[2-(1H-Imidazol-5-yl)acetyl]-Exendin4, 한미정밀화학, 한국) 펩타이드 내의 27번째 라이신 잔기의 아민기와, 양쪽 말단에 알데하이드(Aldehyde, ALD) 기를 가지는 폴리에틸렌글라이콜(3.4 kDa, ALD(2) PEG, 한미정밀화학, 한국)간의 공유결합을 통하여, 페길화(PEGylation)된 펩타이드 결합체(모노 페길화된(mono-PEGylated) CA-Exendin-4)를 제조하였다. 구체적으로, CA-Exendin-4 : ALD(2) PEG의 몰비를 1:5 ∼ 1:15로, CA-Exendin-4 농도를 6 ∼ 12 ㎎/㎖로, 4 ∼ 10 ℃ 내지 상온에서, 약 4 ∼ 12 시간 반응시켰다. 이때 반응은 0.1 M HEPES pH 7.0 내지 8.5, 약 45 % 이소프로판올에서 이루어졌으며, 2 ∼ 50 mM 농도의 소듐 시아노보로하이드라이드[sodium cyanoborohydride(NaCNBH3)]를 첨가하여 반응시켰다. 반응액을 소디움 시트레이트(pH 2.0 ~ 3.5), 약 45 % 에탄올이 포함된 버퍼와 포타슘클로라이드 농도 구배를 이용한 Source 15S(Cytiva, 미국) 컬럼을 사용하여 정제하였다.
1-2. CA-Exendin-4-PEG-Fc 결합체 제조
CA-Exendin-4-PEG-Fc 결합체를 제조하기 위하여, 상기 실시예 1-1을 통해 얻은 모노 페길화된 CA-Exendin-4에 면역글로불린 Fc 단편을 첨가하여 전체 단백질 농도를 10 ∼ 50 ㎎/㎖로 만든 후 4 ∼ 10 ℃ 내지 상온에서 약 12 ∼ 17 시간 반응시켰다. 이때 반응액은 0.1 M 포타슘 포스페이트 pH 5.5 내지 8.5이며, 환원제인 2 ~ 50 mM 소듐 시아노보로하이드라이드를 첨가하였다. 반응이 종결된 후 반응액 내의 CA-Exendin-4-PEG-Fc 결합체를 소수성 결합 및 음이온 교환 컬럼의 2종류를 사용하여 정제하였다. 소수성 결합 컬럼인 Source 15Phenyl(Cytiva, 미국) 경우, Tris-HCl(pH 7.5) 완충액 및 NaCl 농도 구배를 이용하여 반응하지 않은 면역글로불린 Fc 단편을 분리 및 정제하였고, 음이온 교환 컬럼인 Source 15Q(Cytiva, 미국) 경우, Tris-HCl(pH 7.5) 완충액 및 NaCl 농도 구배를 이용하여 과반응된 불순물을 제거하여 CA-Exendin-4-PEG-Fc 결합체를 분리 및 정제하였다.
실시예 2: GLP-2 유도체 지속형 결합체의 제조
2-1. CA GLP-2 RK-PEG 결합체 제조
표 1의 서열번호 4의 GLP-2 유도체 CA GLP-2 RK를 개질 폴리에틸렌글리콜인 ALD(2) PEG(양 말단의 수소가 각각 프로피온알데히드기(3-옥소프로필기)로 치환되고, 에틸렌글리콜 반복단위 부위(moiety)의 화학식량이 3.4 kDa인 개질 폴리에틸렌글리콜, 일본 NOF사)로 페길화시키기 위하여, GLP-2 유도체와 ALD(2) PEG의 몰 비를 1:5 ~ 1:20, GLP-2 유도체 농도를 5 ~ 10 mg/ml로 하여 2 ~ 8 ℃에서 4 ~ 16 시간 반응시켰다. 이 때 반응은 20 mM 헤페스(HEPES) pH 7.5와 에탄올에서 이루어졌으며 환원제인 20 mM 소듐 시아노보로하이드라이드를 첨가하여 반응시켰다. 반응액은 구연산나트륨 pH 2.0, 에탄올이 포함된 완충 용액과 염화칼륨 농도 구배를 이용한 Source 15S(GE, 미국) 컬럼을 사용하여 모노페길화된 GLP-2 유도체를 정제하였다.
2-2. CA GLP-2 RK-PEG-Fc 결합체 제조
다음으로, 상기 정제된 모노페길화된 GLP-2 유도체와 면역글로불린 Fc 단편의 몰 비가 1:2 ~ 1:6가 되도록 하고, 전체 단백질 농도를 30 ~ 35 mg/mL로 하여 2 ~ 8 ℃에서 12 ~ 20 시간 반응시켰다. 이때 반응액은 100 mM 인산칼륨 완충액(pH 6.0)과 아이소프로판올에 환원제로서 20 mM 소듐 시아노보로하이드라이드를 첨가하였다.
반응이 종결된 후 반응액은 비스-트리스(bis-Tris) pH 6.5 버퍼와 염화나트륨 농도 구배를 이용하여 Source 15Q(GE, 미국) 컬럼에 적용하고, 황산 암모늄과 구연산 나트륨 pH 5.0 ~ 5.2의 농도 구배를 이용하여 Source 15 ISO(GE, 미국)에 적용하여, 면역글로불린 Fc 단편에 GLP-2 유도체가 폴리에틸렌글리콜 링커에 의해 공유결합으로 연결된 결합체인 GLP-2 유도체의 지속형 결합체를 정제하였다.
실시예 3: GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체의 병용투여에 의한 마우스 체중 및 소장 길이 증가 확인
GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체의 병용투여에 따른 생체 내(in vivo) 체중 및 소장(Small intestine) 길이의 개선 효력을 측정하기 위하여 마우스를 이용하였다. 구체적으로, 7주령의 수컷 마우스(C57BL/6)를 군당 5마리씩, 하기와 같이 나누었다:
- G1: 정상 대조군(약물을 투여하지 않은 군, Vehicle),
- G2: GLP-1 유도체 지속형 결합체(0.039 mg/kg/Q2D)를 투여한 군(GLP-1 유도체 지속형 결합체 0.039 mg/kg/Q2D, 2주),
- G3: GLP-2 유도체 지속형 결합체(0.889 mg/kg/Q2D)를 투여한 군(GLP-2 유도체 지속형 결합체 0.889 mg/kg/Q2D, 2주),
- G4: GLP-1 유도체 지속형 결합체(0.039 mg/kg/Q2D)와 GLP-2 유도체 지속형 결합체(0.889 mg/kg/Q2D)를 투여한 군([GLP-1 유도체 지속형 결합체 0.039 mg/kg/Q2D + GLP-2 유도체 지속형 결합체 0.889 mg/kg/Q2D], 2주)
본 명세서에서 GLP-1 유도체 지속형 결합체 또는 GLP-2 유도체 지속형 결합체의 투여량으로 나타낸 수치는 사용된 GLP-1 유도체 지속형 결합체 또는 GLP-2 유도체 지속형 결합체의 전체 질량에서 폴리에틸렌글리콜 링커 부위의 질량을 제외한 수치, 즉 폴리펩타이드 부위들만의 질량을 합산한 값을 기준으로 표시한 수치이다.
2주간 반복 투여(D0~D14: 약물이 투여된 첫 번째 날을 0일차로 명명함)를 진행하며 마우스의 체중을 관찰하였다. 이후 D14에서 부검을 통해 소장의 길이를 측정하였다.
그 결과 GLP-1 유도체 지속형 결합체 단독 투여군에 비해 GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체 병용 투여군에서, GLP-1에 의한 체중 감소가 관찰되지 않았으며(도 1), GLP-1 유도체 지속형 결합체 단독 투여군 혹은 GLP-2 유도체 지속형 결합체 단독 투여군에 비해 GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체 병용 투여군에서 유의적으로 소장의 길이가 증가되는 것을 확인하였다(도 2).
실시예 4: GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체의 병용투여에 의한 위장관 운동성 감소
GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체 병용투여에 따른 생체 내(in vivo) 위장관 운동성 감소 효과를 측정하기 위하여 마우스를 이용하였다. 구체적으로, 7주령의 수컷 마우스(C57BL/6)를 군당 6마리씩, 하기와 같이 나누었다:
- G1: 정상 대조군(약물을 투여하지 않은 군, Vehicle),
- G2: GLP-1 유도체 지속형 결합체(0.136 mg/kg)를 투여한 군(GLP-1 유도체 지속형 결합체 0.136 mg/kg),
- G3: GLP-2 유도체 지속형 결합체(3.111 mg/kg)를 투여한 군(GLP-2 유도체 지속형 결합체 3.111 mg/kg),
- G4: GLP-1 유도체 지속형 결합체(0.136 mg/kg)와 GLP-2 유도체 지속형 결합체(3.111 mg/kg)를 투여한 군(GLP-1 유도체 지속형 결합체 0.136 mg/kg + GLP-2 유도체 지속형 결합체 3.111 mg/kg).
그리고 절식과 함께 약물을 단 회 투여하였다. 24시간 후 5% 차콜 밀(Charcoal meal) (w/v in 10% Gum Arabic, 마우스 당 0.3 mL)을 경구 투여하였다. 20분 후 부검을 통해 소장을 취한 후 Charcoal meal의 이동 거리와 전체 소장 길이를 측정하여 소장에서의 charcoal meal의 이동 정도를 아래의 식을 이용하여 측정하였다.
소장에서 Charcoal meal의 이동 정도(Small intestine transit) (%)
= (Charcoal meal 이동거리/소장전체길이) x 100
이와 같은 결과는 본 발명의 GLP-1 유도체 지속형 결합체와 GLP-2 유도체 지속형 결합체의 병용 투여가, 단독 투여군에 비해 GLP-2에 의한 소장의 길이 증가뿐만 아니라 GLP-1에 의해 체중 감소를 일으키지 않으면서 소장의 길이를 빠르게 증가시키고, 위장관 운동성 감소(도 3)를 통해 환자의 영양분 흡수를 증가시켜 단장 증후군의 치료에 효과를 나타낼 수 있음을 시사한다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (22)

  1. 약학적 유효량의 인슐린 분비 펩타이드를 함유하는 단장증후군(short bowel syndrome)의 예방 또는 치료를 위한 약학적 조성물로서,
    상기 약학적 조성물은 글루카곤 유사 펩타이드-2(Glucagon-like peptide-2, GLP-2)와 병용 투여되는 것을 특징으로 하는 약학적 조성물.
  2. 약학적 유효량의 GLP-2를 함유하는 단장증후군의 예방 또는 치료를 위한 약학적 조성물로서,
    상기 약학적 조성물은 인슐린 분비 펩타이드와 병용 투여되는 것을 특징으로 하는 약학적 조성물.
  3. 제1항 또는 제2항에 있어서, 상기 인슐린 분비 펩타이드는 글루카곤 유사 펩타이드-1(Glucagon-like peptide-1, GLP-1), 엑센딘-3, 엑센딘-4, 이들의 작용제, 유도체, 단편, 변이체, 및 이들의 조합으로 구성되는 군으로부터 선택되는 약학적 조성물.
  4. 제1항 또는 제2항에 있어서, 상기 인슐린 분비 펩타이드는 인슐린 분비 펩타이드의 N-말단 히스티딘 잔기가 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘으로 치환된 인슐린 분비 펩타이드 유도체인, 약학적 조성물.
  5. 제1항 또는 제2항에 있어서, 상기 인슐린 분비 펩타이드는 천연형 엑센딘-4, 엑센딘-4의 N-말단 첫 번째 아미노산인 히스티딘 잔기의 알파 탄소 및 알파 탄소에 결합된 N-말단 아미노기가 제거된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 제거된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 하이드록실기로 치환된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 2개의 메틸기로 수식된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아미노기가 카복실기로 치환된 엑센딘-4 유도체, 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 유도체, 또는 엑센딘-4의 열두 번째 아미노산(라이신)이 아르지닌으로 치환된 엑센딘-4 유도체인 약학적 조성물.
  6. 제1항 또는 제2항에 있어서, 상기 GLP-2는 천연형 GLP-2 또는 GLP-2 유도체인, 약학적 조성물.
  7. 제6항에 있어서, 상기 GLP-2 유도체는 천연형 GLP-2 서열에서 적어도 하나의 아미노산에 치환(substitution), 추가(addition), 제거(deletion), 수식(modification) 및 이들의 조합으로 이루어지는 군에서 선택된 변형이 일어난 GLP-2 유도체인 약학적 조성물.
  8. 제6항에 있어서, 상기 GLP-2 유도체는 서열번호 1에서 1번, 2번, 30번 및 33번의 아미노산 중 적어도 하나의 아미노산에 변형이 일어난 것인 약학적 조성물.
  9. 제6항에 있어서, 상기 GLP-2 유도체는 하기 일반식 1로 표시되는 아미노산 서열을 포함하는 약학적 조성물:
    [일반식 1]
    X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 9)
    여기서,
    X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
    X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
    X30은 라이신 또는 아르지닌이고;
    X34는 부존재하거나, 라이신, 아르지닌, 글루타민, 히스티딘, 6-아지도라이신 또는 시스테인이고;
    다만, 일반식 1의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 제외한다.
  10. 제9항에 있어서, 상기 GLP-2 유도체는
    (1) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 시스테인이거나,
    (2) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 라이신이거나,
    (3) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 라이신이거나,
    (4) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 라이신이고, X34가 6-아지도라이신이거나,
    (5) X1이 이미다조아세틸데스히스티딘이고, X2가 글라이신이고, X30이 아르지닌이고, X34가 시스테인이거나,
    (6) X1이 이미다조아세틸데스히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인이거나, 또는
    (7) X1이 히스티딘이고, X2가 Aib이고, X30이 라이신이고, X34가 시스테인인 약학적 조성물.
  11. 제6항에 있어서, 상기 GLP-2 유도체는 하기 일반식 2로 표시되는 아미노산 서열을 포함하는 약학적 조성물:
    [일반식 2]
    X1X2DGSFSDEMNTILDNLAARDFINWLIQTX30ITDX34 (서열번호 10)
    여기서,
    X1은 히스티딘, 이미다조아세틸데스히스티딘, 데스아미노히스티딘, β-히드록시이미다조프로피온일데스히스티딘, N-디메틸히스티딘, 또는 β-카복시이미다조프로피온일데스히스티딘이고;
    X2는 알라닌, 글라이신, 또는 Aib(2-aminoisobutyric acid)이며;
    X30은 라이신 또는 아르지닌이고;
    X34는 하나 이상의 임의의 아미노산 또는 변형이 일어난 하나 이상의 임의의 아미노산이고;
    다만, 일반식 2의 아미노산 서열 중에서 서열번호 1과 동일한 서열은 제외한다.
  12. 제6항에 있어서, 상기 GLP-2 유도체는 서열번호 2 내지 8로 이루어진 군으로부터 선택된 아미노산 서열의 펩타이드인 약학적 조성물.
  13. 제1항 또는 제2항에 있어서, 상기 조성물은 개체에 투여 시 체중 증가, 소장 길이 증가, 위장관 운동성 감소, 및 영양분 흡수 증가 중 하나 이상을 야기하는 약학적 조성물.
  14. 제1항 또는 제2항에 있어서, 상기 인슐린 분비 펩타이드 및 GLP-2는 이의 C-말단이 변형되지 않았거나 아미드화된 약학적 조성물.
  15. 제1항 또는 제2항에 있어서,
    (i) 상기 인슐린 분비 펩타이드는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
    (ii) 상기 GLP-2는 이의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태이거나,
    (iii) 상기 인슐린 분비 펩타이드 및 GLP-2 각각은 이들의 생체 내 반감기를 증가시킬 수 있는 생체적합성 물질이 결합된, 지속형 결합체의 형태인 약학적 조성물.
  16. 제15항에 있어서, 상기 결합체는 하기 화학식 1로 표시되는 약학적 조성물:
    [화학식 1]
    X - La - F
    여기서,
    X는 인슐린 분비 펩타이드 또는 GLP-2이고;
    L은, 에틸렌글리콜 반복 단위를 함유하는 링커이며;
    a는, 0 또는 자연수이며, 다만 a가 2 이상일 때, 각각의 L은 서로 독립적이고;
    F는, 면역글로불린 Fc 영역이며;
    상기 "-"는 공유결합임.
  17. 제16항에 있어서, 상기 면역글로불린 Fc 영역은 비당쇄화된 IgG4 Fc 영역인 약학적 조성물.
  18. 제16항에 있어서, 상기 F는 두 개의 폴리펩타이드 사슬로 이루어진 이합체이며, L의 한 말단이 상기 두 개의 폴리펩타이드 사슬 중 하나의 폴리펩티드 사슬에만 연결되어 있는 약학적 조성물.
  19. 제16항에 있어서, 상기 L은 폴리에틸렌글리콜인 약학적 조성물.
  20. 제16항에 있어서, 상기 L 내의 에틸렌글리콜 반복 단위 부위의 화학식량은 1 내지 100 kDa 범위에 있는 약학적 조성물.
  21. 제1항 또는 제2항에 있어서, 상기 조성물은 약학적으로 허용가능한 담체, 부형제 또는 희석제를 추가로 포함하는 약학적 조성물.
  22. 제1항 또는 제2항에 있어서, 상기 인슐린 분비 펩타이드를 함유하는 조성물은 GLP-2를 함유하는 조성물과 동시, 순차적 또는 역순으로 병용 투여되는 것을 특징으로 하는 약학적 조성물.
PCT/KR2021/019854 2020-12-24 2021-12-24 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법 WO2022139552A1 (ko)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA3201916A CA3201916A1 (en) 2020-12-24 2021-12-24 Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome
AU2021409610A AU2021409610A1 (en) 2020-12-24 2021-12-24 Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome
MX2023007498A MX2023007498A (es) 2020-12-24 2021-12-24 Terapia de combinacion del peptido insulinotropico y glp-2, para prevenir o tratar el sindrome del intestino corto.
EP21911617.5A EP4302776A1 (en) 2020-12-24 2021-12-24 Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome
CN202180094229.4A CN116940370A (zh) 2020-12-24 2021-12-24 用于预防或治疗短肠综合征的促胰岛素肽和glp-2的组合疗法
IL303624A IL303624A (en) 2020-12-24 2021-12-24 Combined treatment of insulinotropic peptide and GLP-2, for the prevention or treatment of short bowel syndrome
US18/269,134 US20240299500A1 (en) 2020-12-24 2021-12-24 Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome
JP2023537538A JP2024503242A (ja) 2020-12-24 2021-12-24 短腸症候群の予防又は治療のためのインスリン分泌ペプチドとｇｌｐ－２の併用療法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0183440 2020-12-24
KR20200183440 2020-12-24

Publications (1)

Publication Number Publication Date
WO2022139552A1 true WO2022139552A1 (ko) 2022-06-30

Family

ID=82158214

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/019854 WO2022139552A1 (ko) 2020-12-24 2021-12-24 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법

Country Status (10)

Country Link
US (1) US20240299500A1 (ko)
EP (1) EP4302776A1 (ko)
JP (1) JP2024503242A (ko)
KR (1) KR20220092446A (ko)
CN (1) CN116940370A (ko)
AU (1) AU2021409610A1 (ko)
CA (1) CA3201916A1 (ko)
IL (1) IL303624A (ko)
MX (1) MX2023007498A (ko)
WO (1) WO2022139552A1 (ko)

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
JP2011506442A (ja) * 2007-12-11 2011-03-03 コンジュケム バイオテクノロジーズ インコーポレイテッド インスリン分泌性ペプチド結合体の製剤
KR20110110174A (ko) * 2008-12-19 2011-10-06 인디애나 유니버시티 리서치 앤드 테크놀로지 코퍼레이션 아미드 기반 글루카곤 슈퍼패밀리 펩티드 프로드럭
JP2014058528A (ja) * 2006-08-17 2014-04-03 Amylin Pharmaceuticals Llc 選択可能な特性を持つｄｐｐ−ｉｖ耐性ｇｉｐハイブリッドポリペプチド
KR20190037181A (ko) 2017-09-28 2019-04-05 한미약품 주식회사 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
JP2014058528A (ja) * 2006-08-17 2014-04-03 Amylin Pharmaceuticals Llc 選択可能な特性を持つｄｐｐ−ｉｖ耐性ｇｉｐハイブリッドポリペプチド
JP2011506442A (ja) * 2007-12-11 2011-03-03 コンジュケム バイオテクノロジーズ インコーポレイテッド インスリン分泌性ペプチド結合体の製剤
KR20110110174A (ko) * 2008-12-19 2011-10-06 인디애나 유니버시티 리서치 앤드 테크놀로지 코퍼레이션 아미드 기반 글루카곤 슈퍼패밀리 펩티드 프로드럭
KR20190037181A (ko) 2017-09-28 2019-04-05 한미약품 주식회사 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
K.B. MADSEN, C. ASKOV-HANSEN, R.M. NAIMI, C.F. BRANDT, B. HARTMANN, J.J. HOLST, P.B. MORTENSEN, P.B. JEPPESEN: "Acute effects of continuous infusions of glucagon-like peptide (GLP)-1, GLP-2 and the combination (GLP-1+GLP-2) on intestinal absorption in short bowel syndrome (SBS) patients. A placebo-controlled study", REGULATORY PEPTIDES, ELSEVIER, vol. 184, 1 June 2013 (2013-06-01), pages 30 - 39, XP055183143, ISSN: 01670115, DOI: 10.1016/j.regpep.2013.03.025 *
LJUNGMANN K. ET AL., AM. J. PHYSIOL. GASTROINTEST LIVER PHYSIOL., vol. 281, no. 3, 2001, pages G779 - 85

Also Published As

Publication number Publication date
CA3201916A1 (en) 2022-06-30
AU2021409610A9 (en) 2024-09-26
JP2024503242A (ja) 2024-01-25
EP4302776A1 (en) 2024-01-10
KR20220092446A (ko) 2022-07-01
CN116940370A (zh) 2023-10-24
AU2021409610A1 (en) 2023-07-06
IL303624A (en) 2023-08-01
MX2023007498A (es) 2023-07-05
US20240299500A1 (en) 2024-09-12

Similar Documents

Publication Publication Date Title
WO2017116205A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체
AU2016287209B2 (en) Glucagon derivative and a composition comprising a long acting conjugate of the same
WO2012173422A9 (en) A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
WO2018004283A2 (ko) 글루카곤 유도체, 이의 결합체, 및 이를 포함하는 조성물, 및 이의 치료적 용도
WO2017052321A1 (ko) 다수의 생리활성 폴리펩타이드 및 면역글로불린 Fc 영역을 포함하는, 단백질 결합체
WO2015152618A1 (ko) 면역글로불린 fc 단편 결합을 이용한 단백질 및 펩타이드의 용해도를 개선시키는 방법
WO2022211537A1 (ko) 신규한 면역 활성 인터루킨 2 아날로그 결합체 및 이의 제조 방법
WO2020071865A1 (ko) 글루카곤 및 이를 포함하는 조합물의 치료학적 용도
WO2019066586A1 (ko) 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체
WO2020130749A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물
WO2017155288A1 (ko) 폴리에틸렌 글리콜 유도체 및 이의 용도
WO2017116207A1 (ko) Fgf21 아날로그, fgf21 결합체, 및 이의 용도
WO2018174668A2 (ko) 인슐린 수용체와의 결합력이 감소된 인슐린 아날로그의 결합체 및 이의 용도
WO2022015082A1 (ko) 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도
WO2021201654A1 (ko) Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물
WO2021066600A1 (ko) 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도
WO2020214013A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도
WO2022216129A1 (ko) 글루카곤 유도체를 포함하는 만성 신장 질환 예방 또는 치료용 약학 조성물
WO2020263063A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도
WO2020130751A1 (ko) 인슐린 및 글루카곤을 포함하는 약학 조성물
WO2023106845A1 (ko) 신규한 아디포넥틴 아날로그 및 결합체
WO2021235913A1 (ko) Glp-2의 지속형 결합체의 액상 제제
WO2021133087A1 (ko) Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물
WO2021235907A1 (ko) 글루카곤 유도체의 지속형 결합체의 액상 제제
WO2022139552A1 (ko) 단장증후군의 예방 또는 치료를 위한 인슐린 분비 펩타이드 및 glp-2의 병용 요법

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21911617

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3201916

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023537538

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/007498

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 18269134

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 202317042271

Country of ref document: IN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023012413

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2021409610

Country of ref document: AU

Date of ref document: 20211224

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112023012413

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230621

WWE Wipo information: entry into national phase

Ref document number: 2023115737

Country of ref document: RU

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021911617

Country of ref document: EP

Effective date: 20230724

WWE Wipo information: entry into national phase

Ref document number: 202180094229.4

Country of ref document: CN