WO2019035672A1 - Acylated oxyntomodulin peptide analog - Google Patents

Acylated oxyntomodulin peptide analog Download PDF

Info

Publication number
WO2019035672A1
WO2019035672A1 PCT/KR2018/009425 KR2018009425W WO2019035672A1 WO 2019035672 A1 WO2019035672 A1 WO 2019035672A1 KR 2018009425 W KR2018009425 W KR 2018009425W WO 2019035672 A1 WO2019035672 A1 WO 2019035672A1
Authority
WO
WIPO (PCT)
Prior art keywords
compound
seq
peptide
lys
asp
Prior art date
Application number
PCT/KR2018/009425
Other languages
French (fr)
Korean (ko)
Inventor
양재성
이경석
채유나
백계림
김태형
정일훈
류채림
임원빈
Original Assignee
동아에스티 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201880053473.4A priority Critical patent/CN111094331B/en
Priority to NZ761754A priority patent/NZ761754B2/en
Priority to CN202310958807.5A priority patent/CN116854804A/en
Priority to JP2020508489A priority patent/JP7211659B2/en
Priority to CN202410003809.3A priority patent/CN117603337A/en
Priority to AU2018318672A priority patent/AU2018318672B2/en
Priority to BR112020003319-7A priority patent/BR112020003319A2/en
Priority to CA3073011A priority patent/CA3073011C/en
Priority to EP22170622.9A priority patent/EP4079757A1/en
Priority to SG11202001283PA priority patent/SG11202001283PA/en
Priority claimed from KR1020180095717A external-priority patent/KR102230363B1/en
Priority to EP18846196.6A priority patent/EP3670529B1/en
Priority to MX2020001761A priority patent/MX2020001761A/en
Priority to RU2020108518A priority patent/RU2752787C1/en
Priority to US16/638,970 priority patent/US11236142B2/en
Application filed by 동아에스티 주식회사 filed Critical 동아에스티 주식회사
Publication of WO2019035672A1 publication Critical patent/WO2019035672A1/en
Priority to IL272606A priority patent/IL272606A/en
Priority to PH12020500338A priority patent/PH12020500338A1/en
Priority to SA520411366A priority patent/SA520411366B1/en
Priority to US17/410,697 priority patent/US11713344B2/en
Priority to JP2021175902A priority patent/JP7443315B2/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • the present invention relates to a pharmaceutical composition which can be used for the prophylaxis or treatment of oxytocmodulin peptide analogues and non-insulin dependent diabetes mellitus including obesity, overweight, or concomitant therapies.
  • Metabolic Disease is a disease caused by metabolic abnormalities such as glucose, fat, and protein. It is mainly caused by abnormalities of glucose and fat metabolism, cancer, diabetes, bone metabolic diseases, fatty liver, obesity and cardiovascular diseases. Collectively. The criteria for the diagnosis of metabolic diseases according to the International Diabetes Federation (IDF), published in 2001, in the US National Cholesterol Education Program (NCEP) adult treatment panel III (ATP III) As follows.
  • the worldwide prevalence of obesity has more than doubled between 1980 and 2014, and in 2014, 39% of adults over age 18 (38% of men and 40% of women) , 13% (male 11%, female 15%) were obese.
  • the main causes of obesity and overweight are energy inequalities between caloric intake and consumption, which result in a decrease in physical activity due to high fat, high-energy diet, modern social work, changes in transportation, It is considered a risk factor.
  • the prevalence of diabetes also increased rapidly from 4.7% in 1980 to 8.5% in 2015 among adults over 18 years of age. Diabetes mellitus prevalence is growing more rapidly in middle-income and low-income countries and is a major cause of blindness, kidney failure, heart attack, and stroke.
  • Glucagon is a hormone produced by the alpha cells of the pancreas. It plays an important role in increasing blood sugar by decomposing glycogen stored in the liver and glucose synthesis in the liver. When the stored glycogen is depleted, glucagon causes the liver and kidney to synthesize glucose, It is known that appetite suppression and decomposition of stored triglycerides into fatty acids have an effect on weight loss by increasing energy metabolism (Diabetes.co.uk., Global Diabetes Community, Anim Sci. 9): 1090-1098).
  • GLP-1 Glucagon-like peptide-1
  • GLP-1 is one of the glucagon derivatives and is a peptide hormone that plays a role in reducing blood sugar. It is secreted by the L-cells of the small intestine and has a half-life of less than 2 minutes. When the secretion is increased by glucose, it induces insulin secretion in pancreatic beta cells, ultimately controlling blood glucose and improving beta cell function . It also has the function of inhibiting glucagon secretion, inhibiting gastric emptying, and reducing food intake (Physiol Rev. 2007; 87 (4): 1409-1439).
  • Liraglutide is a human GLP-1 derivative that is injected once a day as a treatment for the development of type 2 diabetes and obesity indications.
  • Liraglutide is a persistent GLP-1 receptor agonist that binds to the same receptor as endogenous GLP-1 to promote glucose-dependent insulin secretion, thereby regulating blood sugar, reducing appetite, inhibiting weight gain and lowering triglycerides. Victoza for obesity and Saxenda for obesity (Expert Rev Cardiovasc Ther. 2015; 13 (7): 753-767).
  • Exenatide Lixisenatie, albiglutide and dulaglutide have been developed for the treatment of diabetes.
  • side effects of these GLP-1 receptor agonists have been reported to include nausea, vomiting and loss of appetite, headache and constipation, and the occurrence of abdominal distension (Korean J Med. 2014; 87 (1): 9-13).
  • Oxytomodulin is a peptide derived from proglucagon, a precursor of glucagon. It is composed of 37 amino acid peptides containing the complete 29 amino acid sequence of glucagon. It has a double action binding to both GLP-1 and glucagon receptors Respectively. This effect of oxytomodulin is known to be superior to that of selective GLP-1 receptor agonists, and the risk of hyperglycemia due to glucose uptake due to glucagon receptor activation is also increased The insulin secretion by the GLP-1 receptor has been reported to be able to regulate blood glucose. Oxytomodulin has been reported to improve feed intake, weight loss and energy expenditure and glucose metabolism in nonclinical studies (Diabetes.
  • a DPP-IV resistant oxytomodulin derivative capable of selectively binding GLP-1 and glucagon receptors in a balanced manner to overcome the adverse effects of each hormone peptide for a prolonged period of action of oxytomodulin in pharmacological and therapeutic aspects (Diabetes. 2009; 58 (10): 2258-2266), the development of leading substances in various companies such as Merck, Zealand, Medimmune, It is in progress.
  • the present invention provides a method for producing a compound of the present invention, which comprises: (1) providing resistance to DPP-IV; (2) optimizing metabolic stability by acylation; (3) synthesizing GLP-1 and glucagon receptors
  • the present invention relates to a therapeutic pharmaceutical composition for use in the treatment of diabetes accompanied by obesity or obesity through the development of auxin to modulin peptide analogues.
  • an oxytocmodulin analog and a pharmaceutical composition comprising the same, which can be used in the prevention or treatment of conditions caused or characterized by obesity or overweight, or non-insulin dependent diabetes accompanied by them, by providing a tomodulin peptide analogue will be.
  • the present invention provides a novel peptide comprising an amino acid sequence of the following formula I, which is an oxytomodulin peptide analogue.
  • X 1 is Ser or Aib (aminoisobutyric acid);
  • X 2 is Asp or Z
  • X 3 is Tyr or Z
  • X 4 is Ser or Z
  • X 5 is Lys or Z
  • X 6 is Tyr or Z
  • X 7 is Leu or Z
  • X 8 is Asp or Z
  • X 9 is Ser, Aib (aminoisobutyric acid) or Z;
  • X 10 is Gln or Z
  • X 11 is Met or Leu
  • X 12 is Asn or Arg
  • X 13 is Thr or Ala
  • X 14 is Lys or Z
  • X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
  • X < 16 > is Z or absent when X < 15 > is present;
  • the C-terminal amino acid may optionally be amidated
  • X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14 or X 16 is Z;
  • Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z < 1 & gt ;, Z & lt ; 1 > is the following structural formula (1)
  • Z 2 is the following structural formula (3) or (4).
  • " oxyntomodulin " in the present invention means a peptide made from pre-glucagon, which is a precursor of glucagon, and the native oxytomodulin means an amino acid sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO.1) .
  • Z 1 which is one of the constituents of Z, is a copolymer having a polymeric portion as polyethylene glycol, a monomer having ethylene glycol, ethanolamine, lactic acid, or a polyamino acid copolymer having glycine and serine as monomers
  • the poly-amino acid may be the amino acid sequence of GGSGSG (SEQ ID NO. 52), and the compound of the present invention may have two or more repeating units of the polymeric moiety.
  • Z 1 may have at one end any moiety of the above-described oxynthomodulin peptide analog or a functional group for attachment to its side chain.
  • an acyl group which in this case may be attached in the form of an amide bond to the amino group of the side chain
  • Z 1 may have a functional group for bonding to the spacer at one end.
  • an amino group in which case it may be attached in the form of an amide bond to the carboxyl group of the spacer
  • Z 1 is preferably water-soluble and thus may be amphipathic or hydrophilic.
  • the spacer is an L- glutamic acid residues
  • the carboxylic acid is ⁇ - polymeric part of Z 1 and covalent bonds
  • ⁇ - amino group may be part of the lipophilic lipid
  • Z 2 is a covalent bond, at least two repeating units Lt; / RTI >
  • the lipid moiety of Z 2 is directly conjugated to the spacer, the spacer is conjugated directly to the polymeric moiety, and the polymeric moiety is linked to the X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14, or X 16 , and preferably the junction Lys may be introduced as an enabling amino acid residue.
  • Z 2 is a peptide derivative comprising a C 14 -C 20 saturated hydrocarbon chain, wherein the terminal carbon of the hydrocarbon chain is in a carboxylic acid form, a primary amide form, or a carboxylic acid form covalently linked to any single amino acid.
  • the hydrocarbon chain may be branched or straight.
  • the functional group necessary for attaching the hydrocarbon chain to the spacer forms a part of the lipid moiety mentioned above and may include an acyl group, a sulfonyl group, an N atom, an O atom, an S atom, and the like.
  • the spacer attachment can be via an ester, a sulfonyl ester, a thioester, an amide or a sulfonamide.
  • the hydrocarbon chain is bonded to the amino group of the spacer in the form of an amide bond through an acyl group, and thus the hydrocarbon chain may be part of the form of an alkanoyl group in particular.
  • the lipophilic lipid moiety binds to albumin in the blood stream, thereby preventing the compound of the present invention from reacting as a substrate for various degrading enzymes in the bloodstream, thereby improving its in vivo half-life ≪ / RTI >
  • one or more amino acid side chains in an oxytomodulin peptide analogue are conjugated to a lipophilic lipid moiety through a polymeric moiety and a spacer, such chemical modification being dependent on the in vivo solubility and / or hydrophobicity of the oxytocmodulin peptide derivative of the present invention It is possible to induce a pharmacologically favorable effect such as increasing half-life and / or increasing bioavailability.
  • novel peptide comprising the amino acid sequence of the above Formula I can be prepared by substituting Aib for the Ser residue present at the 2-position of the native type auxin tomodulin.
  • a compound as given in the embodiments of the present invention auxin Sat module Lin peptide analogs as if Aib is introduced into X 1 position, to have greater resistance to dipeptidyl peptidase IV as compared to auxin Sat module lean natural It is considered.
  • the oxytocmodulin peptide analogues of the present invention have improved in vivo stability compared to the native oxytomodulin.
  • the acylated oxytomodulin peptide analogue according to the present invention can be obtained by substituting Leu for the Met residue at position 27 of the native oxytomodulin and substituting Leu for the Asn residue at position 28 with Arg time to can be prepared substituting a Thr residue present in the Ala position, to an example of embodiments compound 12 for (SEQ ID NO. 13), X 11 position Leu, the X 12 position Arg, X 13 position With Ala.
  • the oxytocmodulin peptide derivative preferred in the present invention is a novel peptide comprising the amino acid sequence of the following formula (I-1).
  • X 1 is Ser or Aib (aminoisobutyric acid);
  • X 3 is Tyr or Z
  • X 9 is Ser, Aib or Z
  • X 10 is Gln or Z
  • X 11 is Met or Leu
  • X 12 is Asn or Arg
  • X 13 is Thr or Ala
  • X 14 is Lys or Z
  • X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
  • X 16 is Z or absent when X 15 is present, the C-terminal can be amidated
  • Embodiments comprising the peptide analog of Formula I above include Compound 1 (SEQ ID NO. 2), Compound 2 (SEQ ID NO. 3), Compound 3 (SEQ ID NO. 4), Compound 4 (SEQ ID NO. 5), Compound 5 (SEQ ID NO. 6), Compound 6 (SEQ ID NO. 7), Compound 7 (SEQ ID NO. 8), Compound 8 (SEQ ID NO. 10), Compound 10 (SEQ ID NO. 11), Compound 11 (SEQ ID NO. 12), Compound 12 (SEQ ID NO. 13), Compound 13 (SEQ ID NO. 14), Compound 15 (SEQ ID NO. 16), Compound 16 (SEQ ID NO. 17), Compound 17 (SEQ ID NO. 18), Compound 18 (SEQ ID NO.
  • the oxytocmodulin peptide analogue of formula (I) according to the present invention may include one or more intramolecular crosslinks in the amino acid sequence, that is, X 9 and X 10 may be linked by an intramolecular bond (lactamation, di- linkers to form cyclic peptides.
  • X 17 is Ser or Aib (Aminoisobutric acid);
  • X 18 is Z
  • X 19 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
  • X 20 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
  • X 19 and X 20 can form a cyclic peptide through an intramolecular bond or a cross linker, wherein the cyclic peptide has a lactam ring formed by an amide bond between two residues, or a di-sulfide bond between two residues A peptide with a cross-linked ring formed by a cross-linker bond between the formed di-sulfide ring or two residues;
  • the C-terminal amino acid may be amidated in situ
  • Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z < 1 & gt ;, Z & lt ; 1 > is the following structural formula (1)
  • Z 2 is the following structural formula (3) or (4).
  • Bond in the molecule of X 19 and X 20 is X 19 and X 20 each Asp (or Glu) and Lys (or Orn) when the or each Lys (or Orn) and Asp (or Glu) when a bond in the lactam ring formation molecular ;
  • An intramolecular di-sulfide ring forming bond when X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively;
  • X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively, the cross linker is bonded to the thiol functional group of both Cys (or Hcy) side chains to form a ring, C 1 -C 6 straight or branched chain alkyl, C 3 -C 8 saturated or unsaturated cycloalkyl, C 6 -C 10 aryl, or C 5 -C 12 heteroaryl or fused heterocyclic aryl,
  • R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
  • the cross linker forms a ring with the amide bond to the carboxyl group of both Asp (or Glu) side chains, Di-amino C 1 -C 6 straight or branched chain alkyl, di-amino C 3 -C 8 saturated or unsaturated cycloalkyl, aminopiperidine, piperazine, di-amino C 6 -C 10 aryl, or di-amino C 5 -C 12 heteroaryl or fused heterocyclic aryl,
  • R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
  • R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl
  • the cross linker is the carboxyl group of the Asp
  • the amine group of the side chain of Lys (or Orn) is connected to the carboxyl group of the cross linker by an amide bond to form a ring, and the cross linker ) May be selected from the group consisting of alpha amino acids (Gly, VaI, Leu, Ile, etc.), beta amino acids, carbonyl C 1 -C 6 linear or branched alkylamines, carbonyl C 3 -C 8 saturated or unsaturated alkylamines, , Aminobenzoyl, carbonyl C 6 -C 10 arylamine or carbonyl C 5 -C 12 heteroarylamine or fused heterocyclic arylamine, preferably
  • R is hydrogen or C 1 -C 6 linear or branched alkyl.
  • Examples of embodiments that include peptide analogs of Formula II that may have one or more intramolecular bridging within the amino acid sequence of Formula I include Compound 14 (SEQ ID NO. 15), Compound 19 (SEQ ID NO. 20), Compound 20 (SEQ ID NO. 21), compound 21 (SEQ ID NO. 22), compound 22 (SEQ ID NO. 23), compound 23 (SEQ ID NO. 26), Compound 27 (SEQ ID NO. 28), Compound 28 (SEQ ID NO. 29), Compound 29 (SEQ ID NO. (SEQ ID NO. 32), Compound 32 (SEQ ID NO. 33), Compound 33 (SEQ ID NO. 34), Compound 34 (SEQ ID NO. (SEQ ID NO. 37), compound 37 (SEQ ID NO. 38), compound 38 (SEQ ID NO.
  • the cross-linking of the peptide of formula (II) may be carried out by chemical covalent bonding between any two functional groups in a residue or side chain of two arbitrary amino acids separated by three amino acids in the sequence of formula (I) Lt; / RTI >
  • the amino acid side chains of the X 19 residue and the X 20 residue are cross-linked while forming a lactone ring, lactam ring or di-sulfide ring, and the amino acid side chain of the X 19 residue and the X 20 residue is cross- linker may be formed by forming a ring through the connection of the linker.
  • novel peptide comprising the amino acid sequence of the above formula (II) can be obtained by substituting Cys or Hcy for the Ser residue present at position 16 of the natural aroma oxytomodulin and replacing the Gln residue at position 20 with Cys or Hcy (SEQ ID NO. 29) in the following embodiments, substituting Cys at position X 19 and Cys at position X 20 to form a di-sulfide ring in the molecule. to form a di-sulfide ring.
  • acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Cys or Hcy for the Ser residue present at position 16 of the natural incoicotomodulin and substituting Cys or Gln for the Gln residue at position 20 (SEQ ID NO: 23) in the following embodiments, the X 19 position may be replaced by Cys, X may be replaced with Cys, 20 position to Cys and then connecting the two residues with a cross linker to form a ring.
  • acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 27), substituting Asp for the position of X 19 and Lys for the position of X 20 in the case of Compound 26 (SEQ ID NO. 27) in the following embodiments, (SEQ ID NO. 25), compound 20 (SEQ ID NO. 21), compound 24 (SEQ ID NO. 25) , Compound 25 (SEQ ID NO. 26) can be prepared by replacing the X 19 position with Glu and the X 20 position with Lys to form a lactam ring in the molecule.
  • acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 38), compound 38 (SEQ ID NO. 39) in the following embodiments, and the like can be produced by forming a ring by linking two residues with a cross linker after substitution with Orn.
  • SEQ ID NO. 34 Compound 34 (SEQ ID NO. 34), and Compound 34 (SEQ ID NO. 34) can be prepared by substituting Asp for the position of X 19 and Lys for the position of X 20 and then connecting the two residues using a cross linker.
  • the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or (SEQ ID NO. 22) in the following embodiments, the X 19 position is replaced with Lys, the X 20 position is replaced with Glu, and the molecule (27) (SEQ ID NO. 28) can be prepared by substituting Lys at position X 19 and Asp at position X 20 to form a lactam ring in the molecule.
  • the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or Glu, and then connecting the two residues using a cross linker to form a ring.
  • Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin
  • the Gln residue at position 20 for Asp or Glu for connecting the two residues using a cross linker to form a ring.
  • the X 19 position is substituted with Lys, X 20 position with Glu and then connecting the two residues with a cross linker to form a ring.
  • acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Asp or GIu for the Ser residue present at position 16 of the natural flavor oxin tosomandrin, converting the Gln residue at position 20 to Asp (SEQ ID NO. 24), compound 29 (SEQ ID NO. 30) in the following embodiments, and the like.
  • Compound 30 (SEQ ID NO: 31) can be prepared by replacing the X 19 position with Glu and the X 20 position with Glu, and then connecting the two residues with a cross linker to form a ring.
  • the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for replacing the Gln residue at position 20 with Lys or Orn and then connecting two residues using a cross linker to form a ring.
  • Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin
  • the Gln residue at position 20 with Lys or Orn
  • the X 19 position is substituted with Lys, X 20 position with Lys and then connecting the two residues with a cross linker to form a ring.
  • Such intramolecular crosslinking is believed to stabilize the alpha helical structure of the peptide to increase its selectivity or pharmacological efficacy at the GLP-1 receptor and / or glucagon receptor (ACS Chem Biol. 2016; 11: 324-328).
  • auxin to moduline peptide analogs of the present invention can be chemically modified.
  • each amino acid residue of the peptide can be directly linked to various spacers or linkers, and each residue can undergo chemical reactions such as alkylation, disulfide bond formation, metal complexation, amidation, esterification, oxidation, It can be transformed into a corresponding chemical product.
  • any carboxy terminal or amino terminal present in the auxin tomodulin peptide analogue structure of the present invention can be analogized through esterification, amidation, acylation, and the like.
  • the oxytomodulin peptide analog of the present invention may be provided as an acid addition salt of any amine group present in its structure or as a carboxylate salt of any carboxyl group or an alkali addition salt thereof.
  • the present invention also relates to a pharmaceutical composition for preventing and treating obesity or overweight and accompanying diabetes comprising the peptide analogue as an active ingredient and a pharmaceutically acceptable excipient.
  • " prevention " of the present invention means all actions that inhibit or delay the onset of the desired disease.
  • " treatment " of the present invention means any action that alleviates, alleviates, or alleviates the symptoms of the disease that has occurred.
  • the peptide analogs of the present invention exhibit both the effect of GLP-1 on food intake and the effect of glucagon on fat metabolism and energy consumption as dual agonists for the glucagon receptor and GLP-1 receptor,
  • a pharmaceutical composition for the prevention and treatment of obesity or overweight and accompanying diabetes comprising a peptide analogue can induce a medically beneficial effect in the control of body weight through the combined effect of excessive accumulation of fat and inhibition of food intake have.
  • the peptide analog of the present invention and the pharmaceutical composition containing the same can be used for prevention or treatment of diabetes accompanied by obesity by reducing blood sugar. It can be used to treat type 2 diabetes, especially non-insulin dependent diabetes mellitus with obesity.
  • the pharmaceutical composition comprising the peptide analog of the present invention is one of the glucagon derivatives, and has a high activity on the GLP-1 receptor which plays a role in reducing blood glucose, and is ultimately useful for controlling blood glucose .
  • the pharmaceutical compositions comprising the peptide analogs of the present invention are useful for the treatment and prevention of obesity, pathological obesity, preoperative obesity, obesity related inflammation, obesity related gallbladder disease, obesity induced sleep apnea, obesity associated diabetes, As a direct or indirect treatment of any condition caused or characterized by, or in combination with, other related agents.
  • the pharmaceutical compositions containing the peptide analogs of the present invention may be used for the treatment of conditions which may result from or be associated with weight gain, such as metabolic syndrome, hypertension, atherosclerotic dyslipidemia, atherosclerosis, arteriosclerosis, Heart disease, or stroke, or may be co-administered with other related agents.
  • " administration " means introducing a substance for therapeutic use into a patient in an appropriate manner, and the pharmaceutical composition containing the peptide analog of the present invention can be administered to a patient in a variety of ways May be administered via various routes in the form of a formulation. Intraperitoneal, intravenous, intramuscular, subcutaneous, intradermal, oral, topical, intranasal, intrapulmonary, rectal, and the like, but the formulation and administration method is not limited.
  • compositions comprising the oxytomodulin peptide analogs of the present invention may comprise a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizing agent, a dispersing agent, a stabilizer, a suspending agent, a colorant, a perfume or the like in the case of oral administration.
  • a solubilizing agent, an isotonic agent, a stabilizing agent, etc. may be used in combination.
  • a base, an excipient, a lubricant, a preservative, etc. may be used in various ways.
  • Examples of carriers, excipients and diluents that can be used in the formulation of the oxytomodulin peptide analog of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin , Calcium phosphate, calcium silicate, cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil.
  • compositions containing the oxytomodulin peptide analogs of the present invention can be prepared in various manners by mixing with the carriers described above.
  • oral administration may be in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc.
  • unit dosage ampoules or multiple dosage forms may be prepared.
  • it can be formulated into solutions, suspensions, tablets, pills, capsules, sustained release formulations and the like.
  • the dosage or dose according to the present invention varies depending on the patient's body weight, age, sex, health condition, diet, excretion rate and severity of the disease, and the dose is 0.001 mg / kg to 500 mg / kg.
  • the present invention provides novel acylated oxytomodulin peptide analogs wherein the peptide analogs of the present invention have greater activity against both the GLP-1 receptor and the glucagon receptor than the native oxytomodulin.
  • the present invention shows a higher biological activity as a glucagon receptor agonist compared to the GLP-1 receptor.
  • the present invention provides a pharmaceutical composition comprising a novel acylated auxin tomodulin peptide analogue, which is useful primarily in the prevention or treatment of conditions caused or characterized by obesity or overweight, and further, May also be used for the purpose of preventing or treating the accompanying non-insulin dependent diabetes mellitus.
  • FIG. 1 is a graph showing the effect of the acylated oxytomodulin analogues of the present invention on the single- Fig.
  • FIG. 2 is a graph showing the results of evaluating the effects of acylated oxytomodulin peptide analogues of the present invention on the reduction of weight loss for one week in a mouse.
  • FIG. 2a is a graph showing weight loss results and
  • FIG. 2b is a graph showing cumulative feed intake results.
  • FIG. 3 is a graph showing the result of 5-day repeated weight loss effect evaluation of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 3 a is a graph showing weight loss results and FIG. 3 b is a graph showing cumulative feed intake results.
  • FIG. 4 is a graph showing the result of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 4A is a graph showing weight loss results and FIG. 4B is a graph showing cumulative feed intake results.
  • FIG. 5 is a graph showing the results of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 5A is a graph showing weight loss results and FIG. 5B is a graph showing cumulative feed intake results.
  • FIG. 6 is a graph showing the result of evaluating the effect of acylated oxytomodulin peptide analogue of the present invention on the reduction of weight loss for one week in a mouse.
  • FIG. 6A is a graph showing weight loss results and
  • FIG. 6B is a graph showing cumulative feed intake results.
  • FIG. 7 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the weight reduction effect for two weeks in a mouse, wherein FIGS. 7A and 7C are weight loss results, and FIG. FIG. 7D is a graph showing cumulative feed intake results of acylated auxin tomodulin peptide analogues shown in FIG. 7C. FIG. 7D is a graph showing cumulative feed intake results of actual oxyntomodulin peptide analogues.
  • FIG. 8 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the reduction of weight loss for two weeks in a mouse.
  • FIG. 8A is a graph showing weight loss results
  • FIG. 8B is a graph showing cumulative feed intake results.
  • FIG. 9 is a graph showing the result of 5-day repeated weight loss effect evaluation in mice of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 9A is a graph showing weight loss results and FIG. 9B is a graph showing cumulative feed intake results.
  • FIG. 10 is a graph showing the result of weight loss reduction effect evaluation of the acylated oxytomodulin peptide analogue according to the present invention for 4 weeks in a mouse, wherein FIG. 10A is a weight loss result, FIG. 10B is a body fat reduction result, Fig.
  • FIG. 11 is a graph showing the results of assaying the potency of acylated oxytomodulin peptide analogues in the mouse according to the present invention.
  • FIG. 12 is a graph showing the results of evaluating the blood glucose-modulating effect of the acylated oxytomodulin peptide analogue according to the present invention for 6 weeks in a mouse, wherein FIG. 12A is a final non-fasting blood glucose result, and FIG. Graph.
  • FIG. 13 is a graph showing the results of evaluating the effect of acylated auxin tomodulin peptide analogue according to the present invention on the blood glucose control effect for four weeks in a mouse, wherein FIG. 13A is a time- FIG.
  • amino acid-containing peptides and regular peptide sequences of the invention can be synthesized and purchased through commercialized peptide synthesis companies, such as the American peptide company in the United States or Bachem in the United States, or Anygen in Korea.
  • an acylated oxytomodulin peptide analog was synthesized using a symphomy X (synthetic scale: 0.1 mmol) model of an automatic synthesizer, protein technologies, Inc.,
  • the structures of Compound 1 (SEQ ID NO. 2) to Compound 38 (SEQ ID NO. 39), which are modulin peptide analogues, are shown in Table 1 and Table 2.
  • the specific synthesis procedure is as follows.
  • the K (Lys) side synthesis is coupled using Fmoc-K (dde) -OH and the last H (His) is coupled using Boc-His (trt) -OH. After removal of the protected dde using 2% hydralazine, PEG2, rE, C18, C18 diacid, etc. are coupled.
  • the lactam ring synthesis is carried out using amino acids incorporated with Glu (Oall) and Lys (Alloc), followed by lactam coupling using excess HBTU and DIPEA after removal of the protecting group.
  • the di-sulfide ring is coupled using a ser amino acid incorporated as a protecting group, followed by removal of the protecting group, followed by di-sulfide bonding.
  • Coupling is performed using an amino acid incorporated with an appropriate protecting group at a position where a cross linker is to be introduced, and a linker and a two amino acid bond are performed using an amide coupling reagent or the like after removing the protecting group.
  • an oximostomulin peptide analogue having structural similarity was synthesized by the method of Example 1.
  • the following compounds 39 are nonacylated oxytomodulin peptide analogs
  • compounds 40 and 41 are oximodomaine peptide analogs with different acylation positions
  • compounds 42 to 46 are different oximounderin peptide analogs with acylated ends
  • Compound 47 is a nonacylated oxytomodulin peptide analogue having a ring structure, which is disclosed in Korean Laid-Open Patent Publication No. 2012-139579.
  • the structures of the synthesized oxynomodulin peptide analogues of the compounds 39 to 47 are shown in Tables 3 and 4.
  • cyclic adenosine monophosphate which is elevated by transiently overexpressing human GLP-1 or glucagon receptors in cells by activating receptors of the present invention, activates the cyclic adenosine monophosphate reactive promoter (CRE)
  • CRE cyclic adenosine monophosphate reactive promoter
  • GLP-1 and glucagon were used for evaluation.
  • GLP-1 agonist was approved as a diabetic drug, Liraglutide, Semaglutide, and oxytocmodulin peptide analogue, and MEDI0382 (Diabetes, Obesity and Metabolism 2016; 18: 1176-1190, Lancet 2018; 391: 2607-2618) And the peptides of the above compounds 39 to 47 were synthesized, and these were compared as a comparative example.
  • Cells were transfected with Chinese hamster ovary (CHO-K1) human GLP-1 or glucagon expression vector (Origene) to induce firefly luciferase or renilla luciferase expression (Lipofectiamine Plus reagent, Invitrogen) with the plasmid DNAs of the transfected cells. After 3 hours of transfection, the cells were exchanged with nutrient medium ( ⁇ -MEM) containing 10% fetal bovine serum (FBS). On the next day, the cells were exchanged with ⁇ -MEM medium containing the analog of the present invention and 0.1% bovine serum albumin (BSA).
  • ⁇ -MEM nutrient medium
  • FBS fetal bovine serum
  • the activity of the receptor is determined by conducting multiple concentration assessments of the analogs of the present invention to determine the relative activity (%) for the GLP-1 or glucagon maximal effects of the analogs of the invention to determine the concentration (EC 50 )
  • the values calculated using nonlinear regression analysis are shown in Table 5.
  • the acylation auxin Sat module compound the lean analogs are endogenous hormones auxin Sat module is lean than GLP-1 and the activity of the EC 50 value is significantly lower GLP-1 and glucagon receptors for glucagon receptor Great according to the invention Able to know.
  • MEDI0382 which is a clinical analogue of auxin tomodulin, the activity against GLP-1 receptor was superior and GLP-1 receptor -1 receptor were similar.
  • Compound 3 an acylated auxin tomodulin peptide analogue according to the present invention, was found to greatly increase the activity against GLP-1 and glucagon receptors when compared to Compound 39 of the comparative example, which is a nonacylated oxytomodulin peptide analogue , Indicating that the acylation of auxin to modulin peptide analogs has a significant effect on the increase in activity.
  • the compound 40 of the comparative example which was acylated at the position of X 2 and the compound 41 of the comparative example which was acylated at the position of X 14 were the compound 3 according to the present invention which was acylated at the positions of X 3 , X 9 and X 10 , Compared with compounds 15 and 16, it was found that the activity against GLP-1 and glucagon receptors was greatly reduced. Thus, it is estimated that the position of acylation with respect to auxin tomodulin peptide analogue greatly affects the activity.
  • acylated compounds 3, 10, 17 and 18 according to the present invention each having 1 to 4 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups as the polymeric part of Z 1
  • 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups There was no difference in in vitro activity according to the number of 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups, and both GLP-1 and glucagon receptor activities were excellent.
  • Comparative Example Compound 47 showed lower activity on the glucagon receptor than Compound 14 according to the present invention, which has the same type of lactam ring structure in the molecule, Acylation of the lean peptide analogue leads to increased activity.
  • the compound 28 having an intramolecular bond with di-sulfide has a higher affinity for GLP-1 and a glucagon receptor than the other acylated auxin tomodulin cyclic peptide analog 22
  • the activity was low, indicating that the intramolecular ring size of the acylated oxytomodulin cyclic peptide analogue has an effect on activity.
  • acylated oxytomodulin peptide analogues according to the present invention, a diet containing high fat was fed to male mice (C57BL / 6 mice) and mice fed with obesity were fed high fat diets Were used to evaluate the body weight before and after the experiment.
  • Compound 3 according to the present invention was prepared so as to have a dose of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then injected into mice in a single subcutaneous injection. Thereafter, body weight and feed intake were measured once a day, Respectively.
  • acylated oxytomodulin peptide analogue In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the therapeutic effect of diabetes / obesity on the market, a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before exercise.
  • Compound 3 was prepared to have a concentration of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide, a commercially available diabetic / kg, and then subcutaneously injected once a day for a total of 6 days as shown in Table 6.
  • the body weight and feed intake were measured once a day at a constant time to compare the efficacy of the acylated oxytomodulin analogues with respect to liraglutide. From the seventh day, the administration was stopped and the recovery of body weight was confirmed. 2b.
  • the cumulative feed intake of the compound of the present invention (100 nmol / kg) was not significantly different from that of the compound 3 and Liraglutide, the weight of Liraglutide decreased by about 12.2% About 24.6% of body weight was decreased.
  • the dose of Compound 3 was 300 nmol / kg, it was found that the body weight was reduced by about 37.8%.
  • the acylated auxin tomodulin peptide analogue of the present invention was twice as excellent as Liraglutide And had a lower body weight than the vehicle control group after discontinuation of the treatment.
  • acylated auxin tomodulin peptide analogues In order to confirm the maximum weight loss effect of acylated auxin tomodulin peptide analogues according to the present invention, a diet containing high fat was fed to a male mice (Wistar rats) fed with high fat diet, The mice were divided into groups according to body weight before the experiment and evaluated.
  • Compound 3 in the examples of the present invention was subcutaneously injected into distilled water containing 0.01% Tween 80 at a dose of 100 nmol / kg or 300 nmol / kg for 4 days, as shown in Table 7, once a day for a total of 4 days.
  • the body weight and feed intake were measured once a day at a constant time to confirm the effect of weight loss over time on the initial body weight. The administration was stopped from the fifth day and the recovery of body weight was confirmed, and the results are shown in FIGS. 3A and 3B.
  • acylated oxytomodulin peptide analogue In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the commercially available diabetes therapeutic agent, a diet containing high fat was fed to male mice (C57BL / 6 mouse) Were used to evaluate obesity-induced rats.
  • Compound 3 was prepared so as to have a dose of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, a commercially available drug for diabetes, was added to the same solvent to prepare 100 nmol / And subcutaneously injected once every 3 days as described in Table 8 and evaluated for a total of 10 days.
  • the body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of acylated oxytomodulin peptide analogues to semaglutide, and the results are shown in FIGS. 4A and 4B.
  • Compound 18 showed an excellent weight loss effect similar to Compound 3 at the same dose, while Compound 13 had no significant effect on body weight.
  • Compound 13 showed about 10 times more insensitivity to Compound 3 than in Compound 3, and its structural importance was confirmed by confirming the disappearance of the weight loss effect according to the end structure of the dianionic group in an animal experiment.
  • a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before the experiment.
  • Compounds 3 and 21 to 25 according to the present invention were prepared so as to have a volume of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then subcutaneously injected at intervals of 3 days as shown in Table 11 and evaluated for a total of 2 weeks .
  • the body weight and feed intake were measured once a day at a constant time to compare the effects of the compounds 21 to 25 on weight loss, and the results are shown in FIGS. 7a to 7d.
  • mice were fed a high-fat diet (C57BL / 6 mouse)
  • the rats were divided into groups according to body weight before the experiment.
  • Compound 3 and Compound 22 according to the present invention were prepared in distilled water containing 0.01% Tween 80 so as to have a volume of 30 nmol / kg or 100 nmol / kg, and subcutaneously injected at intervals of 3 days as shown in Table 12, Lt; / RTI >
  • the body weight and feed intake were measured once a day at a constant time to compare the weight loss effect of Compound 3 with Compound 22, and the results are shown in FIGS. 8A and 8B.
  • the compound 22 showed a higher cumulative feed intake than the compound 3 at the same dose, while the 10 nmol / kg dose of the compound 22 showed a feed intake of the vehicle control level, but a 7.5% weight loss effect was observed .
  • the weight loss efficacy was similar to that of the same dose group of Compound 3 even though the feeds were higher. This shows that Compound 22 is more influenced by the drug efficacy due to the glucagon receptor activating ability as compared to Compound 3.
  • Compound 3 was prepared in a concentration of 30 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide (commercially available as a therapeutic agent for diabetes / obesity) and MEDI0382 (as a comparative example) were dissolved in the same solvent at 30 nmol / kg, and then subcutaneously injected once a day for a total of 4 days as shown in Table 13.
  • the body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of analogues to Liraglutide and MEDI0382, and the results are shown in FIGS. 9A and 9B.
  • Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every three days as described in Table 14 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at a constant time, body fat was measured at 4 weeks before the autopsy, and the body weight and the body fat reducing effect of the oxytocmodulin peptide analogue of the present invention were compared to that of semaglutide. 10C.
  • This experiment evaluated the effect of the acylated auxin tomodulin peptide analogue according to the present invention on the glucose tolerance improving effect of the male mice (C57BL / 6 mouse) as a means of improving postprandial blood glucose controlling ability.
  • the experimental mice were fasted overnight, and Compound 3, Compound 22 or Compound 25 according to the present invention was prepared in distilled water containing 0.01% Tween 80 and subcutaneously injected 30 minutes before glucose administration.
  • the glucose solution was orally administered 30 minutes after the oxhistone modulin peptide analogue injection, and the whole blood was measured through the vein at the designated time immediately before the drug injection and the glucose solution administration and for 2 hours after the glucose solution administration.
  • the peptide analogs showed a significant and dose-dependent decrease in blood glucose AUC at a dose of 30 nmol / kg or more.
  • Compound 25 showed significant potency resistance improvement effects in all evaluated dose groups and 3 times The excellent antitumor effect was observed.
  • mice Male mice (db / db mouse) were divided into two groups according to the pre-experiment blood glucose, glycated hemoglobin and body weight The groups were separated and evaluated.
  • Compound 3 according to the present invention was prepared so as to have a concentration of 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was prepared in the same solvent so as to have a 100 nmol / kg capacity.
  • the mice were subcutaneously injected once every 3 days and evaluated for a total of 6 weeks.
  • Figs. 12A and 12B After 24 hours of drug administration once a week, non-fasting blood glucose, body weight and feed intake were measured, and at 3 weeks, 5 weeks and 6 weeks, hemoglobin was measured to determine the effect of the oxytocmodulin peptide analogue of the present invention against semaglutide The results are shown in Figs. 12A and 12B.
  • Compound 3 according to the present invention exhibited the same or lower efficacy than Semaglutide at the same dose (100 nmol / kg).
  • the final non-fasting blood glucose level of the control group was 581 mg / dL, while the final non-fasting blood glucose level of the control substance, Semaglutide, was 342 mg / dL, and the final unfasted blood glucose level of Compound 3 was 274 mg / Significant inhibition of blood glucose elevation was observed.
  • the final value of vehicle glycated hemoglobin increased by 5.15% point compared with the initial value, but increased by 2.65% point in the semaglutide administration group and 1.73% point in the compound 3 administration group.
  • acylated oxytomodulin peptide analogs according to the present invention have excellent anticancer effects on the delayed onset of diabetes compared to semaglutide.
  • Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every 3 days as shown in Table 16 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at constant time, and non - fasting blood glucose was measured 24 hours after administration at intervals of about 10 days.
  • the HbA1c was measured at 4th week before the autopsy, and the effect of the oxynitomulin peptide analogue according to the present invention on the blood glucose control was compared with that of semaglutide. The results are shown in FIGS. 13A and 13B.
  • the compound 3 and compound 22 according to the present invention administered at the same dose showed an excellent blood glucose control effect and a glycosylated hemoglobin elevation inhibitory effect similar to those of semaglutide.
  • the oxytocmodulin peptide analogue according to the present invention has the effect of controlling the blood glucose as well as the weight reduction shown in the ⁇ Experimental Example 11>.

Abstract

The present invention relates to a novel peptide analog of acylated oxyntomodulin and a pharmaceutical composition for preventing and treating obesity or overweightness, or diabetes accompanied by obesity and overweightness, containing the same, wherein the peptides have dual activation efficacy on receptors of GLP-1/glucagon and increased in vivo half-life, which are superior to those of natural oxyntomodulin, and the pharmaceutical composition containing the same is effective in the treatment of metabolic diseases such as obesity and diabetes.

Description

아실화 옥신토모듈린 펩타이드 유사체Acylated oxytomolin peptide analogs
본 발명은 옥신토모듈린 펩타이드 유사체, 및 이를 포함하는 비만 또는 과체중, 또는 이를 동반하는 비 인슐린 의존성 당뇨병의 예방 또는 치료에 사용할 수 있는 약학조성물에 관한 것이다.The present invention relates to a pharmaceutical composition which can be used for the prophylaxis or treatment of oxytocmodulin peptide analogues and non-insulin dependent diabetes mellitus including obesity, overweight, or concomitant therapies.
대사성 질환 (Metabolic Disease, Metabolic Syndrome)은 포도당, 지방, 단백질 등의 대사 이상에서 기원하는 질병으로 주로 포도당과 지방대사의 이상으로 유발되는 암, 당뇨병, 골대사질환, 지방간, 비만, 심혈관계 질환 등을 통칭한다. 2001년에 보고된 미국 국가 콜레스테롤 교육프로그램(National Cholesterol Education Program; NCEP)의 adult treatment panel III (ATP Ⅲ) 또는 2012년에 발표된 국제당뇨병연맹(International Diabetes Federation;IDF)에 따른 대사성 질환 진단 기준은 다음과 같다. ① 허리둘레가 남자 102 또는 94 cm(각각 NCEP 또는 IDF), 여자 88 또는 80 cm(각각 NCEP 또는 IDF) 이상인 복부 비만, ② 중성지방(triglycerides) 150 mg/dL 이상인 고중성지방혈증, ③ HDL 콜레스테롤이 남자 40 mg/dL, 여자 50 mg/dL 이하, ④ 혈압 130/85 mmHg 이상인 고혈압, 또는 ⑤ 공복혈당(fasting glucose)이 110 mg/dL 이상 등의 다섯 가지 위험인자 중 세 개 이상을 나타낼 경우 대사성 질환으로 분류할 수 있다.Metabolic Disease (Metabolic Syndrome) is a disease caused by metabolic abnormalities such as glucose, fat, and protein. It is mainly caused by abnormalities of glucose and fat metabolism, cancer, diabetes, bone metabolic diseases, fatty liver, obesity and cardiovascular diseases. Collectively. The criteria for the diagnosis of metabolic diseases according to the International Diabetes Federation (IDF), published in 2001, in the US National Cholesterol Education Program (NCEP) adult treatment panel III (ATP III) As follows. (1) Abdominal obesity with a waist circumference of 102 or 94 cm (NCEP or IDF, respectively), 88 or 80 cm (NCEP or IDF, respectively) in women, 2) Hypertriglyceridemia with triglycerides> 150 mg / dL, 3) HDL cholesterol ≥ 40 mg / dL for a man, 50 mg / dL for a woman, ④ hypertension with a blood pressure of 130/85 mmHg or more, or ⑤ more than three of five risk factors such as fasting glucose (110 mg / dL) It can be classified as metabolic disease.
세계보건기구(World Health Organization; WHO)에 따르면 전세계 비만 유병률은 1980년에서 2014년 사이에 2배 이상 증가하였으며, 2014년에는 18세 이상의 성인 중 39% (남성 38%, 여성 40%)가 과체중, 13% (남성 11%, 여성 15%)가 비만이었다. 이러한 비만 및 과체중의 근본적인 원인으로는 칼로리 섭취 및 소비 사이의 에너지 불균형으로 지방이 많고 에너지 밀도가 높은 식사와 현대 사회 일의 성격, 교통 수단의 변화, 도시화의 증가 등으로 인한 신체 활동 저하가 비만의 위험 요소로 여겨지고 있다. 비만과 함께 동반되는 질환 중 당뇨 역시 그 유병률이 빠르게 증가하고 있는 추세로 18세 이상 성인 중 1980년 4.7%에서 2015년 8.5%로 상승하였다. 당뇨병 유병률은 중산층과 저소득 국가에서 더욱 빠르게 늘고 있으며 실명, 신부전, 심장마비, 뇌졸증 등의 주요 원인이 된다.According to the World Health Organization (WHO), the worldwide prevalence of obesity has more than doubled between 1980 and 2014, and in 2014, 39% of adults over age 18 (38% of men and 40% of women) , 13% (male 11%, female 15%) were obese. The main causes of obesity and overweight are energy inequalities between caloric intake and consumption, which result in a decrease in physical activity due to high fat, high-energy diet, modern social work, changes in transportation, It is considered a risk factor. Among the diseases associated with obesity, the prevalence of diabetes also increased rapidly from 4.7% in 1980 to 8.5% in 2015 among adults over 18 years of age. Diabetes mellitus prevalence is growing more rapidly in middle-income and low-income countries and is a major cause of blindness, kidney failure, heart attack, and stroke.
글루카곤은 췌장의 알파 세포에서 생산되는 호르몬으로 일반적으로 포도당 신생합성과 간에 저장되어 있는 글리코겐을 분해하여 혈당을 높이는 역할을 하는데, 저장된 글리코겐이 고갈되면 글루카곤은 간과 신장으로 하여금 포도당을 새로 합성하게 하며, 식욕억제 및 저장되어 있는 중성지방(Triglyceride)을 지방산으로 분해하여 에너지 대사량 증가를 통한 체중감소에도 영향이 있음이 알려져 있다(Diabetes.co.uk. the global diabetes community, Anim Sci J. 2016;87(9):1090-1098).Glucagon is a hormone produced by the alpha cells of the pancreas. It plays an important role in increasing blood sugar by decomposing glycogen stored in the liver and glucose synthesis in the liver. When the stored glycogen is depleted, glucagon causes the liver and kidney to synthesize glucose, It is known that appetite suppression and decomposition of stored triglycerides into fatty acids have an effect on weight loss by increasing energy metabolism (Diabetes.co.uk., Global Diabetes Community, Anim Sci. 9): 1090-1098).
GLP-1(Glucagon-like peptide-1)은 글루카곤 유도체 중의 하나로 혈당을 감소시키는 역할을 하는 펩타이드 호르몬이다. 식후 소장의 L-세포에서 분비되며, 반감기가 2분 미만으로 매우 짧은데, 포도당에 의해 분비가 증가되면 췌장의 베타 세포에서 인슐린 분비를 유도함으로써 궁극적으로 혈당을 조절하고 베타세포 기능을 개선시키는 역할을 하는 것으로 보고되고 있다. 또한 글루카곤 분비 저해, 위공복 억제, 음식물 섭취를 감소시키는 기능을 가진다(Physiol Rev. 2007;87(4):1409-1439). Novo Nordisk의 리라글루타이드(Liraglutide)는 제2형 당뇨병 및 비만 적응증에 대해 개발된 치료제로 1일 1회 주사되는 사람 GLP-1 유도체이다. Liraglutide는 지속성 GLP-1 수용체 작용제로 내인성 GLP-1과 동일한 수용체에 결합하여 포도당 의존적으로 인슐린 분비를 촉진시킴으로써 혈당을 조절하고 식욕을 감소시켜 체중증가를 억제하고 중성지방을 낮추는 작용으로 제2형 당뇨병에 대해서는 Victoza, 비만에 대해서는 Saxenda라는 이름으로 미국 및 유럽에서 발매되었다(Expert Rev Cardiovasc Ther. 2015;13(7):753-767). Liraglutide 외에도 엑세나타이드 (Exenatide), 릭시세나타이드 (Lixisenatie), 알비글루타이드 (albiglutide) 및 둘라글루타이드 (dulaglutide) 등이 당뇨병 치료제로 개발되었다. 그러나 이와같은 GLP-1 수용체 작용제들의 부작용으로는 구역, 구토 및 식욕감소, 두통과 변비, 복부팽만감 발생 등이 보고되고 있다(Korean J Med. 2014;87(1):9-13).GLP-1 (Glucagon-like peptide-1) is one of the glucagon derivatives and is a peptide hormone that plays a role in reducing blood sugar. It is secreted by the L-cells of the small intestine and has a half-life of less than 2 minutes. When the secretion is increased by glucose, it induces insulin secretion in pancreatic beta cells, ultimately controlling blood glucose and improving beta cell function . It also has the function of inhibiting glucagon secretion, inhibiting gastric emptying, and reducing food intake (Physiol Rev. 2007; 87 (4): 1409-1439). Novo Nordisk's Liraglutide is a human GLP-1 derivative that is injected once a day as a treatment for the development of type 2 diabetes and obesity indications. Liraglutide is a persistent GLP-1 receptor agonist that binds to the same receptor as endogenous GLP-1 to promote glucose-dependent insulin secretion, thereby regulating blood sugar, reducing appetite, inhibiting weight gain and lowering triglycerides. Victoza for obesity and Saxenda for obesity (Expert Rev Cardiovasc Ther. 2015; 13 (7): 753-767). In addition to Liraglutide, Exenatide, Lixisenatie, albiglutide and dulaglutide have been developed for the treatment of diabetes. However, side effects of these GLP-1 receptor agonists have been reported to include nausea, vomiting and loss of appetite, headache and constipation, and the occurrence of abdominal distension (Korean J Med. 2014; 87 (1): 9-13).
옥신토모듈린은 글루카곤의 전구체인 프로글루카곤(proglucagon)에서 유래되는 펩타이드로 글루카곤의 완전한 29개 아미노산 서열을 포함하는 37개 아미노산 펩타이드로 구성되어 있으며, GLP-1 및 글루카곤 수용체에 모두 결합하는 이중작용을 갖는다. 음식물 섭취 감소 및 에너지 대사를 증가시킴으로써 체중감소효과를 나타내는데, 옥신토모듈린의 이러한 작용은 선택적인 GLP-1 수용체 작용제 보다 우수한 것으로 알려져 있으며, 글루카곤 수용체 활성화에 따른 포도당 증가로 인한 고혈당 위험은 함께 활성화 되는 GLP-1 수용체에 의한 인슐린 분비를 통해 혈당 조절 작용을 할 수 있는 것으로 보고되어 있다. 옥신토모듈린은 비임상실험에서 사료섭취량, 체중감소 및 에너지 소비 증가와 당 대사를 향상시키는 것으로 보고되었으며(Diabetes. 2009;58(10):2258-2266), 임상시험에서도 과체중 및 비만 환자들에게 1일 3회씩, 4주간 피하투여를 했을 때 평균 2.3 kg의 체중감소를 보였고(Diabetes. 2005;54:2390-2395), 플라시보 군 대비 유의적인 인슐린 분비 및 혈당 감소 효과도 확인되었으며(Diabetes. 2013;62(Suppl. 1):A48), 또 다른 임상시험에서는 옥신토모듈린의 지속적인 주입으로 인한 구토나 식욕촉진 등의 부작용 없이 에너지 섭취를 감소시킴이 확인되어(J Clin Endocrinol Metab. 2003;88:4696-4701), 옥신토모듈린은 혈당 조절, 음식물 섭취 감소, 포만감 증진 등의 기능을 나타낼 수 있기에 비만 치료 및 혈당조절을 목적으로 하는 새로운 치료법으로 각광받고 있다(Molecular metabolism. 2014;3:241-251). 그러나 옥신토모듈린은 GLP-1처럼 디펩티딜 펩티다아제-IV(Dipeptidyl peptidase-IV; DPP-IV)에 의해 절단되어 생체 내에서 불안정하게 매우 짧은 반감기를 가진다(J Biol Chem. 2002;278: 22418-22423). Oxytomodulin is a peptide derived from proglucagon, a precursor of glucagon. It is composed of 37 amino acid peptides containing the complete 29 amino acid sequence of glucagon. It has a double action binding to both GLP-1 and glucagon receptors Respectively. This effect of oxytomodulin is known to be superior to that of selective GLP-1 receptor agonists, and the risk of hyperglycemia due to glucose uptake due to glucagon receptor activation is also increased The insulin secretion by the GLP-1 receptor has been reported to be able to regulate blood glucose. Oxytomodulin has been reported to improve feed intake, weight loss and energy expenditure and glucose metabolism in nonclinical studies (Diabetes. 2009; 58 (10): 2258-2266) and clinical trials have also shown that overweight and obese patients (3 times daily, 4 weeks) subcutaneously showed an average weight loss of 2.3 kg (Diabetes, 2005; 54: 2390-2395), and significant insulin secretion and blood glucose lowering effect compared to placebo group. 2013; 62 (Suppl. 1): A48), another clinical trial has been shown to reduce energy intake without side effects such as vomiting or appetite stimulation due to continued infusion of oxytomodulin (J Clin Endocrinol Metab 2003; 88: 4696-4701), oxytomodulin has been shown to be a new therapeutic method for the treatment of obesity and glucose control because it can exhibit functions of controlling blood glucose, decreasing food intake, and improving the feeling of satiety (Molecular metabolism. 2014; : 241-251) . However, oxytomodulin has been reported to have a very short half-life in vivo unstably by cleavage by Dipeptidyl peptidase-IV (GLP-1) (J Biol Chem. 2002; 278: 22418- 22423).
따라서 GLP-1 및 글루카곤 수용체에 균형있게 선택적으로 결합하여 약리학 및 치료학적 측면에서 옥신토모듈린의 작용을 장기간 지속시키고 각 호르몬 펩타이드의 부작용을 극복할 수 있는 DPP-IV 내성 옥신토모듈린 유도체에 대한 연구들이 보고되고 있으며(Diabetes. 2009;58(10):2258-2266), 머크(Merck), 질랜드(Zealand), 메드이뮨(Medimmune), 한미약품 등 여러 회사에서 선도물질들에 대한 개발이 진행 중에 있다.Thus, a DPP-IV resistant oxytomodulin derivative capable of selectively binding GLP-1 and glucagon receptors in a balanced manner to overcome the adverse effects of each hormone peptide for a prolonged period of action of oxytomodulin in pharmacological and therapeutic aspects (Diabetes. 2009; 58 (10): 2258-2266), the development of leading substances in various companies such as Merck, Zealand, Medimmune, It is in progress.
이러한 배경 하에서, 본 발명은 ① DPP-IV에 대한 저항성을 부여하고, ② 아실화에 의한 대사 안정성을 최적화시켜, ③ GLP-1 및 글루카곤 수용체에 대하여 원래의 옥신토모듈린 보다 우수한 활성을 나타내는 합성 옥신토모듈린 펩타이드 유사체 개발을 통한 비만 또는 비만을 동반하는 당뇨병 치료에 사용하기 위한 치료용 약학조성물에 관한 것이다.Under these circumstances, the present invention provides a method for producing a compound of the present invention, which comprises: (1) providing resistance to DPP-IV; (2) optimizing metabolic stability by acylation; (3) synthesizing GLP-1 and glucagon receptors The present invention relates to a therapeutic pharmaceutical composition for use in the treatment of diabetes accompanied by obesity or obesity through the development of auxin to modulin peptide analogues.
본 발명의 목적은 기존의 옥신토모듈린보다 GLP-1 및 글루카곤 수용체에 대한 활성이 높고, 아실화에 의해 화학적으로 안정화되어(Molecular metabolism 2013;2:468-479) 생체내 반감기가 증가된 옥신토모듈린 펩타이드 유사체를 제공하여 비만 또는 과체중, 또는 이들을 동반하는 비 인슐린 의존성 당뇨병에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료에 사용할 수 있는 옥신토모듈린 펩타이드 유사체 및 이를 포함한 약학조성물을 제공하는 것이다.It is an object of the present invention to provide a compound of formula (I) which has higher activity on GLP-1 and glucagon receptors than conventional oxytomodulin and is chemically stabilized by acylation (Molecular metabolism 2013; 2: 468-479) There is provided an oxytocmodulin analog and a pharmaceutical composition comprising the same, which can be used in the prevention or treatment of conditions caused or characterized by obesity or overweight, or non-insulin dependent diabetes accompanied by them, by providing a tomodulin peptide analogue will be.
상기 과제를 해결하기 위하여, 본 발명은 옥신토모듈린 펩타이드 유사체인 하기 화학식 Ⅰ의 아미노산 서열을 포함하는 신규한 펩타이드를 제공한다.In order to solve the above-mentioned problems, the present invention provides a novel peptide comprising an amino acid sequence of the following formula I, which is an oxytomodulin peptide analogue.
<화학식 Ⅰ><Formula I>
His-X1-Gln-Gly-Thr-Phe-Thr-Ser-X2-X3-X4-X5-X6-X7-X8-X9-Arg-Arg-Ala-X10-Asp-Phe-Val-Gln-Trp-Leu-X11-X12-X13-X14-X15-X16 (SEQ ID NO.49) His-X 1 -Gln-Gly- Thr-Phe-Thr-Ser-X 2 -X 3 -X 4 -X 5 -X 6 -X 7 -X 8 -X 9 -Arg-Arg-Ala-X 10 - Asp-Phe-Val-Gln-Trp-Leu-X 11 -X 12 -X 13 -X 14 -X 15 -X 16 (SEQ ID NO.49)
상기 식에서,In this formula,
X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X 1 is Ser or Aib (aminoisobutyric acid);
X2는 Asp 또는 Z이며;X 2 is Asp or Z;
X3는 Tyr 또는 Z이며;X 3 is Tyr or Z;
X4는 Ser 또는 Z이며;X 4 is Ser or Z;
X5는 Lys 또는 Z이며;X 5 is Lys or Z;
X6은 Tyr 또는 Z이며;X 6 is Tyr or Z;
X7은 Leu 또는 Z이며;X 7 is Leu or Z;
X8은 Asp 또는 Z이며; X 8 is Asp or Z;
X9는 Ser, Aib(aminoisobutyric acid) 또는 Z이며;X 9 is Ser, Aib (aminoisobutyric acid) or Z;
X10은 Gln 또는 Z이며;X 10 is Gln or Z;
X11은 Met 또는 Leu이며;X 11 is Met or Leu;
X12은 Asn 또는 Arg이며;X 12 is Asn or Arg;
X13은 Thr 또는 Ala이며;X 13 is Thr or Ala;
X14은 Lys 또는 Z이며;X 14 is Lys or Z;
X15는 RNRNNIA(SEQ ID NO.51) 이거나 존재하지 않으며;X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
X16은 X15가 존재할 경우, Z이거나 존재하지 않으며; X &lt; 16 &gt; is Z or absent when X &lt; 15 &gt; is present;
C-말단 아미노산은 임의로 아미드화될 수 있으며;The C-terminal amino acid may optionally be amidated;
여기서 X2, X3, X4, X5, X6, X7, X8, X9, X10, X14 또는 X16 중 적어도 하나가 Z이며; Wherein at least one of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14 or X 16 is Z;
Z는 작용화된 Lys으로서 그 측쇄에 중합체성 부분과 스페이서의 접합체인 Z1과 친유성 리피드 부분인 Z2가 접합된 형태이며, 여기서 Z1은 아실 작용기를 통하여 Lys 측쇄와 직접적으로 접합되고 Z2는 Z1을 통해 Lys 측쇄에 접합되고, Z1은 하기 구조식 (1) 또는 (2)이고, Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z &lt; 1 & gt ;, Z &lt; 1 &gt; is the following structural formula (1)
(1)
Figure PCTKR2018009425-appb-I000001
(One)
Figure PCTKR2018009425-appb-I000001
(2)
Figure PCTKR2018009425-appb-I000002
(2)
Figure PCTKR2018009425-appb-I000002
Z2는 하기 구조식 (3) 또는 (4) 이다.Z 2 is the following structural formula (3) or (4).
(3)
Figure PCTKR2018009425-appb-I000003
(3)
Figure PCTKR2018009425-appb-I000003
(4)
Figure PCTKR2018009425-appb-I000004
(4)
Figure PCTKR2018009425-appb-I000004
본 발명에서 아미노산은 하기 약어를 병용 기재하였다;Amino acids in the present invention are indicated by the following abbreviations;
Ala(A), Lys(K), Asn(N), Asp(D), Cys(C), His(H), Ile(I), Met(M), Ser(S), Val(V), Gly(G), Leu(L), Pro(P), Thr(T), Phe(F), Arg(R), Tyr(Y), Trp(W), Glu(E), Gln(Q), Aib(aminoisobutyric acid).(A), Lys (K), Asn (N), Asp (D), Cys (C), His (H), Ile Glu (G), Leu (L), Pro (P), Thr (T), Phe (F), Arg (R), Tyr Aib (aminoisobutyric acid).
본 발명에서 용어, “옥신토모듈린(oxyntomodulin)” 이란 글루카곤의 전구체인 프리-글루카곤으로부터 만들어지는 펩타이드를 의미하며, 천연형의 옥신토모듈린은 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA(SEQ ID NO.1)의 아미노산 서열을 갖는다. The term &quot; oxyntomodulin &quot; in the present invention means a peptide made from pre-glucagon, which is a precursor of glucagon, and the native oxytomodulin means an amino acid sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO.1) .
본 발명에서 Z의 구성요소 중 하나인 Z1은 중합체성 부분으로 폴리에틸렌 글리콜, 단량체로서 에틸렌 글리콜, 에탄올아민, 락틱산을 갖는 공중합체, 또는 단량체로서 글라이신과 세린을 갖는 폴리-아미노산 공중합체의 형태를 가질 수 있고, 폴리-아미노산은 GGSGSG의 아미노산 서열(SEQ ID NO. 52)일 수 있으며, 본 발명의 화합물은 상기 중합체성 부분의 반복 단위를 2개 이상 가질 수 있다. In the present invention, Z 1, which is one of the constituents of Z, is a copolymer having a polymeric portion as polyethylene glycol, a monomer having ethylene glycol, ethanolamine, lactic acid, or a polyamino acid copolymer having glycine and serine as monomers And the poly-amino acid may be the amino acid sequence of GGSGSG (SEQ ID NO. 52), and the compound of the present invention may have two or more repeating units of the polymeric moiety.
또한, Z1은 한 말단에 상술한 옥신토모듈린 펩타이드 유사체의 임의의 잔기 또는 그 측쇄에 부착되기 위한 작용기를 가질 수 있다. 바람직하게는 아실기이며, 이 경우 측쇄의 아미노기에 아미드 결합의 형태로 부착될 수 있으며, 일부 구현예에서, Z1은 한 말단에 스페이서와 결합되기 위한 작용기를 가질 수 있다. 바람직하게는 아미노기이며, 이 경우 스페이서의 카르복시기에 아미드 결합의 형태로 부착될 수 있으며, Z1은 바람직하게는 수용성을 가지며, 따라서 양친매성이나 친수성일 수 있다. Furthermore, Z 1 may have at one end any moiety of the above-described oxynthomodulin peptide analog or a functional group for attachment to its side chain. Preferably an acyl group, which in this case may be attached in the form of an amide bond to the amino group of the side chain, and in some embodiments Z 1 may have a functional group for bonding to the spacer at one end. Preferably an amino group, in which case it may be attached in the form of an amide bond to the carboxyl group of the spacer, and Z 1 is preferably water-soluble and thus may be amphipathic or hydrophilic.
본 발명에서 스페이서는 L-글루타민산 잔기로서, 그 γ-카복실산에는 중합체성 부분인 Z1과 공유결합되고 α-아미노기에는 친유성 리피드 부분인 Z2가 공유결합 될 수 있으며, 2개 이상 반복단위를 가질 수 있다.In the present invention the spacer is an L- glutamic acid residues, the carboxylic acid is γ- polymeric part of Z 1 and covalent bonds and α- amino group may be part of the lipophilic lipid Z 2 is a covalent bond, at least two repeating units Lt; / RTI &gt;
Z의 또 다른 구성요소인 Z2의 리피드 부분은 스페이서와 직접적으로 접합되고, 스페이서는 중합체성 부분과 직접적으로 접합되며, 중합체성 부분은 본 발명의 옥신토모듈린 펩타이드 유사체의 X2, X3, X4, X5, X6, X7, X8, X9, X10, X14 또는 X16 위치에 존재하는 아미노산 잔기의 측쇄와 직접적으로 접합될 수 있으며, 바람직하게는, 이 접합을 가능케 하는 아미노산 잔기로서 Lys이 도입될 수 있다.The lipid moiety of Z 2 , another component of Z, is directly conjugated to the spacer, the spacer is conjugated directly to the polymeric moiety, and the polymeric moiety is linked to the X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14, or X 16 , and preferably the junction Lys may be introduced as an enabling amino acid residue.
또한, Z2는 C14~C20 포화 탄화수소 쇄를 포함하며, 이 탄화수소 쇄의 말단 탄소가 카복실산 형태, 일차 아미드 형태 또는 임의의 단일 아미노산과 공유결합으로 연결된 카복실산 형태인 펩타이드 유도체이다. 이때 탄화수소 쇄는 분지형이거나 직선형일 수 있다. 탄화수소 쇄가 스페이서에 부착되기 위하여 필요한 작용기는 상술한 리피드 부분의 일부를 형성하며, 아실기, 설포닐기, N 원자, O 원자, S 원자 등이 포함될 수 있다. Also, Z 2 is a peptide derivative comprising a C 14 -C 20 saturated hydrocarbon chain, wherein the terminal carbon of the hydrocarbon chain is in a carboxylic acid form, a primary amide form, or a carboxylic acid form covalently linked to any single amino acid. Wherein the hydrocarbon chain may be branched or straight. The functional group necessary for attaching the hydrocarbon chain to the spacer forms a part of the lipid moiety mentioned above and may include an acyl group, a sulfonyl group, an N atom, an O atom, an S atom, and the like.
따라서 스페이서 부착은 에스테르, 설포닐 에스테르, 티오에스테르, 아미드 또는 설폰 아미드를 통해 이루어질 수 있다. 바람직하게는, 탄화수소 쇄는 아실기를 통하여 아미드 결합의 형태로 스페이서의 아미노기와 접합되며, 따라서 탄화수소 쇄는 특히 알카노일기의 형태의 일부일 수 있다.Thus, the spacer attachment can be via an ester, a sulfonyl ester, a thioester, an amide or a sulfonamide. Preferably, the hydrocarbon chain is bonded to the amino group of the spacer in the form of an amide bond through an acyl group, and thus the hydrocarbon chain may be part of the form of an alkanoyl group in particular.
특정한 이론에 그 해석을 제한받고자 하는 바는 아니나, 친유성 리피드 부분은 혈류 내에서 알부민과 결합함으로서 본 발명의 화합물이 혈류 내 다양한 분해 효소의 기질로서 반응하는 것을 방지하여 그 생체 내 반감기를 향상시키는 것으로 여겨진다.While not wishing to be bound by any particular theory, it is believed that the lipophilic lipid moiety binds to albumin in the blood stream, thereby preventing the compound of the present invention from reacting as a substrate for various degrading enzymes in the bloodstream, thereby improving its in vivo half-life &Lt; / RTI &gt;
본 발명에서 옥신토모듈린 펩타이드 유사체 내의 하나 이상의 아미노산 측쇄는 중합체성 부분과 스페이서를 통하여 친유성 리피드 부분과 접합되며, 이러한 화학적 변형은 본 발명의 옥신토모듈린 펩타이드 유도체의 생체내 가용성 또는/및 반감기를 증가시키고/시키거나 생체이용률을 증가시키는 등의 약학적으로 유리한 효과를 유도할 수 있다. In the present invention, one or more amino acid side chains in an oxytomodulin peptide analogue are conjugated to a lipophilic lipid moiety through a polymeric moiety and a spacer, such chemical modification being dependent on the in vivo solubility and / or hydrophobicity of the oxytocmodulin peptide derivative of the present invention It is possible to induce a pharmacologically favorable effect such as increasing half-life and / or increasing bioavailability.
상기 화학식 Ⅰ의 아미노산 서열을 포함하는 신규한 펩타이드는 천연형 옥신토모듈린의 2번 위치에 존재하는 Ser 잔기를 Aib로 치환하여 제조될 수 있다. 본 발명의 상기 구현예에서 제시된 화합물은 옥신토모듈린 펩타이드 유사체 X1 위치에 Aib가 도입된 경우로서, 천연의 옥신토모듈린에 비교하여 디펩티딜 펩티다제 IV에 대해 더 큰 저항성을 가지는 것으로 여겨진다. 결과적으로 본 발명의 옥신토모듈린 펩타이드 유사체는 천연형의 옥신토모듈린에 비하여 개선된 생체 내 안정성을 가진다.The novel peptide comprising the amino acid sequence of the above Formula I can be prepared by substituting Aib for the Ser residue present at the 2-position of the native type auxin tomodulin. A compound as given in the embodiments of the present invention auxin Sat module Lin peptide analogs as if Aib is introduced into X 1 position, to have greater resistance to dipeptidyl peptidase IV as compared to auxin Sat module lean natural It is considered. As a result, the oxytocmodulin peptide analogues of the present invention have improved in vivo stability compared to the native oxytomodulin.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연형 옥신토모듈린의 27번 위치에 존재하는 Met 잔기를 Leu으로 치환시키고, 28번 위치에 존재하는 Asn 잔기를 Arg 으로, 29번 위치에 존재하는 Thr 잔기를 Ala으로 치환시켜 제조될 수 있으며, 예로서 하기 구현예 중 화합물 12(SEQ ID NO. 13)의 경우, X11 위치를 Leu, X12 위치를 Arg, X13 위치를 Ala으로 치환시켜 제조한 것이다.Also, the acylated oxytomodulin peptide analogue according to the present invention can be obtained by substituting Leu for the Met residue at position 27 of the native oxytomodulin and substituting Leu for the Asn residue at position 28 with Arg time to can be prepared substituting a Thr residue present in the Ala position, to an example of embodiments compound 12 for (SEQ ID NO. 13), X 11 position Leu, the X 12 position Arg, X 13 position With Ala.
본 발명에서 바람직한 옥신토모듈린 펩타이드 유도체는 하기 화학식 Ⅰ-1의 아미노산 서열을 포함하는 신규한 펩타이드이다.The oxytocmodulin peptide derivative preferred in the present invention is a novel peptide comprising the amino acid sequence of the following formula (I-1).
<화학식 Ⅰ-1>&Lt; Formula (I-1) >
HX1QGTFTSDX3SKYLDX9RRAX10DFVQWLX11X12X13X14X15X16 (SEQ ID NO.50)HX 1 QGTFTSDX 3 SKYLDX 9 RRAX 10 DFVQWLX 11 X 12 X 13 X 14 X 15 X 16 (SEQ ID NO.50)
상기 아미노산 서열에서In the amino acid sequence
X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X 1 is Ser or Aib (aminoisobutyric acid);
X3은 Tyr 또는 Z;X 3 is Tyr or Z;
X9은 Ser, Aib 또는 Z;X 9 is Ser, Aib or Z;
X10은 Gln 또는 Z이며;X 10 is Gln or Z;
X11는 Met 또는 Leu;X 11 is Met or Leu;
X12는 Asn 또는 Arg;X 12 is Asn or Arg;
X13는 Thr 또는 Ala;X 13 is Thr or Ala;
X14은 Lys 또는 Z;X 14 is Lys or Z;
X15은 RNRNNIA(SEQ ID NO. 51) 이거나 존재하지 않으며;X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
X16은 X15이 존재할 경우, Z이거나 존재하지 않으며, C-terminal 은 아미드화 될 수 있고,X 16 is Z or absent when X 15 is present, the C-terminal can be amidated,
Z은 상기 화학식 Ⅰ에서 정의한 바와 같다.Z is as defined in the above formula (I).
상기 화학식 Ⅰ의 펩타이드 유사체를 포함하는 구현예에는, 화합물 1(SEQ ID NO. 2), 화합물 2(SEQ ID NO. 3), 화합물 3(SEQ ID NO. 4), 화합물 4(SEQ ID NO. 5), 화합물 5(SEQ ID NO. 6), 화합물 6(SEQ ID NO. 7), 화합물 7(SEQ ID NO. 8), 화합물 8(SEQ ID NO. 9), 화합물 9(SEQ ID NO. 10), 화합물 10(SEQ ID NO. 11), 화합물 11(SEQ ID NO. 12), 화합물 12(SEQ ID NO. 13), 화합물 13(SEQ ID NO. 14), 화합물 15(SEQ ID NO. 16), 화합물 16(SEQ ID NO. 17), 화합물 17(SEQ ID NO. 18), 화합물 18(SEQ ID NO. 19)를 포함할 수 있다.Embodiments comprising the peptide analog of Formula I above include Compound 1 (SEQ ID NO. 2), Compound 2 (SEQ ID NO. 3), Compound 3 (SEQ ID NO. 4), Compound 4 (SEQ ID NO. 5), Compound 5 (SEQ ID NO. 6), Compound 6 (SEQ ID NO. 7), Compound 7 (SEQ ID NO. 8), Compound 8 (SEQ ID NO. 10), Compound 10 (SEQ ID NO. 11), Compound 11 (SEQ ID NO. 12), Compound 12 (SEQ ID NO. 13), Compound 13 (SEQ ID NO. 14), Compound 15 (SEQ ID NO. 16), Compound 16 (SEQ ID NO. 17), Compound 17 (SEQ ID NO. 18), Compound 18 (SEQ ID NO.
또한, 상기 본 발명에 따른 화학식 Ⅰ의 옥신토모듈린 펩타이드 유사체는 아미노산 서열 내에 하나 이상의 분자내 가교, 즉, X9와 X10은 분자내 결합 (락탐화, di-sulfide 결합) 또는 가교제 (cross linker)를 통하여 cyclic 펩타이드를 형성할 수 있다. In addition, the oxytocmodulin peptide analogue of formula (I) according to the present invention may include one or more intramolecular crosslinks in the amino acid sequence, that is, X 9 and X 10 may be linked by an intramolecular bond (lactamation, di- linkers to form cyclic peptides.
그러므로 본 발명의 다른 목적은 하기 화학식 Ⅱ의 아미노산 서열을 포함하는 신규한 옥신토모듈린 펩타이드 유사체를 제공하는 것이다.It is therefore a further object of the present invention to provide a novel oxytomodulin peptide analogue comprising the amino acid sequence of the following formula II.
<화학식 Ⅱ>&Lt; Formula (II)
His-X17-Gln-Gly-Thr-Phe-Thr-Ser-Asp-X18-Ser-Lys-Tyr-Leu-Asp-X19-Arg-Arg-Ala-X20-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys (SEQ ID NO.53) His-X 17 -Gln-Gly- Thr-Phe-Thr-Ser-Asp-X 18 -Ser-Lys-Tyr-Leu-Asp-X 19 -Arg-Arg-Ala-X 20 -Asp-Phe-Val- Gln-Trp-Leu-Met-Asn-Thr-Lys (SEQ ID NO: 53)
상기 식에서,In this formula,
X17은 Ser 또는 Aib (Aminoisobutric acid)이고;X 17 is Ser or Aib (Aminoisobutric acid);
X18은 Z이며;X 18 is Z;
X19는 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X 19 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
X20은 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X 20 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
X19와 X20은 분자내 결합 또는 가교제 (cross linker)을 통하여 cyclic 펩타이드를 형성할 수 있으며, 이때, cyclic 펩타이드는 두 잔기 사이에 아미드결합으로 형성된 락탐 링 또는 두 잔기 사이에 di-sulfide 결합으로 형성된 di-sulfide 링 또는 두 잔기 사이에 가교제 (cross linker) 결합으로 형성된 cross-linked 링을 가진 펩타이드이며;X 19 and X 20 can form a cyclic peptide through an intramolecular bond or a cross linker, wherein the cyclic peptide has a lactam ring formed by an amide bond between two residues, or a di-sulfide bond between two residues A peptide with a cross-linked ring formed by a cross-linker bond between the formed di-sulfide ring or two residues;
C-말단 아미노산은 임으로 아미드화 될 수 있으며;The C-terminal amino acid may be amidated in situ;
Z는 작용화된 Lys으로서 그 측쇄에 중합체성 부분과 스페이서의 접합체인 Z1과 친유성 리피드 부분인 Z2가 접합된 형태이며, 여기서 Z1은 아실 작용기를 통하여 Lys 측쇄와 직접적으로 접합되고 Z2는 Z1을 통해 Lys 측쇄에 접합되고, Z1은 하기 구조식 (1) 또는 (2)이고, Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is bonded to the Lys side chain through Z &lt; 1 & gt ;, Z &lt; 1 &gt; is the following structural formula (1)
(1)
Figure PCTKR2018009425-appb-I000005
(One)
Figure PCTKR2018009425-appb-I000005
(2)
Figure PCTKR2018009425-appb-I000006
(2)
Figure PCTKR2018009425-appb-I000006
Z2는 하기 구조식 (3) 또는 (4) 이다.Z 2 is the following structural formula (3) or (4).
(3)
Figure PCTKR2018009425-appb-I000007
(3)
Figure PCTKR2018009425-appb-I000007
(4)
Figure PCTKR2018009425-appb-I000008
(4)
Figure PCTKR2018009425-appb-I000008
X19와 X20의 분자내 결합은 X19와 X20이 각각 Asp (또는 Glu)와 Lys (또는 Orn)일때 또는 각각 Lys (또는 Orn)와 Asp (또는 Glu)일때 분자내 락탐 링 형성 결합이거나; X19와 X20이 각각 Cys (또는 Hcy)와 Cys (또는 Hcy)일때 분자내 di-sulfide 링 형성 결합이며;Bond in the molecule of X 19 and X 20 is X 19 and X 20 each Asp (or Glu) and Lys (or Orn) when the or each Lys (or Orn) and Asp (or Glu) when a bond in the lactam ring formation molecular ; An intramolecular di-sulfide ring forming bond when X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively;
X19와 X20이 각각 Cys(또는 Hcy)와 Cys(또는 Hcy)일때 가교제(cross linker)는 양쪽 Cys(또는 Hcy) 측쇄의 티올(thiol) 작용기에 결합되어 링을 형성하며, 이때 가교제는 C1-C6 직쇄 또는 분지쇄 알킬, C3-C8 포화 또는 불포화 사이클로알킬, C6-C10 아릴, 또는 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴이며, 바람직하게는When X 19 and X 20 are Cys (or Hcy) and Cys (or Hcy), respectively, the cross linker is bonded to the thiol functional group of both Cys (or Hcy) side chains to form a ring, C 1 -C 6 straight or branched chain alkyl, C 3 -C 8 saturated or unsaturated cycloalkyl, C 6 -C 10 aryl, or C 5 -C 12 heteroaryl or fused heterocyclic aryl,
Figure PCTKR2018009425-appb-I000009
Figure PCTKR2018009425-appb-I000009
R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이며;R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl;
X19와 X20이 각각 Asp(또는 Glu)와 Asp(또는 Glu)일때 가교제(cross linker)는 양쪽 Asp(또는 Glu) 측쇄의 카르복실기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-아미노 C1-C6 직쇄 또는 분지쇄 알킬, 디-아미노 C3-C8 포화 또는 불포화 사이클로알킬, 아미노 피페리딘, 피페라진, 디-아미노 C6-C10 아릴, 또는 디-아미노 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴이며, 바람직하게는 When X 19 and X 20 are Asp (or Glu) and Asp (or Glu), respectively, the cross linker forms a ring with the amide bond to the carboxyl group of both Asp (or Glu) side chains, Di-amino C 1 -C 6 straight or branched chain alkyl, di-amino C 3 -C 8 saturated or unsaturated cycloalkyl, aminopiperidine, piperazine, di-amino C 6 -C 10 aryl, or di-amino C 5 -C 12 heteroaryl or fused heterocyclic aryl,
Figure PCTKR2018009425-appb-I000010
Figure PCTKR2018009425-appb-I000010
R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이며;R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl;
X19와 X20이 각각 Lys(또는 Orn)와 Lys(또는 Orn)일때 가교제(cross linker)는 양쪽 Lys(또는 Orn) 측쇄의 아민기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-카르보닐 C1-C6 직쇄 또는 분지쇄 알킬, 디-카르보닐 C3-C8 포화 또는 불포화 사이클로알킬, 디-카르보닐 C6-C10 아릴 또는 디-카르보닐 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴이고, 바람직하게는 When X 19 and X 20 are Lys (or Orn) and Lys (or Orn) respectively, the cross linker forms a ring with an amide bond in the amine group of both Lys (or Orn) side chains, where the cross linker Di-carbonyl C 1 -C 6 straight or branched chain alkyl, di-carbonyl C 3 -C 8 saturated or unsaturated cycloalkyl, di-carbonyl C 6 -C 10 aryl or di-carbonyl C 5 -C 12 Heteroaryl or fused heterocyclic aryl, preferably &lt; RTI ID = 0.0 &gt;
Figure PCTKR2018009425-appb-I000011
Figure PCTKR2018009425-appb-I000011
R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이며;R is hydrogen or C 1 -C 6 straight-chain or a branched-chain alkyl;
X19와 X20이 각각 Asp(또는 Glu)와 Lys(또는 Orn)일때 또는 각각 Lys(또는 Orn)와 Asp(또는 Glu)일 때, 가교제(cross linker)는 Asp(또는 Glu) 측쇄의 카르복실기와 가교제(cross linker)의 아민 작용기와 아미드결합으로 연결되며, Lys(또는 Orn) 측쇄의 아민기에는 가교제(cross linker)의 카르복실 작용기와 아미드결합으로 연결되어 링을 형성하며, 이때 가교제(cross linker)는 알파 아미노산(Gly, Val, Leu, Ile 등), 베타 아미노산, 카르보닐 C1-C6 직쇄 또는 분지쇄 알킬아민, 카르보닐 C3-C8 포화 또는 불포화 알킬아민, 카르보닐 피페리딘, 아미노 벤조일, 카르보닐 C6-C10 아릴아민 또는 카르보닐 C5-C12 헤테로 아릴아민 또는 융합된 헤테로사이클릭 아릴아민이며, 바람직하게는 When X 19 and X 20 are Asp (or Glu) and Lys (or Orn), respectively, or when Lys (or Orn) and Asp (or Glu), respectively, the cross linker is the carboxyl group of the Asp The amine group of the side chain of Lys (or Orn) is connected to the carboxyl group of the cross linker by an amide bond to form a ring, and the cross linker ) May be selected from the group consisting of alpha amino acids (Gly, VaI, Leu, Ile, etc.), beta amino acids, carbonyl C 1 -C 6 linear or branched alkylamines, carbonyl C 3 -C 8 saturated or unsaturated alkylamines, , Aminobenzoyl, carbonyl C 6 -C 10 arylamine or carbonyl C 5 -C 12 heteroarylamine or fused heterocyclic arylamine, preferably
Figure PCTKR2018009425-appb-I000012
Figure PCTKR2018009425-appb-I000012
R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이다.R is hydrogen or C 1 -C 6 linear or branched alkyl.
상기 화학식 Ⅰ의 아미노산 서열 내에 하나 이상의 분자내 가교를 가질 수 있는 화학식 Ⅱ의 펩타이드 유사체를 포함하는 구현예에는, 화합물 14(SEQ ID NO. 15), 화합물 19(SEQ ID NO. 20), 화합물 20(SEQ ID NO. 21), 화합물 21(SEQ ID NO. 22), 화합물 22(SEQ ID NO. 23), 화합물 23(SEQ ID NO. 24), 화합물 24(SEQ ID NO. 25), 화합물 25(SEQ ID NO. 26), 화합물 27(SEQ ID NO. 28), 화합물 28(SEQ ID NO. 29), 화합물 29(SEQ ID NO. 30), 화합물 30(SEQ ID NO. 31), 화합물 31(SEQ ID NO. 32), 화합물 32(SEQ ID NO. 33), 화합물 33(SEQ ID NO. 34), 화합물 34(SEQ ID NO. 35), 화합물 35(SEQ ID NO. 36), 화합물 36(SEQ ID NO. 37), 화합물 37(SEQ ID NO. 38), 화합물 38(SEQ ID NO. 39)를 포함할 수 있다.Examples of embodiments that include peptide analogs of Formula II that may have one or more intramolecular bridging within the amino acid sequence of Formula I include Compound 14 (SEQ ID NO. 15), Compound 19 (SEQ ID NO. 20), Compound 20 (SEQ ID NO. 21), compound 21 (SEQ ID NO. 22), compound 22 (SEQ ID NO. 23), compound 23 (SEQ ID NO. 26), Compound 27 (SEQ ID NO. 28), Compound 28 (SEQ ID NO. 29), Compound 29 (SEQ ID NO. (SEQ ID NO. 32), Compound 32 (SEQ ID NO. 33), Compound 33 (SEQ ID NO. 34), Compound 34 (SEQ ID NO. (SEQ ID NO. 37), compound 37 (SEQ ID NO. 38), compound 38 (SEQ ID NO.
상기 화학식 Ⅱ 펩타이드의 가교는 화학식 Ⅰ의 서열 내에서 3개의 아미노산의 간격을 두고 분리된 두 개의 임의의 아미노산들이 각기 포함하고 있는 잔기 내 또는 측쇄 내 임의의 작용기 간의 화학적 공유결합, 또는 이온간 상호작용에 의해 이루어질 수 있다. 바람직하게는, X19 잔기와 X20 잔기의 아미노산 측쇄들끼리 락톤 환, 락탐 환 또는 di-sulfide 환을 형성하면서 가교가 이루어질 수 있고, 또한 X19 잔기와 X20 잔기의 아미노산 측쇄와 가교제(cross linker)의 연결을 통하여 환을 형성하면서 가교가 이루어질 수 있다.The cross-linking of the peptide of formula (II) may be carried out by chemical covalent bonding between any two functional groups in a residue or side chain of two arbitrary amino acids separated by three amino acids in the sequence of formula (I) Lt; / RTI &gt; Preferably, the amino acid side chains of the X 19 residue and the X 20 residue are cross-linked while forming a lactone ring, lactam ring or di-sulfide ring, and the amino acid side chain of the X 19 residue and the X 20 residue is cross- linker may be formed by forming a ring through the connection of the linker.
상기 화학식 Ⅱ의 아미노산 서열을 포함하는 신규한 펩타이드는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Cys 또는 Hcy으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Cys 또는 Hcy으로 치환 시킨 후 분자내 di-sulfide 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 28(SEQ ID NO. 29)의 경우, X19 위치를 Cys, X20 위치를 Cys으로 치환 후 분자내 di-sulfide 환을 형성시켜 제조할 수 있다.The novel peptide comprising the amino acid sequence of the above formula (II) can be obtained by substituting Cys or Hcy for the Ser residue present at position 16 of the natural aroma oxytomodulin and replacing the Gln residue at position 20 with Cys or Hcy (SEQ ID NO. 29) in the following embodiments, substituting Cys at position X 19 and Cys at position X 20 to form a di-sulfide ring in the molecule. to form a di-sulfide ring.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Cys 또는 Hcy으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Cys 또는 Hcy으로 치환 시킨 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 22(SEQ ID NO. 23)의 경우, X19 위치를 Cys, X20 위치를 Cys으로 치환 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Cys or Hcy for the Ser residue present at position 16 of the natural incoicotomodulin and substituting Cys or Gln for the Gln residue at position 20 (SEQ ID NO: 23) in the following embodiments, the X 19 position may be replaced by Cys, X may be replaced with Cys, 20 position to Cys and then connecting the two residues with a cross linker to form a ring.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Asp 또는 Glu으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Lys 또는 Orn으로 치환 시킨 후 분자내 락탐 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 26(SEQ ID NO. 27)의 경우, X19 위치를 Asp, X20 위치를 Lys으로 치환 후 분자내 락탐 환을 형성시켜 제조할 수 있고, 화합물 14(SEQ ID NO.15), 화합물 19(SEQ ID NO.20), 화합물 20(SEQ ID NO.21), 화합물 24(SEQ ID NO.25), 화합물 25(SEQ ID NO.26)의 경우, X19 위치를 Glu, X20 위치를 Lys으로 치환 후 분자내 락탐 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 27), substituting Asp for the position of X 19 and Lys for the position of X 20 in the case of Compound 26 (SEQ ID NO. 27) in the following embodiments, (SEQ ID NO. 25), compound 20 (SEQ ID NO. 21), compound 24 (SEQ ID NO. 25) , Compound 25 (SEQ ID NO. 26) can be prepared by replacing the X 19 position with Glu and the X 20 position with Lys to form a lactam ring in the molecule.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Asp 또는 Glu으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Lys 또는 Orn으로 치환 시킨 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 37(SEQ ID NO.38), 화합물 38(SEQ ID NO.39)의 경우, X19 위치를 Asp, X20 위치를 Lys으로 치환 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있고, 화합물 33(SEQ ID NO.34), 화합물 34(SEQ ID NO.35), 화합물 35(SEQ ID NO.36), 화합물 36(SEQ ID NO.37)의 경우, X19 위치를 Glu, X20 위치를 Lys으로 치환 후 가교제 (cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Asp or Glu for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Lys or (SEQ ID NO. 38), compound 38 (SEQ ID NO. 39) in the following embodiments, and the like can be produced by forming a ring by linking two residues with a cross linker after substitution with Orn. (SEQ ID NO. 34), Compound 34 (SEQ ID NO. 34), and Compound 34 (SEQ ID NO. 34) can be prepared by substituting Asp for the position of X 19 and Lys for the position of X 20 and then connecting the two residues using a cross linker. (SEQ ID NO. 35), Compound 35 (SEQ ID NO. 36) and Compound 36 (SEQ ID NO. 37), the X 19 position is replaced with Glu, the X 20 position is replaced with Lys, And then connecting the residues to form a ring.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Lys 또는 Orn으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Asp 또는 Glu으로 치환 시킨 후 분자내 락탐 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 21(SEQ ID NO. 22)의 경우, X19 위치를 Lys, X20 위치를 Glu으로 치환 후 분자내 락탐 환을 형성시켜 제조할 수 있고, 화합물 27(SEQ ID NO.28)의 경우, X19 위치를 Lys, X20 위치를 Asp로 치환 후 분자내 락탐 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or (SEQ ID NO. 22) in the following embodiments, the X 19 position is replaced with Lys, the X 20 position is replaced with Glu, and the molecule (27) (SEQ ID NO. 28) can be prepared by substituting Lys at position X 19 and Asp at position X 20 to form a lactam ring in the molecule.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Lys 또는 Orn으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Asp 또는 Glu으로 치환 시킨 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 32(SEQ ID NO.33)의 경우, X19 위치를 Lys, X20 위치를 Glu로 치환 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for substituting the Gln residue at position 20 for Asp or Glu, and then connecting the two residues using a cross linker to form a ring. For example, in the case of the compound 32 (SEQ ID NO. 33) in the following embodiments, the X 19 position is substituted with Lys, X 20 position with Glu and then connecting the two residues with a cross linker to form a ring.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Asp 또는 Glu으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Asp 또는 Glu으로 치환 시킨 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 23(SEQ ID NO.24), 화합물 29(SEQ ID NO.30), 화합물 30(SEQ ID NO.31)의 경우, X19 위치를 Glu, X20 위치를 Glu으로 치환 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be prepared by substituting Asp or GIu for the Ser residue present at position 16 of the natural flavor oxin tosomandrin, converting the Gln residue at position 20 to Asp (SEQ ID NO. 24), compound 29 (SEQ ID NO. 30) in the following embodiments, and the like. , Compound 30 (SEQ ID NO: 31) can be prepared by replacing the X 19 position with Glu and the X 20 position with Glu, and then connecting the two residues with a cross linker to form a ring.
또한, 상기 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 천연향 옥신토모듈린의 16번 위치에 존재하는 Ser 잔기를 Lys 또는 Orn으로 치환시키고, 20번 위치에 존재하는 Gln 잔기를 Lys 또는 Orn으로 치환 시킨 후 가교제(cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있으며, 예로서 하기 구현예 중 화합물 31(SEQ ID NO.32)의 경우, X19 위치를 Lys, X20 위치를 Lys으로 치환 후 가교제 (cross linker)로 두 잔기를 연결하여 환을 형성시켜 제조할 수 있다.In addition, the acylated oxytomodulin peptide analogue according to the present invention may be obtained by substituting Lys or Orn for the Ser residue present at position 16 of the natural oriental oxytomodulin and for replacing the Gln residue at position 20 with Lys or Orn and then connecting two residues using a cross linker to form a ring. For example, in the case of Compound 31 (SEQ ID NO. 32) in the following embodiments, the X 19 position is substituted with Lys, X 20 position with Lys and then connecting the two residues with a cross linker to form a ring.
이와 같은 분자 내 가교는 펩타이드의 알파 나선 구조를 안정화시켜 GLP-1 수용체 또는/ 및 글루카곤 수용체에서 그 선택성이나 약리상 효능을 증가시키는 것으로 여겨진다(ACS Chem Biol. 2016;11:324-328).Such intramolecular crosslinking is believed to stabilize the alpha helical structure of the peptide to increase its selectivity or pharmacological efficacy at the GLP-1 receptor and / or glucagon receptor (ACS Chem Biol. 2016; 11: 324-328).
본 발명의 옥신토모듈린 펩타이드 유사체는 화학적으로 변형될 수 있다. 특히, 펩타이드를 이루는 각각의 아미노산 잔기는 다양한 스페이서나 링커와 직접적으로 연결될 수 있으며, 또한 각각의 잔기들은 알킬화, 이황화 결합 형성, 금속 착화, 아미드화, 에스테르화, 산화, 환원 등의 화학적 반응을 일으켜 해당하는 화학적 산물로 변형될 수 있다. 특히, 본 발명의 옥신토모듈린 펩타이드 유사체 구조에 존재하는 임의의 카르복시 말단 또는 아미노 말단은 에스테르화, 아미드화, 아실화 등을 통해 유사체화될 수 있다. 더하여, 본 발명의 옥신토모듈린 펩타이드 유사체는 그 구조에 존재하는 임의의 아민기의 산 부가 염이나 임의의 카르복시기의 카르복실레이트 염 또는 이의 알칼리 부가 염으로서 제공될 수 있다.The auxin to moduline peptide analogs of the present invention can be chemically modified. In particular, each amino acid residue of the peptide can be directly linked to various spacers or linkers, and each residue can undergo chemical reactions such as alkylation, disulfide bond formation, metal complexation, amidation, esterification, oxidation, It can be transformed into a corresponding chemical product. In particular, any carboxy terminal or amino terminal present in the auxin tomodulin peptide analogue structure of the present invention can be analogized through esterification, amidation, acylation, and the like. In addition, the oxytomodulin peptide analog of the present invention may be provided as an acid addition salt of any amine group present in its structure or as a carboxylate salt of any carboxyl group or an alkali addition salt thereof.
또한, 본 발명은 상기 펩타이드 유사체를 유효성분으로 하며, 약학적으로 허용가능한 부형제를 포함하는 비만 또는 과체중 및 이를 동반하는 당뇨병 예방 및 치료용 약학조성물에 관한 것이다.The present invention also relates to a pharmaceutical composition for preventing and treating obesity or overweight and accompanying diabetes comprising the peptide analogue as an active ingredient and a pharmaceutically acceptable excipient.
본 발명의 용어 “예방”이란 목적하는 질환의 발병을 억제하거나 지연시키는 모든 행위를 의미한다. 또한, 본 발명의 용어 “치료”란 발생된 질병의 증상을 경감, 개선 또는 완화시키는 모든 행위를 의미한다.The term &quot; prevention &quot; of the present invention means all actions that inhibit or delay the onset of the desired disease. In addition, the term &quot; treatment &quot; of the present invention means any action that alleviates, alleviates, or alleviates the symptoms of the disease that has occurred.
특히, 본 발명의 펩타이드 유사체는 글루카곤 수용체와 GLP-1 수용체에 대한 이중 작용제로서 음식 섭취에 있어서의 GLP-1의 효과와 지방 대사와 에너지 소비에 있어서의 글루카곤의 효과를 모두 나타내므로, 본 발명의 펩타이드 유사체를 포함하는 비만 또는 과체중 및 이를 동반하는 당뇨병 예방 및 치료용 약학조성물은 과도하게 축적된 지방의 제거와 음식 섭취 억제의 조합된 효과를 통해 체중의 조절에 있어서 의학적으로 유리한 효과를 유도할 수 있다. In particular, the peptide analogs of the present invention exhibit both the effect of GLP-1 on food intake and the effect of glucagon on fat metabolism and energy consumption as dual agonists for the glucagon receptor and GLP-1 receptor, A pharmaceutical composition for the prevention and treatment of obesity or overweight and accompanying diabetes comprising a peptide analogue can induce a medically beneficial effect in the control of body weight through the combined effect of excessive accumulation of fat and inhibition of food intake have.
또한, 본 발명의 펩타이드 유사체와 이를 포함한 약학 조성물은 혈당을 감소시켜 비만을 동반하는 당뇨병 예방 또는 치료에 사용될 수 있다. 특히 비만이 동반되는 비 인슐린 의존성 당뇨병인 2형 당뇨병을 치료하는데 사용될 수 있다. 특정한 이론에 그 해석을 제한받고자 하는 바는 아니나, 본 발명의 펩타이드 유사체를 포함한 약학 조성물은 글루카곤 유도체 중의 하나로 혈당을 감소시키는 역할을 하는 GLP-1 수용체에의 활성이 높아 궁극적으로 혈당 조절에 유용하다.In addition, the peptide analog of the present invention and the pharmaceutical composition containing the same can be used for prevention or treatment of diabetes accompanied by obesity by reducing blood sugar. It can be used to treat type 2 diabetes, especially non-insulin dependent diabetes mellitus with obesity. While not intending to be bound by any particular theory, the pharmaceutical composition comprising the peptide analog of the present invention is one of the glucagon derivatives, and has a high activity on the GLP-1 receptor which plays a role in reducing blood glucose, and is ultimately useful for controlling blood glucose .
따라서, 본 발명의 펩타이드 유사체를 포함한 약학조성물은 비만, 병적 비만, 수술전 병적 비만, 비만 관련 염증, 비만 관련 쓸개 질환, 비만 유도된 수면 무호흡, 비만을 동반하는 당뇨병의 치료 및 예방과 같은, 과체중에 의해 야기되거나 특징지어지는 임의의 병태의 직접 또는 간접 치료법의 일환으로 단독으로 투여되거나 또는 다른 관련 약제와 병용 투여될 수 있다. 또한, 본 발명의 펩타이드 유사체를 포함한 약학조성물은 체중에 의한 효과의 결과이거나 이와 관련되어 있을 수 있는 병태, 예를 들면 대사 증후군, 고혈압, 동맥경화 유발 이상지혈증, 죽상동맥경화증, 동맥경화증, 관상동맥 심장 질환, 또는 뇌졸중의 예방을 위해 단독으로 투여되거나 또는 다른 관련 약제와 병용 투여될 수 있다.Accordingly, the pharmaceutical compositions comprising the peptide analogs of the present invention are useful for the treatment and prevention of obesity, pathological obesity, preoperative obesity, obesity related inflammation, obesity related gallbladder disease, obesity induced sleep apnea, obesity associated diabetes, As a direct or indirect treatment of any condition caused or characterized by, or in combination with, other related agents. In addition, the pharmaceutical compositions containing the peptide analogs of the present invention may be used for the treatment of conditions which may result from or be associated with weight gain, such as metabolic syndrome, hypertension, atherosclerotic dyslipidemia, atherosclerosis, arteriosclerosis, Heart disease, or stroke, or may be co-administered with other related agents.
본 발명에서 “투여”는, 적절한 방법으로 환자에게 치료 용도의 물질을 도입하는 것을 의미하며, 본 발명의 펩타이드 유사체를 포함한 약학조성물은 약물이 목적 조직에 도달하여 목적하는 효능을 나타낼 수 있는 한 다양한 제형의 형태로 다양한 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비내 투여, 폐내 투여, 직장내 투여 등이 가능하나, 그 제형과 투여 방법이 제한되지는 않는다. In the present invention, &quot; administration &quot; means introducing a substance for therapeutic use into a patient in an appropriate manner, and the pharmaceutical composition containing the peptide analog of the present invention can be administered to a patient in a variety of ways May be administered via various routes in the form of a formulation. Intraperitoneal, intravenous, intramuscular, subcutaneous, intradermal, oral, topical, intranasal, intrapulmonary, rectal, and the like, but the formulation and administration method is not limited.
본 발명의 옥신토모듈린 펩타이드 유사체를 포함한 약학조성물은 약제학적으로 허용 가능한 담체를 포함할 수 있다. 약제학적으로 허용되는 담체는 경구투여시에는 결합제, 활택제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장화제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 다양하게 사용할 수 있다. The pharmaceutical compositions comprising the oxytomodulin peptide analogs of the present invention may comprise a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizing agent, a dispersing agent, a stabilizer, a suspending agent, a colorant, a perfume or the like in the case of oral administration. A solubilizing agent, an isotonic agent, a stabilizing agent, etc. may be used in combination. In the case of topical administration, a base, an excipient, a lubricant, a preservative, etc. may be used in various ways.
본 발명의 옥신토모듈린 펩타이드 유사체의 제제화에 사용될 수 있는 담체, 부형제 및 희석제의 예로는 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 있다. Examples of carriers, excipients and diluents that can be used in the formulation of the oxytomodulin peptide analog of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin , Calcium phosphate, calcium silicate, cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil.
본 발명의 옥신토모듈린 펩타이드 유사체를 포함한 약학조성물은 상술된 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여 시에는 정제, 트로키, 캡슐, 엘릭서, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 이외 용액, 현탁액, 정제, 환약, 캡슐, 서방형 제제 등으로도 제형화 할 수 있다.Pharmaceutical compositions containing the oxytomodulin peptide analogs of the present invention can be prepared in various manners by mixing with the carriers described above. For example, oral administration may be in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc. In the case of injections, unit dosage ampoules or multiple dosage forms may be prepared. In addition, it can be formulated into solutions, suspensions, tablets, pills, capsules, sustained release formulations and the like.
본 발명에 따른 투여량 또는 복용량은 환자의 체중, 연령, 성별, 건강상태, 식이, 배설율 및 질환의 중증도에 따라 그 범위가 다양하며, 성인 기준으로 투여량은 1일당 0.001 mg/kg 내지 500 mg/kg일 수 있다.The dosage or dose according to the present invention varies depending on the patient's body weight, age, sex, health condition, diet, excretion rate and severity of the disease, and the dose is 0.001 mg / kg to 500 mg / kg.
본 발명은 신규의 아실화 옥신토모듈린 펩타이드 유사체를 제공하며, 본 발명에 의한 펩타이드 유사체는 천연형의 옥신토모듈린에 비해 GLP-1 수용체와 글루카곤 수용체 모두에 대하여 더 우수한 활성을 가지고 있다. 특히, 본 발명은 GLP-1 수용체에 비해 글루카곤 수용체 작용제로서 더 높은 생물학적 활성이 보여진다. The present invention provides novel acylated oxytomodulin peptide analogs wherein the peptide analogs of the present invention have greater activity against both the GLP-1 receptor and the glucagon receptor than the native oxytomodulin. In particular, the present invention shows a higher biological activity as a glucagon receptor agonist compared to the GLP-1 receptor.
따라서, 본 발명은 신규의 아실화 옥신토모듈린 펩타이드 유사체를 포함하는 약학조성물은 일차적으로 비만 또는 과체중에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료에 유용하게 적용될 수 있으며, 나아가 비만 또는 과체중을 동반하는 비 인슐린 의존성 당뇨병의 예방 또는 치료의 목적으로도 사용될 수 있다.Accordingly, the present invention provides a pharmaceutical composition comprising a novel acylated auxin tomodulin peptide analogue, which is useful primarily in the prevention or treatment of conditions caused or characterized by obesity or overweight, and further, May also be used for the purpose of preventing or treating the accompanying non-insulin dependent diabetes mellitus.
도 1은 본 발명에 의한 아실화 옥신토모듈린 유사체의 마우스에서 단회 체중감소 약효평가 결과를 나타낸 그래프이다.FIG. 1 is a graph showing the effect of the acylated oxytomodulin analogues of the present invention on the single- Fig.
도 2는 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 1주 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 2a는 체중 감소 결과, 도 2b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 2 is a graph showing the results of evaluating the effects of acylated oxytomodulin peptide analogues of the present invention on the reduction of weight loss for one week in a mouse. FIG. 2a is a graph showing weight loss results and FIG. 2b is a graph showing cumulative feed intake results.
도 3은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 랫드에서 5일 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 3a는 체중 감소 결과, 도 3b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 3 is a graph showing the result of 5-day repeated weight loss effect evaluation of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 3 a is a graph showing weight loss results and FIG. 3 b is a graph showing cumulative feed intake results.
도 4는 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 10일 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 4a는 체중 감소 결과, 도 4b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 4 is a graph showing the result of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 4A is a graph showing weight loss results and FIG. 4B is a graph showing cumulative feed intake results.
도 5는 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 10일 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 5a는 체중 감소 결과,도 5b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 5 is a graph showing the results of evaluating the 10-day repeated weight loss effect of the acylated auxin tomodulin peptide analogue according to the present invention, wherein FIG. 5A is a graph showing weight loss results and FIG. 5B is a graph showing cumulative feed intake results.
도 6은 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 1주 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 6a는 체중 감소 결과, 도 6b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 6 is a graph showing the result of evaluating the effect of acylated oxytomodulin peptide analogue of the present invention on the reduction of weight loss for one week in a mouse. FIG. 6A is a graph showing weight loss results and FIG. 6B is a graph showing cumulative feed intake results.
도 7은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 2주 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 7a와 도 7c는 체중 감소 결과이고, 도 7b는 도 7a에 표기된 아실화 옥신토모듈린 펩타이드 유사체의 누적 사료 섭취량 결과를 나타낸 그래프이며, 도 7d는 도 7c에 표기된 아실화 옥신토모듈린 펩타이드 유사체의 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 7 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the weight reduction effect for two weeks in a mouse, wherein FIGS. 7A and 7C are weight loss results, and FIG. FIG. 7D is a graph showing cumulative feed intake results of acylated auxin tomodulin peptide analogues shown in FIG. 7C. FIG. 7D is a graph showing cumulative feed intake results of actual oxyntomodulin peptide analogues.
도 8은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 2주 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 8a는 체중 감소 결과, 도 8b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 8 is a graph showing the results of evaluating the effect of acylated oxytomodulin peptide analogues according to the present invention on the reduction of weight loss for two weeks in a mouse. FIG. 8A is a graph showing weight loss results and FIG. 8B is a graph showing cumulative feed intake results.
도 9는 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 5일 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 9a는 체중 감소 결과,도 9b는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 9 is a graph showing the result of 5-day repeated weight loss effect evaluation in mice of acylated oxytomodulin peptide analogues according to the present invention, wherein FIG. 9A is a graph showing weight loss results and FIG. 9B is a graph showing cumulative feed intake results.
도 10은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 4주 반복 체중 감소 약효평가 결과를 나타낸 그래프로서, 도 10a는 체중 감소 결과, 도 10b는 체지방 감소 결과, 도 10c는 누적 사료 섭취량 결과를 나타낸 그래프이다.FIG. 10 is a graph showing the result of weight loss reduction effect evaluation of the acylated oxytomodulin peptide analogue according to the present invention for 4 weeks in a mouse, wherein FIG. 10A is a weight loss result, FIG. 10B is a body fat reduction result, Fig.
도 11은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 내당력 개선 효과 검정 결과를 나타낸 그래프이다.FIG. 11 is a graph showing the results of assaying the potency of acylated oxytomodulin peptide analogues in the mouse according to the present invention.
도 12는 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 6주 반복 혈당조절 약효평가 결과를 나타낸 그래프로서, 도 12a는 최종 비절식 혈당 결과, 도 12b는 당화 혈색소 상승 억제 결과를 나타낸 그래프이다. FIG. 12 is a graph showing the results of evaluating the blood glucose-modulating effect of the acylated oxytomodulin peptide analogue according to the present invention for 6 weeks in a mouse, wherein FIG. 12A is a final non-fasting blood glucose result, and FIG. Graph.
도 13은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 마우스에서 4주 반복 혈당조절 약효평가 결과를 나타낸 그래프로서, 도 13a는 경시적인 비절식 혈당 결과, 도 13b는 당화 혈색소 상승 억제 및 개선에 대한 결과를 나타낸 그래프이다.FIG. 13 is a graph showing the results of evaluating the effect of acylated auxin tomodulin peptide analogue according to the present invention on the blood glucose control effect for four weeks in a mouse, wherein FIG. 13A is a time- FIG.
본 발명에 대한 보다 구체적인 내용을 하기 실시예 및 실험예에 의하여 설명한다. 이들 실시예는 본 발명에 대한 이해를 돕기 위한 것일 뿐, 어떤 의미로든 본 발명의 범위가 이들 실시예로 한정되는 것은 아니다.The present invention will be described in more detail with reference to the following examples and experimental examples. These embodiments are provided to aid understanding of the present invention, and the scope of the present invention is not limited to these embodiments in any sense.
<실시예 1> &Lt; Example 1 > 아실화 옥신토모듈린 펩타이드 유사체 합성Synthesis of acylated oxytomolin peptide analogs
본 발명의 일부 아미노산이 포함된 펩타이드와 정형적인 펩타이드 서열은 상업화된 펩타이드 합성 회사, 예를 들어 미국의 American peptide company나 Bachem, 또는 한국의 Anygen을 통해 합성 및 구매가능하다.Some amino acid-containing peptides and regular peptide sequences of the invention can be synthesized and purchased through commercialized peptide synthesis companies, such as the American peptide company in the United States or Bachem in the United States, or Anygen in Korea.
본 발명에서 아실화 옥신토모듈린 펩타이드 유사체를 합성하기 위해 자동합성기인 protein technologies,Inc.사의 Symphomy X(합성 scale: 0.1mmol)모델을 이용하여 합성하였고, 본 발명의 의해 합성된 아실화 옥신토모듈린 펩타이드 유사체인 화합물 1(SEQ ID NO. 2) 내지 화합물 38(SEQ ID NO. 39)의 구조는 표 1 및 표 2에 나타내었다. 구체적인 합성 과정은 다음과 같다.In the present invention, an acylated oxytomodulin peptide analog was synthesized using a symphomy X (synthetic scale: 0.1 mmol) model of an automatic synthesizer, protein technologies, Inc., The structures of Compound 1 (SEQ ID NO. 2) to Compound 38 (SEQ ID NO. 39), which are modulin peptide analogues, are shown in Table 1 and Table 2. The specific synthesis procedure is as follows.
Fmoc-AA-OH(1mmol), HBTU(1mmol), NMM(n-methylmorpholine)(2mmol) 및DMF(7ml) 혼합액을 Fmoc이 제거된 레진(resin)에 넣고 실온에서 1시간 교반시킨다. 반응액을 배출시키고 DMF(N,N-Dimethylmethanamide) 7ml로 2회 세척한다. 20% Piperidine DMF용액(5ml)으로 Fmoc 제거(cleavage)반응을 실온에서 5분 2회 수행한 후, DMF(7ml)로 6회 세척한다. 이 과정을 자동합성기를 이용하여 반복하면서 아미노산을 커플링(coupling) 시킨다.Add a mixture of Fmoc-AA-OH (1 mmol), HBTU (1 mmol), NMM (n-methylmorpholine) (2 mmol) and DMF (7 ml) into Fmoc-free resin and stir at room temperature for 1 hour. The reaction solution is drained and washed twice with 7 ml of DMF (N, N-Dimethylmethanamide). Fmoc cleavage with 20% Piperidine DMF solution (5 ml) was performed twice at room temperature for 5 min and then 6 times with DMF (7 ml). This process is repeated using an automatic synthesizer to couple amino acids.
K(Lys) side 합성은 Fmoc-K(dde)-OH을 사용하여 커플링하고, 마지막 H(His)는 Boc-His(trt)-OH를 사용하여 커플링한다. 2% hydralazine을 이용하여 보호화 된 dde제거 후 PEG2, rE, C18, C18 diacid 등을 커플링시킨다. 락탐 링 합성은 Glu(Oall) 및 Lys(Alloc)으로 편입된 아미노산을 사용하여 coupling하고, 보호기 제거 후 과량의 HBTU 및 DIPEA를 사용하여 락탐 결합을 수행한다. di-sulfide 링은 보호기로 편입된 Ser 아미노산을 사용하여 커플링하고, 보호기 제거 후, di-sulfide 결합을 수행한다. 가교제 (cross linker)를 도입하고자 하는 위치에 적절한 보호기로 편입된 아미노산을 사용하여 커플링하고, 보호기를 제거 후 아미드 커플링 시약 등을 사용하여 가교제 (cross linker)와 두 아미노산 간의 결합을 수행한다.The K (Lys) side synthesis is coupled using Fmoc-K (dde) -OH and the last H (His) is coupled using Boc-His (trt) -OH. After removal of the protected dde using 2% hydralazine, PEG2, rE, C18, C18 diacid, etc. are coupled. The lactam ring synthesis is carried out using amino acids incorporated with Glu (Oall) and Lys (Alloc), followed by lactam coupling using excess HBTU and DIPEA after removal of the protecting group. The di-sulfide ring is coupled using a ser amino acid incorporated as a protecting group, followed by removal of the protecting group, followed by di-sulfide bonding. Coupling is performed using an amino acid incorporated with an appropriate protecting group at a position where a cross linker is to be introduced, and a linker and a two amino acid bond are performed using an amide coupling reagent or the like after removing the protecting group.
상기에서 얻은 peptide-resin 0.1mmol에 Reagent K (trifluoroacetic acid, water, thioanisole, 1,2-ethandithiol (87.5, 5.0, 5.0, 2.5)) 용액 8ml를 5~10℃로 냉각 후 넣고 실온에서 2~3시간 교반시킨다. drain후 소량의 TFA로 resin을 세척하고, 여액을 합하여 diethyl ether 100ml에 넣어 결정화 시킨 후, 생성된 고체를 여과하여 crude 펩타이드를 얻는다. 얻어진 조결 펩타이드를 preparative HPLC로 정제하여 목적 화합물을 얻는다.8 ml of a solution of Reagent K (trifluoroacetic acid, water, thioanisole, 1,2-ethanthiol (87.5, 5.0, 5.0, 2.5)) was added to 0.1 mmol of the peptide-resin obtained above, cooled to 5-10 ° C, Stir for a time. After draining, the resin is washed with a small amount of TFA and the filtrate is combined and crystallized by adding 100 ml of diethyl ether. The resulting solid is filtered to obtain a crude peptide. The resulting crude peptide is purified by preparative HPLC to obtain the target compound.
분자량분석은 shimadzuAxima Assurance MALDI-TOF 이용하였으며, Matrix는CHCA(α-Cyano-4-hydroxycinnamic acid)를 사용하였다.Molecular weight analysis was performed using shimadzuAxima Assurance MALDI-TOF and Matrix using CHCA (α-Cyano-4-hydroxycinnamic acid).
Figure PCTKR2018009425-appb-T000001
Figure PCTKR2018009425-appb-T000001
Figure PCTKR2018009425-appb-I000013
Figure PCTKR2018009425-appb-I000013
Figure PCTKR2018009425-appb-I000014
Figure PCTKR2018009425-appb-I000014
Figure PCTKR2018009425-appb-I000015
Figure PCTKR2018009425-appb-I000015
Figure PCTKR2018009425-appb-T000002
Figure PCTKR2018009425-appb-T000002
Figure PCTKR2018009425-appb-I000016
Figure PCTKR2018009425-appb-I000016
<< 비교예Comparative Example 1>  1> 옥신토모듈린Auxinomodulin 펩타이드Peptides 유사체 합성 Analog synthesis
본 발명과 비교하기 위하여, 구조적으로 유사성을 갖는 옥신토모듈린 펩타이드 유사체를 실시예 1의 방법으로 합성하였다. 하기 화합물 39는 비아실화 된 옥신토모듈린 펩타이드 유사체이고, 화합물 40 및 41은 아실화 위치가 다른 옥신토모듈린 펩타이드 유사체이며, 화합물 42 내지 46은 아실화 말단이 다른 옥신토모듈린 펩타이드 유사체이며, 화합물 47은 대한민국 공개특허공보 제2012-139579호에 공지된 것으로서, 링 구조를 갖는 비아실화 된 옥신토모듈린 펩타이드 유사체이다. 상기 화합물 39 내지 47의 합성된 옥신토모듈린 펩타이드 유사체의 구조는 표 3 및 표 4에 나타내었다.For comparison with the present invention, an oximostomulin peptide analogue having structural similarity was synthesized by the method of Example 1. The following compounds 39 are nonacylated oxytomodulin peptide analogs, compounds 40 and 41 are oximodomaine peptide analogs with different acylation positions, compounds 42 to 46 are different oximounderin peptide analogs with acylated ends , Compound 47 is a nonacylated oxytomodulin peptide analogue having a ring structure, which is disclosed in Korean Laid-Open Patent Publication No. 2012-139579. The structures of the synthesized oxynomodulin peptide analogues of the compounds 39 to 47 are shown in Tables 3 and 4.
Figure PCTKR2018009425-appb-T000003
Figure PCTKR2018009425-appb-T000003
Figure PCTKR2018009425-appb-T000004
Figure PCTKR2018009425-appb-T000004
<< 실험예Experimental Example 1>  1> GLP-1 및 글루카곤 수용체 GLP-1 and glucagon receptor 활성화능Activation ability 검정 black
세포에 사람 GLP-1 또는 글루카곤 수용체를 일시적으로 과발현시켜 본 발명의 유사체가 수용체를 활성화시킴으로써 증가되는 사이클릭 아데노신 일인산(cAMP)이 순차적으로 사이클릭 아데노신 일인산 반응성 프로모터(CRE)를 활성화시키게 되면 이후 증가되는 루시퍼라아제 활성정도를 각 수용체 활성화에 대한 효능의 의미로 평가하였다. When cyclic adenosine monophosphate (cAMP), which is elevated by transiently overexpressing human GLP-1 or glucagon receptors in cells by activating receptors of the present invention, activates the cyclic adenosine monophosphate reactive promoter (CRE) The degree of luciferase activity, which was increased afterwards, was evaluated as the efficacy of each receptor activation.
양성 대조약물로는 GLP-1과 글루카곤을 각각의 평가에 사용하였고, 비교예로는 GLP-1 agonist로 당뇨병 치료제로의 승인받은 Liraglutide와 Semaglutide 그리고 옥신토모듈린 펩타이드 유사체로 임상 2상 개발 중인 MEDI0382(Diabetes, Obesity and Metabolism 2016; 18: 1176-1190, Lancet 2018; 391: 2607-2618) 및 상기 화합물 39 내지 47의 펩타이드를 합성하여 이를 비교예로 하였다.As a positive control, GLP-1 and glucagon were used for evaluation. As a comparative example, GLP-1 agonist was approved as a diabetic drug, Liraglutide, Semaglutide, and oxytocmodulin peptide analogue, and MEDI0382 (Diabetes, Obesity and Metabolism 2016; 18: 1176-1190, Lancet 2018; 391: 2607-2618) And the peptides of the above compounds 39 to 47 were synthesized, and these were compared as a comparative example.
세포는 중국 햄스터 난소 세포(CHO-K1)에 사람 GLP-1 또는 글루카곤 발현벡터(이상 Origene)를 반딧불이 루시퍼라아제(firefly luciferase) 또는 레닐라 루시퍼라아제(renilla luciferase) 발현을 유도할 수 있는 각각의 플라스미드 DNA들과 함께 리포펙타민 플러스 시약(Lipofectiamine Plus reagent, Invitrogen)을 이용하여 상기 세포에 일시적으로 트랜스팩션시켰다. 3시간 트랜스펙션 후 10% 소태아혈청(FBS)을 포함하는 영양배지(α-MEM)로 교환하였다. 다음 날 본 발명의 유사체 및 0.1% 소혈청알부민(BSA)을 포함하는 α-MEM 배지로 교환하였고, 6시간 후 세포가 잠긴 배지와 동량의 듀얼 루시퍼라아제 검색 시약(Dual luciferase assay reagent, Promega)을 가하여 연속적으로 반딧불이 루시퍼라아제 및 레닐라 루시퍼라아제의 활성을 측정하였다. 반딧불이 루시퍼라아제 활성은 레닐라 루시퍼라아제 활성으로 보정하여 트랜스펙션에 대한 효율을 산출하였다.Cells were transfected with Chinese hamster ovary (CHO-K1) human GLP-1 or glucagon expression vector (Origene) to induce firefly luciferase or renilla luciferase expression (Lipofectiamine Plus reagent, Invitrogen) with the plasmid DNAs of the transfected cells. After 3 hours of transfection, the cells were exchanged with nutrient medium (α-MEM) containing 10% fetal bovine serum (FBS). On the next day, the cells were exchanged with α-MEM medium containing the analog of the present invention and 0.1% bovine serum albumin (BSA). After 6 hours, the same amount of dual luciferase assay reagent (Promega) Was added thereto to continuously measure the activities of firefly luciferase and renilla luciferase. Firefly luciferase activity was calibrated with renilla luciferase activity to yield efficiency for transfection.
수용체의 활성 효능은 본 발명의 유사체에 대한 다중 농도 평가를 실시하여 본 발명의 유사체들의 GLP-1 또는 글루카곤 최대 효과에 대한 상대적 활성화도(%)를 구하여 50% 활성화를 나타내는 농도(EC50)를 비선형회귀 분석을 이용하여 산출한 값을 표 5에 나타내었다.The activity of the receptor is determined by conducting multiple concentration assessments of the analogs of the present invention to determine the relative activity (%) for the GLP-1 or glucagon maximal effects of the analogs of the invention to determine the concentration (EC 50 ) The values calculated using nonlinear regression analysis are shown in Table 5.
Figure PCTKR2018009425-appb-T000005
Figure PCTKR2018009425-appb-T000005
Figure PCTKR2018009425-appb-I000017
Figure PCTKR2018009425-appb-I000017
실험결과, 본 발명에 의한 아실화 옥신토모듈린 유사체의 화합물들이 내인성 호르몬 옥신토모듈린보다 GLP-1 및 글루카곤 수용체에 대한 EC50값이 현저히 낮아 GLP-1 및 글루카곤 수용체에 대한 활성이 우수함을 알 수 있다. 또한 현재 시판중인 당뇨병 치료제인 Liraglutide와 Semaglutide를 비교하였을 때 GLP-1 수용체에 대한 활성이 우수하였고, 현재 임상중인 옥신토모듈린 펩타이드 유사체인 MEDI0382와 비교했을 때 글루카곤 수용체에 대한 활성은 우수하였고, GLP-1 수용체에 대한 활성은 유사하였다.The experimental results, the acylation auxin Sat module compound the lean analogs are endogenous hormones auxin Sat module is lean than GLP-1 and the activity of the EC 50 value is significantly lower GLP-1 and glucagon receptors for glucagon receptor Great according to the invention Able to know. Compared with MEDI0382, which is a clinical analogue of auxin tomodulin, the activity against GLP-1 receptor was superior and GLP-1 receptor -1 receptor were similar.
본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체인 화합물 3은 비아실화 옥신토모듈린 펩타이드 유사체인 비교예의 화합물 39와 비교하였을 때, GLP-1 및 글루카곤 수용체에 대한 활성을 매우 증가시켰음을 알 수 있어, 옥신토모듈린 펩타이드 유사체의 아실화는 활성 증가에 큰 영향을 끼치는 것으로 평가된다. Compound 3, an acylated auxin tomodulin peptide analogue according to the present invention, was found to greatly increase the activity against GLP-1 and glucagon receptors when compared to Compound 39 of the comparative example, which is a nonacylated oxytomodulin peptide analogue , Indicating that the acylation of auxin to modulin peptide analogs has a significant effect on the increase in activity.
또한, X2의 위치에 아실화된 비교예의 화합물 40과 X14의 위치에 아실화된 비교예의 화합물 41은 각각 X3, X9, X10의 위치에 아실화된 본 발명에 의한 화합물 3, 화합물 15, 화합물 16과 비교하였을 때, GLP-1 및 글루카곤 수용체에 대한 활성이 매우 감소하였음을 알 수 있어, 옥신토모듈린 펩타이드 유사체에 대한 아실화 위치가 활성에 큰 영향을 주는 것으로 평가된다.The compound 40 of the comparative example which was acylated at the position of X 2 and the compound 41 of the comparative example which was acylated at the position of X 14 were the compound 3 according to the present invention which was acylated at the positions of X 3 , X 9 and X 10 , Compared with compounds 15 and 16, it was found that the activity against GLP-1 and glucagon receptors was greatly reduced. Thus, it is estimated that the position of acylation with respect to auxin tomodulin peptide analogue greatly affects the activity.
또한, Z1의 중합체성 부분으로서 2-(2-(2-aminoethoxy)ethoxy)acetoyl기 개수가 각각 1 ~ 4개로 구성된 본 발명에 의한 아실화된 화합물 3, 화합물 10, 화합물 17, 화합물 18은 2-(2-(2-aminoethoxy)ethoxy)acetoyl기 개수에 따른 in vitro 활성 차이는 없었고, 모두 GLP-1 및 글루카곤 수용체에 대한 활성이 우수하였다.The acylated compounds 3, 10, 17 and 18 according to the present invention each having 1 to 4 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups as the polymeric part of Z 1 There was no difference in in vitro activity according to the number of 2- (2- (2-aminoethoxy) ethoxy) acetoyl groups, and both GLP-1 and glucagon receptor activities were excellent.
또한, Z2로서 친유성 리피드 부분 말단에 카르복실산을 가진 아실화된 비교예 화합물 42, 화합물 43, 화합물 44는 리피드 탄소 길이에 상관없이 친유성 리피드 부분 말단이 탄화수소인 본 발명에 의한 화합물 3과 같은 아실화된 화합물에 비해 GLP-1 및 글루카곤 수용체에 대한 낮은 활성을 보였다. 그리고, Z2로서 친유성 리피드 부분 말단에 카르복실산과 Gly, Val로 결합된 구조를 가진 비교예 화합물 45, 화합물 46은 친유성 리피드 부분 말단이 탄화수소인 본 발명에 의한 화합물 3과 같은 화합물에 비해 GLP-1 및 글루카곤 수용체에 대한 낮은 활성을 보여, Z2로서 친유성 리피드 부분 말단에 극성 치환기를 가지는 아실화 화합물들은 낮은 in vitro 활성을 나타냄을 알 수 있다.Further, the acylated Comparative Compounds 42, 43, and 44 having a carboxylic acid at the lipophilic lipid moiety end as Z 2 are the compounds 3 according to the present invention in which lipophilic lipid moiety ends are hydrocarbons, regardless of the lipid carbon length Lt; RTI ID = 0.0 &gt; GLP-1 &lt; / RTI &gt; and glucagon receptors. Compounds 45 and 46 having a structure in which carboxylic acid and Gly and Val are bonded to the lipophilic lipid moiety at the terminal of Z 2 as compared with the compound of the present invention such as compound 3 of the present invention wherein the lipophilic lipid moiety end is a hydrocarbon GLP-1 and glucagon receptors. It can be seen that the acylated compounds having a polar substituent at the lipophilic lipid moiety end as Z 2 show low in vitro activity.
또한, 비아실화 옥신토모듈린 cyclic 펩타이드 유사체로서 비교예 화합물 47은 분자내 같은 형식의 락탐링 구조를 갖는 아실화된 본 발명에 의한 화합물 14에 비해 글루카곤 수용체에 대한 낮은 활성을 보여, 옥신토모듈린 펩타이드 유사체의 아실화는 활성 증가를 유도함을 알 수 있다.In addition, as the nonacylated oxytomulin cyclic peptide analog, Comparative Example Compound 47 showed lower activity on the glucagon receptor than Compound 14 according to the present invention, which has the same type of lactam ring structure in the molecule, Acylation of the lean peptide analogue leads to increased activity.
또한, 본 발명에 의한 아실화 옥신토모듈린 cyclic 펩타이드 유사체 중 di-sulfide로 분자내 결합을 가진 화합물 28은 다른 아실화 옥신토모듈린 cyclic 펩타이드 유사체 화합물 22에 비해 GLP-1 및 글루카곤 수용체에 대한 낮은 활성을 보여, 아실화 옥신토모듈린 cyclic 펩타이드 유사체의 분자내 고리 크기가 활성에 영향이 있음을 알 수 있다. In addition, among the acylated oxytomrannic cyclic peptide analogues according to the present invention, the compound 28 having an intramolecular bond with di-sulfide has a higher affinity for GLP-1 and a glucagon receptor than the other acylated auxin tomodulin cyclic peptide analog 22 The activity was low, indicating that the intramolecular ring size of the acylated oxytomodulin cyclic peptide analogue has an effect on activity.
<실험예 2> <Experimental Example 2> 본 발명에 의한 펩타이드의 단회 체중 감소 약효평가Evaluation of a Single Weight Loss Drug Effect of the Peptide According to the Present Invention
본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 평가하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3을 0.01% Tween80이 함유된 증류수에 100 nmol/kg 용량이 되도록 조제 후 마우스에 단 회 피하 주사 하였으며, 이후 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 그 결과를 도 1에 나타내었다.To evaluate the efficacy of acylated oxytomodulin peptide analogues according to the present invention, a diet containing high fat was fed to male mice (C57BL / 6 mice) and mice fed with obesity were fed high fat diets Were used to evaluate the body weight before and after the experiment. Compound 3 according to the present invention was prepared so as to have a dose of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then injected into mice in a single subcutaneous injection. Thereafter, body weight and feed intake were measured once a day, Respectively.
실험 결과, 용매만 주사한 대조군에 비해 누적 사료 섭취량의 유의미한 차이가 없음에도 대조군의 체중감소율 대비 화합물 3 주사 후 체중 감소가 관찰되었고 그 효과가 4일간 지속됨을 알 수 있다. 따라서 생체 내에서 불안정하여 매우 짧은 반감기를 나타내 체중 감소 약효평가를 위해서는 1일 1회 이상의 투여가 필요한 옥신토모듈린 대비 본 발명의 아실화 옥신토모듈린 펩타이드 유사체는 화학적 안정성 개선으로 인해 단 회 투여만으로도 체중감소에 대한 약효가 일정 기간 유지될 수 있음을 알 수 있다.Experimental results showed that although the cumulative feed intake was not significantly different from the control group injected with only the solvent, weight loss was observed after 3 injections of the compound compared to the control group, and the effect lasted for 4 days. Therefore, the acylated oxytomodulin peptide analog of the present invention, compared with oxytomodulin, which is unstable in vivo and exhibits a very short half-life and needs to be administered at least once a day in order to evaluate the weight loss efficacy, The effect on weight loss can be maintained for a certain period of time.
<실험예 3> <Experimental Example 3> 본 발명에 의한 펩타이드의 1주 반복 체중 감소 약효평가Assessment of Weight Loss Reduction Effect of Peptide according to the Present Invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 시판중인 당뇨병/비만 치료제와 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명의 실시예 중 화합물 3은 0.01% Tween80이 함유된 증류수에 100 nmol/kg 또는 300 nmol/kg 용량이 되도록 조제 하였고, 대조물질로서 당뇨병/비만 치료제로 시판중인 Liraglutide를 동일한 용매에 100 nmol/kg 용량이 되도록 조제 후 표 6에 기재된 것과 같이 1일 1회 총 6일 동안 피하 주사 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 Liraglutide 대비 아실화 옥신토모듈린 유사체의 체중 감소 약효를 비교하였고, 7일째부터 투여를 중단하고 체중의 회복을 확인하여 그 결과를 도 2a 및 도 2b에 나타내었다.In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the therapeutic effect of diabetes / obesity on the market, a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before exercise. In the examples of the present invention, Compound 3 was prepared to have a concentration of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide, a commercially available diabetic / kg, and then subcutaneously injected once a day for a total of 6 days as shown in Table 6. The body weight and feed intake were measured once a day at a constant time to compare the efficacy of the acylated oxytomodulin analogues with respect to liraglutide. From the seventh day, the administration was stopped and the recovery of body weight was confirmed. 2b.
Figure PCTKR2018009425-appb-T000006
Figure PCTKR2018009425-appb-T000006
실험 결과, 본 발명에 의한 화합물 3과 Liraglutide를 동일 용량(100 nmol/kg)으로 주사한 군의 누적 사료 섭취량에 유의미한 차이가 없음에도 Liraglutide의 경우 약 12.2%의 체중이 감소하였고, 화합물 3의 경우 약 24.6%의 체중이 감소하였다. 또한, 화합물 3의 용량을 300 nmol/kg 로 주사한 경우, 체중이 약 37.8% 감소한 것을 알 수 있는바, 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 Liraglutide보다 2배 이상 우수한 용량의존적인 체중 감소 효과가 있었으며, 투여 중단 후에도 vehicle 대조군 대비 낮은 체중을 유지하였다.As a result of the experiment, although the cumulative feed intake of the compound of the present invention (100 nmol / kg) was not significantly different from that of the compound 3 and Liraglutide, the weight of Liraglutide decreased by about 12.2% About 24.6% of body weight was decreased. In addition, when the dose of Compound 3 was 300 nmol / kg, it was found that the body weight was reduced by about 37.8%. Thus, the acylated auxin tomodulin peptide analogue of the present invention was twice as excellent as Liraglutide And had a lower body weight than the vehicle control group after discontinuation of the treatment.
<실험예 4> <Experimental Example 4> 본 발명에 의한 펩타이드의 5일 반복 체중 감소 약효평가Evaluation of 5-day repeated weight loss effect of peptides according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 최대 체중 감소 효과를 확인하기 위해 웅성 실험용 생쥐(Wistar rat)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명의 실시예 중 화합물 3은 0.01% Tween80이 함유된 증류수에 100 nmol/kg 또는 300 nmol/kg 용량이 되도록 조제 후 표 7에 기재된 것과 같이 1일 1회 총 4일 동안 피하 주사 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 초기 체중 대비 경시적인 체중 감소 약효를 확인하였고, 5일째부터 투여를 중단하고 체중의 회복을 확인하여 그 결과를 도 3a 및 도 3b에 나타내었다.In order to confirm the maximum weight loss effect of acylated auxin tomodulin peptide analogues according to the present invention, a diet containing high fat was fed to a male mice (Wistar rats) fed with high fat diet, The mice were divided into groups according to body weight before the experiment and evaluated. Compound 3 in the examples of the present invention was subcutaneously injected into distilled water containing 0.01% Tween 80 at a dose of 100 nmol / kg or 300 nmol / kg for 4 days, as shown in Table 7, once a day for a total of 4 days. The body weight and feed intake were measured once a day at a constant time to confirm the effect of weight loss over time on the initial body weight. The administration was stopped from the fifth day and the recovery of body weight was confirmed, and the results are shown in FIGS. 3A and 3B.
Figure PCTKR2018009425-appb-T000007
Figure PCTKR2018009425-appb-T000007
실험 결과, vehicle 대조군 대비 화합물 3을 주사한 군의 누적 사료 섭취량에 유의적인 차이를 보였고, 두 용량 모두 약 12.5% 수준의 체중 감소 약효가 관찰되었으며, 투여 중단 후에도 vehicle 대조군 대비 낮은 체중을 유지하였다. The experimental results showed that the cumulative feed intake of group 3 injected with vehicle 3 was significantly different from that of the vehicle control group, and the weight loss effect was observed at about 12.5% in both doses.
<실험예 5> <Experimental Example 5> 본 발명에 의한 펩타이드의 10일 반복 체중 감소 약효평가Evaluation of the 10-day repeated weight loss effect of the peptide according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 시판중인 당뇨병 치료제와 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명의 실시예 중 화합물 3은 0.01% Tween80이 함유된 증류수에 100 nmol/kg 또는 300 nmol/kg 용량이 되도록 조제 하였고, 당뇨병 치료제로 시판중인 Semaglutide를 동일한 용매에 100 nmol/kg 용량이 되도록 조제 후 표 8에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 10일 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 Semaglutide 대비 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 비교하여 그 결과를 도 4a 및 도 4b에 나타내었다.In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with the commercially available diabetes therapeutic agent, a diet containing high fat was fed to male mice (C57BL / 6 mouse) Were used to evaluate obesity-induced rats. In the examples of the present invention, Compound 3 was prepared so as to have a dose of 100 nmol / kg or 300 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, a commercially available drug for diabetes, was added to the same solvent to prepare 100 nmol / And subcutaneously injected once every 3 days as described in Table 8 and evaluated for a total of 10 days. The body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of acylated oxytomodulin peptide analogues to semaglutide, and the results are shown in FIGS. 4A and 4B.
Figure PCTKR2018009425-appb-T000008
Figure PCTKR2018009425-appb-T000008
실험 결과, 동일 용량(100 nmol/kg)에서 화합물 3은 Semaglutide 보다 더 많은 누적 사료 섭취량이 측정되었음에도 체중 감소 약효는 Semaglutide 대비 우수하였다 (화합물 3: 13.9%, Semaglutide: 9.7%). 또한, 화합물 3의 용량을 300 nmol/kg 로 주사한 경우, 체중이 약 16.9% 감소한 것을 알 수 있는바, 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 Semaglutide 대비 우수한 용량의존적인 체중 감소 약효가 관찰되었다. As a result of the experiment, compound 3 was found to have higher cumulative feed intake than semaglutide at the same dose (100 nmol / kg), but the weight loss effect was superior to semaglutide (compound 3: 13.9%, semaglutide: 9.7%). In addition, when the dose of Compound 3 was 300 nmol / kg, it was found that the body weight was reduced by about 16.9%. Thus, the acylated oxytomulin peptide analogue according to the present invention exhibited excellent dose- Was observed.
<실험예 6> <Experimental Example 6> 본 발명에 의한 펩타이드의 10일 반복 체중 감소 약효평가Evaluation of the 10-day repeated weight loss effect of the peptide according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체들의 구조에 따라 펩타이드 내에 중합체 개수 차이 또는 cyclic 펩타이드 형성에 따른 체중 감소 약효를 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3, 10 및 14를 0.01% Tween80이 함유된 증류수에 100 nmol/kg 용량이 되도록 조제 후 표 9에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 10일 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 화합물 3 대비 화합물 10과 화합물 14의 체중 감소 약효를 비교하여 그 결과를 도 5a 및 도 5b에 나타내었다.In order to compare the effect of the acylated oxytomulin peptide analogues according to the present invention on the number of polymers in the peptide or the effect of weight reduction due to the formation of cyclic peptides, the experiment was conducted in a male experimental animal (C57BL / 6 mouse) The rats were divided into two groups according to body weight before the experiment. Compounds 3, 10 and 14 according to the present invention were prepared in distilled water containing 0.01% Tween 80 at a dose of 100 nmol / kg, and subcutaneously injected at intervals of 3 days as shown in Table 9 and evaluated for a total of 10 days. The body weight and feed intake were measured once a day at a constant time to compare the weight loss effect of Compound 10 with Compound 14 versus Compound 3, and the results are shown in FIGS. 5A and 5B.
Figure PCTKR2018009425-appb-T000009
Figure PCTKR2018009425-appb-T000009
실험 결과, 동일 용량에서 vehicle 대조군 대비 화합물 10과 화합물 14에 의한 누적 사료 섭취량은 각각 20%와 27%의 유의적인 감소가 관찰되었고 화합물 3에 의한 누적 사료 섭취량은 vehicle 대조군 대비 약 17% 감소 수준으로 산출되었다. 체중 감소 측면에서는 세 화합물 모두 초기 체중 대비 약 19~22% 수준의 우수한 약효가 관찰되었고, cyclic 펩타이드 화합물 14는 화합물 3 및 화합물 10 대비 다소 우수한 경향을 보였다. The experimental results showed that the cumulative feed intake by compound 10 and compound 14 was significantly reduced by 20% and 27%, respectively, compared to vehicle control, and the cumulative feed intake by compound 3 was about 17% lower than vehicle control Respectively. In terms of weight loss, all of the three compounds showed excellent drug efficacy of about 19 to 22% as compared with the initial weight, and the cyclic peptide compound 14 showed a somewhat superior tendency to the compound 3 and compound 10.
<실험예 7> <Experimental Example 7> 본 발명에 의한 펩타이드의 1주 반복 체중 감소 약효평가Assessment of Weight Loss Reduction Effect of Peptide according to the Present Invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체들의 구조에 따라 펩타이드 내에 친유성리피드 부분 또는 중합체 개수 차이에 따른 체중 감소 약효를 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3, 화합물 13 및 화합물 18은 0.01% Tween80이 함유된 증류수에 100 nmol/kg 용량이 되도록 조제 후 표 10에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 7일 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 화합물 3 대비 화합물 13과 화합물 18의 체중 감소 약효를 비교하여 그 결과를 도 6a 및 도 6b에 나타내었다.In order to compare the effects of lipophilic lipid moieties or polymers on the weight loss effect of peptides according to the structure of the acylated oxytomodulin peptide analogues according to the present invention, high fat was added to male mice (C57BL / 6 mice) Were fed diets containing high density lipoprotein (LDH) and high density lipoprotein (LDH). Compound 3, Compound 13 and Compound 18 according to the present invention were prepared so as to have a dose of 100 nmol / kg in distilled water containing 0.01% Tween 80, subcutaneously injected once every three days as shown in Table 10, and evaluated for a total of 7 days Respectively. The body weight and feed intake were measured once a day at a constant time to compare the weight loss effect of Compound 13 with Compound 13 versus Compound 3, and the results are shown in FIGS. 6A and 6B.
Figure PCTKR2018009425-appb-T000010
Figure PCTKR2018009425-appb-T000010
실험 결과, 동일 용량에서 화합물 18은 화합물 3과 유사한 우수한 체중 감소 약효가 확인된 반면, 화합물 13은 체중에 대한 유의미한 약효는 없었다. 화합물 13 은 화합물 3 대비 약 10배 이상 둔감한 in vitro 약효를 나타냈으며, 이는 동물실험으로 이어져 친유성리프드 부분 말단 구조에 따른 체중 감소 약효 소실을 확인함으로써 구조적인 중요성을 확인할 수 있었다. As a result of the experiment, Compound 18 showed an excellent weight loss effect similar to Compound 3 at the same dose, while Compound 13 had no significant effect on body weight. Compound 13 showed about 10 times more insensitivity to Compound 3 than in Compound 3, and its structural importance was confirmed by confirming the disappearance of the weight loss effect according to the end structure of the dianionic group in an animal experiment.
<실험예 8> <Experimental Example 8> 본 발명에 의한 펩타이드의 2주 반복 체중 감소 약효평가Evaluation of the effect of the peptide of the present invention for two weeks of repeated weight loss
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체들 중 cyclic 펩타이드 구조에 따른 체중 감소 약효를 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3, 화합물 21 ~ 25를 0.01% Tween80이 함유된 증류수에 100 nmol/kg 용량이 되도록 조제 후 표 11에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 2주 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 화합물 3 대비 화합물 21 ~ 25의 체중 감소 약효를 비교하여 그 결과를 도 7a 내지 도 7d에 나타내었다.In order to compare the effects of cyclic peptide structure on acylated oxytomodulin peptide analogues according to the present invention, a diet containing high fat was fed to male mice (C57BL / 6 mice) Obesity - induced rats were divided into groups according to body weight before the experiment. Compounds 3 and 21 to 25 according to the present invention were prepared so as to have a volume of 100 nmol / kg in distilled water containing 0.01% Tween 80, and then subcutaneously injected at intervals of 3 days as shown in Table 11 and evaluated for a total of 2 weeks . The body weight and feed intake were measured once a day at a constant time to compare the effects of the compounds 21 to 25 on weight loss, and the results are shown in FIGS. 7a to 7d.
Figure PCTKR2018009425-appb-T000011
Figure PCTKR2018009425-appb-T000011
실험 결과, 동일 용량에서 화합물 3 대비 화합물 23과 화합물 25는 더 많은 누적사료 섭취량이 산출되었고, 화합물 21과 화합물 22는 화합물 3과 유사한 수준의 누적 사료 섭취량를 나타냈다. 체중 측면에서는 화합물 3이 화합물 21, 화합물23 및 화합물 25 대비 동등 수준 이상의 체중 감소가 관찰되었고, 화합물 25는 화합물 3 대비 우수한 체중 감소 약효가 확인되었다. 반면 in vitro assay에서 함께 평가된 다른 화합물들 대비 글루카곤 수용체 활성능이 다소 약했던 화합물 24는 초기체중 대비 약 13.4% 수준의 유의적인 체중 감소 약효를 보여, 화합물 3 대비 열등한 체중 감소 약효를 나타냈다. 화합물 25는 화합물 3 대비 유사한 체중 감소 약효를 보였으나, 누적 사료 섭취량이 더 적었다. 반면, 화합물 22는 화합물 3 대비 유사한 체중 감소 약효를 보였으나, 누적 사료 섭취량은 유사하였다. 아실화 옥신토모듈린 cyclic 펩타이드 유사체들은 구조에 따라 체중 감소 약효 패턴의 차이를 보였다. As a result of the experiment, Compound 23 and Compound 25 compared to Compound 3 at the same dose yielded more cumulative feed intake, and Compound 21 and Compound 22 showed similar cumulative feed intakes to Compound 3. In terms of weight, compound 3 showed a weight loss equal to or higher than that of compound 21, compound 23 and compound 25, and compound 25 showed an excellent weight loss effect compared to compound 3. Compared with other compounds evaluated in the in vitro assay, compound 24, which had slightly lower glucagon receptor activity, showed significant weight loss effect of about 13.4% compared to the initial weight, and showed an inferior weight loss effect compared to compound 3. Compound 25 showed similar weight loss efficacy compared to Compound 3, but the cumulative feed intake was less. On the other hand, Compound 22 showed similar weight loss effect compared to Compound 3, but cumulative feed intake was similar. The acylated oxytomodulin cyclic peptide analogs showed different weight loss effect patterns depending on the structure.
<실험예 9> <Experimental Example 9> 본 발명에 의한 펩타이드의 2주 반복 체중 감소 약효평가Evaluation of the effect of the peptide of the present invention for two weeks of repeated weight loss
본 실험은 <실험예 8>에 이어 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체들의 저용량에서의 체중 감소 약효를 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3 및 화합물 22를 0.01% Tween80이 함유된 증류수에 30 nmol/kg 또는 100 nmol/kg 용량이 되도록 조제 후 표 12에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 2주 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 화합물 3과 화합물 22의 체중 감소 약효를 비교하여 그 결과를 도 8a 및 도 8b에 나타내었다.In order to compare the efficacy of the acylated oxytomodulin peptide analogues according to the present invention at low doses, the mice were fed a high-fat diet (C57BL / 6 mouse) The rats were divided into groups according to body weight before the experiment. Compound 3 and Compound 22 according to the present invention were prepared in distilled water containing 0.01% Tween 80 so as to have a volume of 30 nmol / kg or 100 nmol / kg, and subcutaneously injected at intervals of 3 days as shown in Table 12, Lt; / RTI &gt; The body weight and feed intake were measured once a day at a constant time to compare the weight loss effect of Compound 3 with Compound 22, and the results are shown in FIGS. 8A and 8B.
Figure PCTKR2018009425-appb-T000012
Figure PCTKR2018009425-appb-T000012
실험 결과, 동일용량에서 화합물 22는 화합물 3 대비 더 많은 누적 사료 섭취량이 측정되었고, 화합물 22의 10 nmol/kg 용량군에서는 vehicle 대조군 수준의 사료섭취량을 보였음에도 7.5% 수준의 체중 감소 약효가 관찰되었다. 또한 화합물 22의 30 nmol/kg 용량군에서는 화합물 3 동일용량군과 비교 시 더 많은 사료를 섭취했음에도 체중 감소 약효는 유사수준이었다. 이는 화합물 22가 화합물 3 대비 글루카곤 수용체 활성화능에 기인한 약효에 영향을 더 받음을 알 수 있다.As a result, the compound 22 showed a higher cumulative feed intake than the compound 3 at the same dose, while the 10 nmol / kg dose of the compound 22 showed a feed intake of the vehicle control level, but a 7.5% weight loss effect was observed . In addition, in the 30 nmol / kg dose group of Compound 22, the weight loss efficacy was similar to that of the same dose group of Compound 3 even though the feeds were higher. This shows that Compound 22 is more influenced by the drug efficacy due to the glucagon receptor activating ability as compared to Compound 3.
<실험예 10> <Experimental Example 10> 본 발명에 의한 펩타이드의 5일 반복 체중 감소 약효평가Evaluation of 5-day repeated weight loss effect of peptides according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 시판중인 당뇨병/비만 치료제 및 옥신토모듈린 펩타이드 유사체로 개발중인 선도물질과 비교하기 위해 웅성 실험용 생쥐(C57BL/6 mouse)에 고지방을 함유하고 있는 식이를 공급하였고, 고지방 식이에 의해 비만이 유도된 쥐들을 이용하여 실험 전 체중에 따라 군분리 후 평가하였다. 본 발명의 실시예 중 화합물 3은 0.01% Tween80이 함유된 증류수에 30 nmol/kg 용량이 되도록 조제 하였고, 비교예로 당뇨병/비만 치료제로 시판중인 Liraglutide 및 임상시험 중인 MEDI0382를 동일한 용매에 30 nmol/kg 용량이 되도록 조제 후 표 13에 기재된 것과 같이 1일 1회 총 4일 동안 피하 주사 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하여 Liraglutide 및 MEDI0382 대비 유사체의 체중 감소 약효를 비교하여 그 결과를 도 9a 및 도 9b에 나타내었다.In order to compare the effect of the acylated oxytomodulin peptide analogue according to the present invention with that of the commercially available diabetic / obesity therapeutic agent and auxin tomodulin peptide analogue, male mice (C57BL / 6 mouse ) Were fed diets containing high fat, and obesity - induced rats were fed with high fat diets. Compound 3 was prepared in a concentration of 30 nmol / kg in distilled water containing 0.01% Tween 80, and Liraglutide (commercially available as a therapeutic agent for diabetes / obesity) and MEDI0382 (as a comparative example) were dissolved in the same solvent at 30 nmol / kg, and then subcutaneously injected once a day for a total of 4 days as shown in Table 13. The body weight and feed intake were measured once a day at a constant time to compare the weight loss efficacy of analogues to Liraglutide and MEDI0382, and the results are shown in FIGS. 9A and 9B.
Figure PCTKR2018009425-appb-T000013
Figure PCTKR2018009425-appb-T000013
실험 결과, 동일 용량에서 평가된 세 물질 중 화합물 3 투여군에서 초기 체중 대비 가장 우수한 체중 감소 약효가 관찰되었다 (화합물 3: 18.6%, Liraglutide: 12.7%, MEDI0382: 8.0%).Among the three substances evaluated at the same dose, the compound 3 administration group showed the best weight loss effect (Compound 3: 18.6%, Liraglutide: 12.7%, MEDI0382: 8.0%).
<실험예 11> &Lt; Experimental Example 11 & 본 발명에 의한 펩타이드의 4주 반복 체중 감소 약효평가Evaluation of the effect of 4 weeks repeated weight reduction of the peptide according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 체중 감소 약효를 시판중인 당뇨병 치료제와 비교하기 위해 웅성 비만 및 당뇨병 실험용 생쥐(FATZO mouse)에 고지방을 함유하고 있는 식이를 공급하고, 실험 전 체중, 체지방, 비절식 혈당 및 당화혈색소(HbA1c)에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3과 화합물 22는 0.01% Tween80이 함유된 증류수에 30 nmol/kg 또는 100 nmol/kg 용량이 되도록 조제 하였고, 당뇨병 치료제로 시판중인 Semaglutide를 동일한 용매에 100 nmol/kg 용량이 되도록 조제 후 표 14에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 4주 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하였고, 부검 전 4주차에 체지방을 측정하여 Semaglutide 대비 본 발명에 의한 옥신토모듈린 펩타이드 유사체의 체중 및 체지방 감소 약효를 비교하여 그 결과를 도 10a 내지 도 10c에 나타내었다.In order to compare the efficacy of the acylated oxytomodulin peptide analogues according to the present invention with those of commercially available diabetes mellitus, a diet containing high fat was fed to male obese and diabetic mice (FATZO mice) Total body weight, body fat, non - fasting blood sugar and HbA1c were evaluated after group separation. Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every three days as described in Table 14 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at a constant time, body fat was measured at 4 weeks before the autopsy, and the body weight and the body fat reducing effect of the oxytocmodulin peptide analogue of the present invention were compared to that of semaglutide. 10C.
Figure PCTKR2018009425-appb-T000014
Figure PCTKR2018009425-appb-T000014
실험 결과, 동일 용량(100 nmol/kg) 뿐 아니라 낮은 30 nmol/kg 용량에서 본 발명에 의한 화합물 3 및 화합물 22는 Semaglutide 보다 더 많은 누적 사료 섭취량이 측정되었음에도 체중 감소 약효는 매우 우수함을 알 수 있는데, 이는 본 발명에 의한 옥신토모듈린 펩타이드 유사체가 GLP-1 수용체 agonist인 Semaglutide와 달리 GLP-1과 글루카곤 수용체 모두에 작용을 하는 기전을 갖고 있기 때문임을 알 수 있다. As a result of the experiment, Compound 3 and Compound 22 according to the present invention at a low dose of 30 nmol / kg as well as the same dose (100 nmol / kg) show that the cumulative feed intake is higher than that of semaglutide, , Indicating that the oxytocmodulin peptide analog according to the present invention has a mechanism of acting on both GLP-1 and glucagon receptors, unlike Semaglutide, which is a GLP-1 receptor agonist.
<실험예 12> <Experimental Example 12> 본 발명에 의한 펩타이드의 마우스에서 내당력 개선 효과 검정The effect of the peptide according to the present invention on the potency of the mouse
본 실험은 웅성 실험용 생쥐(C57BL/6 mouse)에 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 내당력 개선효과를 식후 혈당 조절능 개선효과의 의미로서 평가하였다. 실험용 생쥐를 실험 전일 절식 시킨 후, 본 발명에 의한 화합물 3 또는 화합물 22 또는 화합물 25를 0.01% Tween80을 함유하는 증류수에 조제하여 포도당 투여 30분 전에 피하 주사 하였다. 옥신토모듈린 펩타이드 유사체 주사 30분 후에 포도당 용액을 경구 투여 하였고, 약물 주사 및 포도당 용액 투여 직전, 포도당 용액 투여 후 2시간 동안 지정된 시간에 미정맥을 통해 전혈의 혈당을 측정하였다. 그 결과는 경시적인 혈당곡선의 곡선하면적(Area under the curve; AUC)을 산출하여 대조군의 혈당 AUC 대비 유사체 및 비교물질의 혈당 AUC를 백분율로 산출하여 내당력 개선 약효를 평가하였다. 화합물별 각각 별도의 실험으로 진행하였고 화합물 22 또는 화합물 25를 평가 시에는 화합물 3의 30 nmol/kg 용량을 비교예로 추가하여 합산된 결과를 도 11에 나타내었다.This experiment evaluated the effect of the acylated auxin tomodulin peptide analogue according to the present invention on the glucose tolerance improving effect of the male mice (C57BL / 6 mouse) as a means of improving postprandial blood glucose controlling ability. The experimental mice were fasted overnight, and Compound 3, Compound 22 or Compound 25 according to the present invention was prepared in distilled water containing 0.01% Tween 80 and subcutaneously injected 30 minutes before glucose administration. The glucose solution was orally administered 30 minutes after the oxhistone modulin peptide analogue injection, and the whole blood was measured through the vein at the designated time immediately before the drug injection and the glucose solution administration and for 2 hours after the glucose solution administration. As a result, the area under the curve (AUC) of the blood glucose curve over time was calculated, and the blood glucose AUC of the control group and the comparative substance was calculated as a percentage of the control group. Each of the compounds was subjected to separate experiments. In the evaluation of Compound 22 or Compound 25, 30 nmol / kg of Compound 3 was added as a comparative example, and the results are shown in FIG.
실험결과, 펩타이드 유사체들은 30 nmol/kg 용량 이상에서 유의적이고 용량 의존적인 혈당 AUC 감소를 나타냈으며, 특히 화합물 25는 평가된 모든 용량 군에서 유의적인 내당력 개선 약효 및 화합물 3과 화합물 22 대비 3배 이상 우수한 내당력 약효가 관찰되었다. As a result, the peptide analogs showed a significant and dose-dependent decrease in blood glucose AUC at a dose of 30 nmol / kg or more. Particularly, Compound 25 showed significant potency resistance improvement effects in all evaluated dose groups and 3 times The excellent antitumor effect was observed.
<실험예 13> <Experimental Example 13> 본 발명에 의한 펩타이드의 6주 반복 혈당조절 약효평가Evaluation of the 6-week repetitive blood glucose control effect of the peptide according to the present invention
본 실험은 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 혈당 조절 약효를 시판중인 당뇨병 치료제와 비교하기 위해 웅성 당뇨병 실험용 생쥐(db/db mouse)를 실험 전 비절식 혈당, 당화혈색소 및 체중에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3은 0.01% Tween80이 함유된 증류수에 100 nmol/kg 용량이 되도록 조제 하였고, 당뇨병 치료제로 시판중인 Semaglutide를 동일한 용매에 100 nmol/kg 용량이 되도록 조제 후 표 15에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 6주 동안 평가 하였다. 주 1회 약물 투여 24시간 후 비절식 혈당, 체중 및 사료섭취량을 측정하였고 3주, 5주 및 6주에는 당화혈색소를 측정하여 Semaglutide 대비 본 발명에 의한 옥신토모듈린 펩타이드 유사체의 혈당 조절 약효를 비교하여 그 결과를 도 12a 및 도 12b에 나타내었다.In order to compare the efficacy of acylated oxytomodulin peptide analogues according to the present invention with those of commercially available diabetes mellitus, male mice (db / db mouse) were divided into two groups according to the pre-experiment blood glucose, glycated hemoglobin and body weight The groups were separated and evaluated. Compound 3 according to the present invention was prepared so as to have a concentration of 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was prepared in the same solvent so as to have a 100 nmol / kg capacity. The mice were subcutaneously injected once every 3 days and evaluated for a total of 6 weeks. After 24 hours of drug administration once a week, non-fasting blood glucose, body weight and feed intake were measured, and at 3 weeks, 5 weeks and 6 weeks, hemoglobin was measured to determine the effect of the oxytocmodulin peptide analogue of the present invention against semaglutide The results are shown in Figs. 12A and 12B.
Figure PCTKR2018009425-appb-T000015
Figure PCTKR2018009425-appb-T000015
실험 결과, 동일 용량(100 nmol/kg)에서 본 발명에 의한 화합물 3은 평가 초기 Semaglutide 대비 동등이하의 약효를 나타냈으나, 장기간 투여에 의해 Semaglutide 대비 우수하 혈당 조절 약효를 나타냈다. Vehicle 대조군의 최종 비절식 혈당은 581 mg/dL로 매우 심한 중증당뇨 특성을 보인 반면, 대조물질 Semaglutide의 최종 비절식 혈당은 342 mg/dL였고, 화합물 3의 최종 비절식 혈당은 274 mg/dL로 유의적인 혈당 상승 억제가 관찰되었다. 당화혈색소 역시 Vehicle 대조군의 경우 초기 수치 대비 최종 수치가 5.15%Point 증가하였으나, Semaglutide 투여 군에서는 2.65%Point, 화합물 3 투여군에서는 1.73%Point만 증가하여 약물에 의한 당화혈색소 상승 억제 약효가 확인되었다. 따라서 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체는 Semaglutide 대비 당뇨발병지연에 대한 우수한 약효가 관찰되었다. As a result, Compound 3 according to the present invention exhibited the same or lower efficacy than Semaglutide at the same dose (100 nmol / kg). The final non-fasting blood glucose level of the control group was 581 mg / dL, while the final non-fasting blood glucose level of the control substance, Semaglutide, was 342 mg / dL, and the final unfasted blood glucose level of Compound 3 was 274 mg / Significant inhibition of blood glucose elevation was observed. In the case of vehicle control group, the final value of vehicle glycated hemoglobin increased by 5.15% point compared with the initial value, but increased by 2.65% point in the semaglutide administration group and 1.73% point in the compound 3 administration group. Thus, acylated oxytomodulin peptide analogs according to the present invention have excellent anticancer effects on the delayed onset of diabetes compared to semaglutide.
<실험예 14> <Experimental Example 14> 본 발명에 의한 펩타이드의 4주 반복 혈당조절 약효평가Evaluation of the effect of the peptide according to the present invention on the 4-week repeatedly regulated blood glucose
본 실험은 <실험예 11>과 동일한 실험으로 본 발명에 의한 아실화 옥신토모듈린 펩타이드 유사체의 혈당조절 약효를 시판중인 당뇨병 치료제와 비교하기 위해 웅성 비만 및 당뇨병 실험용 생쥐(FATZO mouse)에 고지방을 함유하고 있는 식이를 공급하고, 실험 전 체중, 체지방, 비절식 혈당 및 당화혈색소(HbA1c)에 따라 군분리 후 평가하였다. 본 발명에 의한 화합물 3과 화합물 22는 0.01% Tween80이 함유된 증류수에 30 nmol/kg 또는 100 nmol/kg 용량이 되도록 조제 하였고, 당뇨병 치료제로 시판중인 Semaglutide를 동일한 용매에 100 nmol/kg 용량이 되도록 조제 후 표 16에 기재된 것과 같이 3일 1회 간격으로 피하 주사하며 총 4주 동안 평가 하였다. 매일 1회 일정한 시간에 체중 및 사료섭취량을 측정하였고, 약 10일 간격으로 투여 24시간 후 비절식 혈당을 측정하였다. 또한 부검 전 4주차에 당화혈색소를 측정하여 Semaglutide 대비 본 발명에 의한 옥신토모듈린 펩타이드 유사체의 혈당조절 약효를 비교하여 그 결과를 도 13a 및 도 13b에 나타내었다.This experiment was conducted in the same manner as in Experimental Example 11 to compare the effect of the acylated oxytomodulin peptide analogue of the present invention with the therapeutic effect of diabetes mellitus on the market. (HbA1c) and body weight, body fat, non - fasting blood sugar and HbA1c. Compounds 3 and 22 according to the present invention were prepared so as to have a concentration of 30 nmol / kg or 100 nmol / kg in distilled water containing 0.01% Tween 80, and semaglutide, which is commercially available as a therapeutic agent for diabetes, was added to the same solvent at a concentration of 100 nmol / kg After formulation, they were subcutaneously injected once every 3 days as shown in Table 16 and evaluated for a total of 4 weeks. Body weight and feed intake were measured once a day at constant time, and non - fasting blood glucose was measured 24 hours after administration at intervals of about 10 days. In addition, the HbA1c was measured at 4th week before the autopsy, and the effect of the oxynitomulin peptide analogue according to the present invention on the blood glucose control was compared with that of semaglutide. The results are shown in FIGS. 13A and 13B.
Figure PCTKR2018009425-appb-T000016
Figure PCTKR2018009425-appb-T000016
실험 결과, 동일 용량(100 nmol/kg)에서 본 발명에 의한 화합물 3 및 화합물 22 투여군에서 Semaglutide와 유사수준의 우수한 혈당조절 약효 및 당화혈색소 상승 억제 약효가 관찰되었다. 이는 본 발명에 의한 옥신토모듈린 펩타이드 유사체가 <실험예 11>에서 보인 체중 감소와 더불어 혈당조절이 동시에 가능한 약효를 갖고 있음을 알 수 있다. As a result of the experiment, it was observed that the compound 3 and compound 22 according to the present invention administered at the same dose (100 nmol / kg) showed an excellent blood glucose control effect and a glycosylated hemoglobin elevation inhibitory effect similar to those of semaglutide. It can be seen that the oxytocmodulin peptide analogue according to the present invention has the effect of controlling the blood glucose as well as the weight reduction shown in the <Experimental Example 11>.

Claims (26)

  1. 하기 화학식 Ⅰ의 아미노산 서열을 포함하는 옥신토모듈린 펩타이드 유사체.Claims 1. An auxin to modulin peptide analog comprising an amino acid sequence of the formula (I)
    <화학식 Ⅰ><Formula I>
    His-X1-Gln-Gly-Thr-Phe-Thr-Ser-X2-X3-X4-X5-X6-X7-X8-X9-Arg-Arg-Ala-X10-Asp-Phe-Val-Gln-Trp-Leu-X11-X12-X13-X14-X15-X16 (SEQ ID NO.49) His-X 1 -Gln-Gly- Thr-Phe-Thr-Ser-X 2 -X 3 -X 4 -X 5 -X 6 -X 7 -X 8 -X 9 -Arg-Arg-Ala-X 10 - Asp-Phe-Val-Gln-Trp-Leu-X 11 -X 12 -X 13 -X 14 -X 15 -X 16 (SEQ ID NO.49)
    상기 식에서,In this formula,
    X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X 1 is Ser or Aib (aminoisobutyric acid);
    X2는 Asp 또는 Z이며;X 2 is Asp or Z;
    X3는 Tyr 또는 Z이며;X 3 is Tyr or Z;
    X4는 Ser 또는 Z이며;X 4 is Ser or Z;
    X5는 Lys 또는 Z이며;X 5 is Lys or Z;
    X6은 Tyr 또는 Z이며;X 6 is Tyr or Z;
    X7은 Leu 또는 Z이며;X 7 is Leu or Z;
    X8은 Asp 또는 Z이며; X 8 is Asp or Z;
    X9는 Ser, Aib(aminoisobutyric acid) 또는 Z이며;X 9 is Ser, Aib (aminoisobutyric acid) or Z;
    X10은 Gln 또는 Z이며;X 10 is Gln or Z;
    X11은 Met 또는 Leu이며;X 11 is Met or Leu;
    X12은 Asn 또는 Arg이며;X 12 is Asn or Arg;
    X13은 Thr 또는 Ala이며;X 13 is Thr or Ala;
    X14은 Lys 또는 Z이며;X 14 is Lys or Z;
    X15는 RNRNNIA(SEQ ID NO.51)이거나 존재하지 않으며;X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
    X16은 X15가 존재할 경우, Z이거나 존재하지 않으며; X &lt; 16 &gt; is Z or absent when X &lt; 15 &gt; is present;
    C-말단 아미노산은 임의로 아미드화될 수 있으며;The C-terminal amino acid may optionally be amidated;
    여기서 X2, X3, X4, X5, X6, X7, X8, X9, X10, X14 또는 X16 중 적어도 하나가 Z이며;Wherein at least one of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 14 or X 16 is Z;
    Z는 작용화된 Lys으로서 그 측쇄에 중합체성 부분과 스페이서의 접합체인 Z1과 친유성 리피드 부분인 Z2가 접합된 형태이며, 여기서 Z1은 아실 작용기를 통하여 Lys 측쇄와 직접적으로 접합되고 Z2는 Z1을 통해 Lys 측쇄에 접합되며, Z1은 하기 구조식 (1) 또는 (2)이며, Z2는 하기 구조식 (3) 또는 (4)이다.Z is a functionalized Lys in which a side chain is a conjugate of a polymeric moiety and a spacer, Z 1, and a lipophilic lipid moiety Z 2 , wherein Z 1 is directly bonded to the Lys side chain through an acyl functional group and Z 2 is joined to the Lys side chain via Z 1, Z 1 is a structural formula (1) or (2), Z 2 is the structural formula (3) or (4).
    (1)
    Figure PCTKR2018009425-appb-I000018
    (One)
    Figure PCTKR2018009425-appb-I000018
    Figure PCTKR2018009425-appb-I000019
    Figure PCTKR2018009425-appb-I000019
    (3)
    Figure PCTKR2018009425-appb-I000020
    (3)
    Figure PCTKR2018009425-appb-I000020
    (4)
    Figure PCTKR2018009425-appb-I000021
    (4)
    Figure PCTKR2018009425-appb-I000021
  2. 제 1 항에 있어서, X1 위치가 Aib인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.The oxime modulin peptide analogue according to claim 1, wherein the X 1 position is Aib.
  3. 제 1 항에 있어서, X11 위치가 Leu, X12 위치가 Arg, X13 위치가 Ala인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.The oxime modulin peptide analogue according to claim 1, wherein the X 11 position is Leu, the X 12 position is Arg, and the X 13 position is Ala.
  4. 제 1 항에 있어서, X10 위치가 Gln 또는 Lys, X11 또는 X12 위치가 각각 Leu, Arg 중에서 선택되는 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체. The oxime modulin peptide analogue according to claim 1, wherein the X 10 position is selected from Gln or Lys, and the X 11 or X 12 position is selected from Leu and Arg.
  5. 제 1 항에 있어서, 상기 스페이서가 L-글루타민산 잔기로서 그 γ-카복실산에는 중합체성 부분이 공유결합되고, α-아미노기에는 친유성 리피드 부분이 공유결합되는 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.The oxime modulin peptide analogue according to claim 1, wherein the spacer is an L-glutamic acid residue, the polymeric moiety is covalently bonded to the? -Carboxylic acid, and the lipophilic lipid moiety is covalently bonded to the? -Amino group.
  6. 제 1 항 에 있어서, 상기 중합체성 부분이 폴리에틸렌 글리콜(PEG), 단량체로서 에틸렌 글리콜, 에탄올아민 및 락틱산을 갖는 공중합체 또는 글라이신 및 세린을 갖는 폴리-아미노산 공중합체인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.The composition of claim 1, wherein the polymeric moiety is a poly (ethylene glycol) (PEG), a copolymer having ethylene glycol, ethanolamine, and lactic acid as monomers, or a polyamino acid copolymer having glycine and serine. Peptide analogs.
  7. 제 1 항에 있어서, 상기 Z가 구조식 (1) 또는 (2)의 Z1을 갖는 옥신토모듈린 펩타이드 유사체. The method of claim 1 wherein the auxin Sat module Lin peptide analog having a Z 1 of the Z has the structural formula (1) or (2).
  8. 제 1 항에 있어서, 상기 친유성 리피드 부분 Z2는 탄소 원자 수가 C14~C20인 포화 탄화수소 쇄를 포함하고, 이 탄화수소 쇄의 말단 탄소가 카복실산 형태, 일차 아미드 형태 또는 임의의 단일 아미노산과 공유결합으로 연결된 카복실산 형태인 옥신토모듈린 펩타이드 유사체.The method of claim 1, wherein the hydrophobic lipid portion Z 2 is a carbon number C 14 ~ C 20 which contains a saturated hydrocarbon chain, and the terminal carbon of the hydrocarbon chain carboxylic acid form, the primary amide form, or any single amino acid Share An oximodomaine peptide analogue in the form of a linked carboxylic acid form.
  9. 제 1 항에 있어서, 상기 Z가 구조식 (3) 또는 (4)의 Z2를 갖는 옥신토모듈린 펩타이드 유사체.2. The oxime-modulin peptide analog of claim 1, wherein Z has Z 2 of formula (3) or (4).
  10. 제 1 항에 있어서, 하기 화학식 Ⅰ-1의 아미노산 서열을 포함하는 옥신토모듈린 펩타이드 유사체.2. The oxime modulin peptide analogue of claim 1, comprising an amino acid sequence of the formula (I-1).
    <화학식 Ⅰ-1>&Lt; Formula (I-1) >
    HX1QGTFTSDX3SKYLDX9RRAX10DFVQWLX11X12X13X14X15X16 (SEQ ID NO.50)HX 1 QGTFTSDX 3 SKYLDX 9 RRAX 10 DFVQWLX 11 X 12 X 13 X 14 X 15 X 16 (SEQ ID NO.50)
    상기 식에서In the above formula
    X1은 Ser 또는 Aib (aminoisobutyric acid)이고;X 1 is Ser or Aib (aminoisobutyric acid);
    X3은 Tyr 또는 Z;X 3 is Tyr or Z;
    X9은 Ser, Aib 또는 Z;X 9 is Ser, Aib or Z;
    X10은 Gln 또는 Z이며;X 10 is Gln or Z;
    X11는 Met 또는 Leu;X 11 is Met or Leu;
    X12는 Asn 또는 Arg;X 12 is Asn or Arg;
    X13는 Thr 또는 Ala;X 13 is Thr or Ala;
    X14은 Lys 또는 Z;X 14 is Lys or Z;
    X15은 RNRNNIA(SEQ ID NO. 51)이거나 존재하지 않으며;X 15 is RNRNNIA (SEQ ID NO: 51) or absent;
    X16은 X15이 존재할 경우, Z이거나 존재하지 않으며, C-terminal 은 아미드화 될 수 있고,X 16 is Z or absent when X 15 is present, the C-terminal can be amidated,
    Z은 상기 화학식 Ⅰ에서 정의한 바와 같다.Z is as defined in the above formula (I).
  11. 제 10 항에 있어서, 상기 펩타이드 유사체는 화합물 1(SEQ ID NO. 2), 화합물 2(SEQ ID NO. 3), 화합물 3(SEQ ID NO. 4), 화합물 4(SEQ ID NO. 5), 화합물 5(SEQ ID NO. 6), 화합물 6(SEQ ID NO. 7), 화합물 7(SEQ ID NO. 8), 화합물 8(SEQ ID NO. 9), 화합물 9(SEQ ID NO. 10), 화합물 10(SEQ ID NO. 11), 화합물 11(SEQ ID NO. 12), 화합물 12(SEQ ID NO. 13), 화합물 13(SEQ ID NO. 14), 화합물 15(SEQ ID NO. 16), 화합물 16(SEQ ID NO. 17), 화합물 17(SEQ ID NO. 18), 또는 화합물 18(SEQ ID NO. 19)인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.11. The method of claim 10, wherein the peptide analog is selected from the group consisting of Compound 1 (SEQ ID NO. 2), Compound 2 (SEQ ID NO. 3), Compound 3 (SEQ ID NO. (SEQ ID NO. 6), Compound 6 (SEQ ID NO. 7), Compound 7 (SEQ ID NO. 8), Compound 8 (SEQ ID NO. Compound 10 (SEQ ID NO. 11), Compound 11 (SEQ ID NO. 12), Compound 12 (SEQ ID NO. 13), Compound 13 (SEQ ID NO. 14), Compound 15 The oximated modulin peptide analogue is characterized by compound 16 (SEQ ID NO. 17), compound 17 (SEQ ID NO. 18), or compound 18 (SEQ ID NO.
  12. 하기 화학식 Ⅱ의 아미노산 서열을 포함하며, 아미노산 서열 내에 분자내 가교를 갖는 옥신토모듈린 펩타이드 유사체. An oxytomodulin peptide analogue comprising an amino acid sequence of the following formula (II) and having an intramolecular bridge within the amino acid sequence.
    <화학식 Ⅱ>&Lt; Formula (II)
    His-X17-Gln-Gly-Thr-Phe-Thr-Ser-Asp-X18-Ser-Lys-Tyr-Leu-Asp-X19-Arg-Arg-Ala-X20-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys (SEQ ID NO.53) His-X 17 -Gln-Gly- Thr-Phe-Thr-Ser-Asp-X 18 -Ser-Lys-Tyr-Leu-Asp-X 19 -Arg-Arg-Ala-X 20 -Asp-Phe-Val- Gln-Trp-Leu-Met-Asn-Thr-Lys (SEQ ID NO: 53)
    상기식에서,In this formula,
    X17은 Ser 또는 Aib (Aminoisobutric acid)이고;X 17 is Ser or Aib (Aminoisobutric acid);
    X18은 Z이며;X 18 is Z;
    X19는 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X 19 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
    X20은 Asp, Glu, Cys, Hcy (Homocysteine), Lys 또는 Orn (Ornithine)이며;X 20 is Asp, Glu, Cys, Hcy (Homocysteine), Lys or Orn (Ornithine);
    X19와 X20은 분자내 결합 또는 가교제 (cross linker)를 통하여 cyclic 펩타이드를 형성하며, 이때, cyclic 펩타이드는 두 잔기 사이에 아미드결합으로 형성된 락탐 링 또는 두 잔기 사이에 di-sulfide 결합으로 형성된 di-sulfide 링 또는 두 잔기 사이에 가교제 (cross linker) 결합으로 형성된 cross-linked 링을 가진 펩타이드이며;X 19 and X 20 form a cyclic peptide through an intramolecular bond or a cross linker, wherein the cyclic peptide is formed by a lactam ring formed by an amide bond between two residues, or a lactam ring formed by a di-sulfide bond between two residues a peptide with a cross-linked ring formed by a cross linker bond between a sulfide ring or two residues;
    C-말단 아미노산은 임으로 아미드화 될 수 있으며;The C-terminal amino acid may be amidated in situ;
    Z은 상기 화학식 Ⅰ에서 정의한 바와 같다.Z is as defined in the above formula (I).
  13. 제 12 항에 있어서, X19와 X20의 분자내 결합은 X19와 X20이 각각 Asp 또는 Glu와 Lys 또는 Orn이거나, 각각 Lys 또는 Orn와 Asp 또는 Glu 일 때, 분자내 락탐 링 형성 결합이거나; X19와 X20이 각각 Cys 또는 Hcy와 Cys 또는 Hcy 일 때, 분자내 di-sulfide 링 형성 결합인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.13. The method of claim 12, X 19 and bond the molecules of X 20 is X 19 and X 20 each Asp or is Glu and Lys or Orn, respectively, Lys or Orn and Asp or Glu one time, the lactam intramolecular ring forming bond or ; Wherein when X 19 and X 20 are Cys or Hcy and Cys or Hcy, respectively, it is an intramolecular di-sulfide ring-forming bond.
  14. 제 13 항에 있어서, X19와 X20이 각각 Cys 또는 Hcy와 Cys 또는 Hcy 일 때, 가교제(cross linker)는 양쪽 Cys 또는 Hcy 측쇄의 티올(thiol) 작용기에 결합되어 링을 형성하며, 이때 가교제는 C1-C6 직쇄 또는 분지쇄 알킬, C3-C8 포화 또는 불포화 사이클로알킬, C6-C10 아릴, 또는 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.14. The method of claim 13, wherein when X 19 and X 20 are Cys or Hcy and Cys or Hcy, respectively, the cross linker is bonded to the thiol functional groups of both Cys or Hcy side chains to form a ring, Is C 1 -C 6 straight or branched chain alkyl, C 3 -C 8 saturated or unsaturated cycloalkyl, C 6 -C 10 aryl, or C 5 -C 12 heteroaryl or fused heterocyclic aryl Oxytomodulin peptide analogs.
  15. 제 14 항에 있어서,15. The method of claim 14,
    가교제는
    Figure PCTKR2018009425-appb-I000022
    ,
    Figure PCTKR2018009425-appb-I000023
    ,
    Figure PCTKR2018009425-appb-I000024
    ,
    The cross-
    Figure PCTKR2018009425-appb-I000022
    ,
    Figure PCTKR2018009425-appb-I000023
    ,
    Figure PCTKR2018009425-appb-I000024
    ,
    Figure PCTKR2018009425-appb-I000025
    ,
    Figure PCTKR2018009425-appb-I000026
    ,
    Figure PCTKR2018009425-appb-I000027
    또는
    Figure PCTKR2018009425-appb-I000028
    Figure PCTKR2018009425-appb-I000025
    ,
    Figure PCTKR2018009425-appb-I000026
    ,
    Figure PCTKR2018009425-appb-I000027
    or
    Figure PCTKR2018009425-appb-I000028
    medium
    에서 선택됨을 특징으로 하는 옥신토모듈린 펩타이드 유사체.&Lt; / RTI &gt; is selected from the group consisting of: &lt; RTI ID = 0.0 &gt;
    상기 식에서, R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이다.Wherein, R is hydrogen or C 1 -C 6 linear or branched alkyl.
  16. 제 12 항에 있어서, X19와 X20이 각각 Asp 또는 Glu와 Asp 또는 Glu 일 때, 가교제(cross linker)는 양쪽 Asp 또는 Glu 측쇄의 카르복실기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-아미노 C1-C6 직쇄 또는 분지쇄 알킬, 디-아미노 C3-C8 포화 또는 불포화 사이클로알킬, 아미노 피페리딘, 피페라진, 디-아미노 C6-C10 아릴, 또는 디-아미노 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.13. The method of claim 12, wherein when X 19 and X 20 are Asp or Glu and Asp or GIu, respectively, the cross linker forms a ring with amide bonds in the carboxyl groups of both Asp or Glu side chains, wherein the cross linker Is selected from the group consisting of di-amino C 1 -C 6 straight or branched chain alkyl, di-amino C 3 -C 8 saturated or unsaturated cycloalkyl, aminopiperidine, piperazine, di-amino C 6 -C 10 aryl, - amino C 5 -C 12 heteroaryl or fused heterocyclic aryl.
  17. 제 16 항에 있어서, 17. The method of claim 16,
    가교제는
    Figure PCTKR2018009425-appb-I000029
    ,
    Figure PCTKR2018009425-appb-I000030
    ,
    Figure PCTKR2018009425-appb-I000031
    ,
    The cross-
    Figure PCTKR2018009425-appb-I000029
    ,
    Figure PCTKR2018009425-appb-I000030
    ,
    Figure PCTKR2018009425-appb-I000031
    ,
    Figure PCTKR2018009425-appb-I000032
    ,
    Figure PCTKR2018009425-appb-I000033
    ,
    Figure PCTKR2018009425-appb-I000034
    ,
    Figure PCTKR2018009425-appb-I000035
    ,
    Figure PCTKR2018009425-appb-I000032
    ,
    Figure PCTKR2018009425-appb-I000033
    ,
    Figure PCTKR2018009425-appb-I000034
    ,
    Figure PCTKR2018009425-appb-I000035
    ,
    또는
    Figure PCTKR2018009425-appb-I000037
    중에서 선택됨을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
    or
    Figure PCTKR2018009425-appb-I000037
    &Lt; RTI ID = 0.0 &gt; oxynomodulin &lt; / RTI &gt; peptide analogs.
    상기 식에서, R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이다.Wherein, R is hydrogen or C 1 -C 6 linear or branched alkyl.
  18. 제 12 항에 있어서, X19와 X20이 각각 Lys 또는 Orn와 Lys 또는 Orn 일 때, 가교제(cross linker)는 양쪽 Lys 또는 Orn 측쇄의 아민기에 아미드결합으로 링을 형성하며, 이때 가교제(cross linker)는 디-카르보닐 C1-C6 직쇄 또는 분지쇄 알킬, 디-카르보닐 C3-C8 포화 또는 불포화 사이클로알킬, 디-카르보닐 C6-C10 아릴 또는 디-카르보닐 C5-C12 헤테로 아릴 또는 융합된 헤테로사이클릭 아릴인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.13. The method of claim 12, wherein when X 19 and X 20 are Lys or Orn and Lys or Orn, respectively, the cross linker forms a ring with an amide bond in the amine group of both Lys or Orn side chains, wherein the cross linker ) Is a di-carbonyl C 1 -C 6 straight or branched chain alkyl, di-carbonyl C 3 -C 8 saturated or unsaturated cycloalkyl, di-carbonyl C 6 -C 10 aryl or di-carbonyl C 5 - C 12 auxin Sat module Lin peptide analogs wherein the hetero cyclic aryl or fused heteroaryl.
  19. 제 18 항에 있어서, 19. The method of claim 18,
    가교제는
    Figure PCTKR2018009425-appb-I000038
    ,
    Figure PCTKR2018009425-appb-I000039
    ,
    Figure PCTKR2018009425-appb-I000040
    ,
    The cross-
    Figure PCTKR2018009425-appb-I000038
    ,
    Figure PCTKR2018009425-appb-I000039
    ,
    Figure PCTKR2018009425-appb-I000040
    ,
    Figure PCTKR2018009425-appb-I000041
    ,
    Figure PCTKR2018009425-appb-I000042
    ,
    Figure PCTKR2018009425-appb-I000043
    또는
    Figure PCTKR2018009425-appb-I000044
    Figure PCTKR2018009425-appb-I000041
    ,
    Figure PCTKR2018009425-appb-I000042
    ,
    Figure PCTKR2018009425-appb-I000043
    or
    Figure PCTKR2018009425-appb-I000044
    medium
    에서 선택됨을 특징으로 하는 옥신토모듈린 펩타이드 유사체. &Lt; / RTI &gt; is selected from the group consisting of: &lt; RTI ID = 0.0 &gt;
    상기 식에서, R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이다.Wherein, R is hydrogen or C 1 -C 6 linear or branched alkyl.
  20. 제 12 항에 있어서, X19와 X20이 각각 Asp 또는 Glu와 Lys 또는 Orn 일 때, 또는 각각 Lys 또는 Orn와 Asp 또는 Glu 일 때, 가교제(cross linker)는 Asp 또는 Glu 측쇄의 카르복실기와 가교제(cross linker)의 아민 작용기와 아미드결합으로 연결되며, Lys 또는 Orn 측쇄의 아민기에는 가교제(cross linker)의 카르복실 작용기와 아미드결합으로 연결되어 링을 형성하며, 이때 가교제(cross linker)는 Gly, Val, Leu, Ile 중에서 선택되는 알파아미노산, 베타 아미노산, 카르보닐 C1-C6 직쇄 또는 분지쇄 알킬아민, 카르보닐 C3-C8 포화 또는 불포화 알킬아민, 카르보닐 피페리딘, 아미노 벤조일, 카르보닐 C6-C10 아릴아민 또는 카르보닐 C5-C12 헤테로 아릴아민 또는 융합된 헤테로사이클릭 아릴아민인 것을 특징으로 하는 옥신토모듈린 펩타이드 유사체.13. The method of claim 12, wherein when X 19 and X 20 are Asp or Glu and Lys or Orn, respectively, or Lys or Orn and Asp or GIu, respectively, the cross linker is a cross- Cross linkers are linked by amide bonds. Amine groups of Lys or Orn side chains are linked by amide bonds with carboxyl functional groups of cross linkers to form rings. The cross linkers are Gly, Val, Leu, Ile, beta amino acid, carbonyl C 1 -C 6 straight or branched chain alkylamine, carbonyl C 3 -C 8 saturated or unsaturated alkylamine, carbonylpiperidine, aminobenzoyl, A carbonyl C 6 -C 10 arylamine or a carbonyl C 5 -C 12 heteroarylamine or a fused heterocyclic arylamine.
  21. 제 20 항에 있어서,21. The method of claim 20,
    가교제는
    Figure PCTKR2018009425-appb-I000045
    ,
    Figure PCTKR2018009425-appb-I000046
    ,
    Figure PCTKR2018009425-appb-I000047
    ,
    The cross-
    Figure PCTKR2018009425-appb-I000045
    ,
    Figure PCTKR2018009425-appb-I000046
    ,
    Figure PCTKR2018009425-appb-I000047
    ,
    Figure PCTKR2018009425-appb-I000048
    ,
    Figure PCTKR2018009425-appb-I000049
    ,
    Figure PCTKR2018009425-appb-I000050
    ,
    Figure PCTKR2018009425-appb-I000051
    ,
    Figure PCTKR2018009425-appb-I000048
    ,
    Figure PCTKR2018009425-appb-I000049
    ,
    Figure PCTKR2018009425-appb-I000050
    ,
    Figure PCTKR2018009425-appb-I000051
    ,
    Figure PCTKR2018009425-appb-I000052
    ,
    Figure PCTKR2018009425-appb-I000053
    또는
    Figure PCTKR2018009425-appb-I000054
    중에서 선택됨을 특징으로 하는 옥신토모듈린 펩타이드 유사체.
    Figure PCTKR2018009425-appb-I000052
    ,
    Figure PCTKR2018009425-appb-I000053
    or
    Figure PCTKR2018009425-appb-I000054
    &Lt; RTI ID = 0.0 &gt; oxynomodulin &lt; / RTI &gt; peptide analogs.
    상기 식에서, R은 수소 또는 C1-C6 직쇄 또는 분지쇄 알킬이다.Wherein, R is hydrogen or C 1 -C 6 linear or branched alkyl.
  22. 제 12 항에 있어서, 상기 펩타이드 유사체는 화합물 14(SEQ ID NO. 15), 화합물 19(SEQ ID NO. 20), 화합물 20(SEQ ID NO. 21), 화합물 21(SEQ ID NO. 22), 화합물 22(SEQ ID NO. 23), 화합물 23(SEQ ID NO. 24), 화합물 24(SEQ ID NO. 25), 화합물 25(SEQ ID NO. 26), 화합물 27(SEQ ID NO. 28), 화합물 28(SEQ ID NO. 29), 화합물 29(SEQ ID NO. 30), 화합물 30(SEQ ID NO. 31), 화합물 31(SEQ ID NO. 32), 화합물 32(SEQ ID NO. 33), 화합물 33(SEQ ID NO. 34), 화합물 34(SEQ ID NO. 35), 화합물 35(SEQ ID NO. 36), 화합물 36(SEQ ID NO. 37), 화합물 37(SEQ ID NO. 38), 화합물 38(SEQ ID NO. 39)인 것을 특징으로 하는 펩타이드 유사체.14. The method of claim 12, wherein the peptide analog is selected from the group consisting of compound 14 (SEQ ID NO. 15), compound 19 (SEQ ID NO. 20), compound 20 (SEQ ID NO. 21) (SEQ ID NO. 23), Compound 23 (SEQ ID NO. 24), Compound 24 (SEQ ID NO. 25), Compound 25 (SEQ ID NO. 26), Compound 27 (SEQ ID NO. 29), Compound 29 (SEQ ID NO. 30), Compound 30 (SEQ ID NO. 31), Compound 31 (SEQ ID NO. (SEQ ID NO. 34), Compound 34 (SEQ ID NO. 35), Compound 35 (SEQ ID NO. 36), Compound 36 (SEQ ID NO. 37), Compound 37 Compound 38 (SEQ ID NO. 39).
  23. 제 1 항 내지 제 11 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료용 약학조성물.12. A pharmaceutical composition for preventing or treating a condition caused or characterized by obesity or overweight comprising a peptide analogue according to any one of claims 1 to 11 and comprising a pharmaceutically acceptable excipient.
  24. 제 1 항 내지 제 11 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중을 동반하는 비 인슐린 의존성 당뇨병 치료 또는 예방용 약학조성물.12. A pharmaceutical composition for the treatment or prophylaxis of non-insulin dependent diabetes mellitus comprising the peptide analogue according to any one of claims 1 to 11 and being accompanied by obesity or overweight comprising a pharmaceutically acceptable excipient.
  25. 제 12 항 내지 제 22 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중에 의해 야기되거나 특징지어지는 병태의 예방 또는 치료용 약학조성물.22. A pharmaceutical composition for preventing or treating a condition caused by or characterized by obesity or overweight comprising a peptide analogue according to any one of claims 12 to 22 and comprising a pharmaceutically acceptable excipient.
  26. 제 12 항 내지 제 22 항 중 어느 한 항에 기재된 펩타이드 유사체를 포함하고, 약학적으로 허용되는 부형제를 포함하는 비만 또는 과체중을 동반하는 비 인슐린 의존성 당뇨병 치료 또는 예방용 약학조성물.22. A pharmaceutical composition for the treatment or prophylaxis of non-insulin dependent diabetes mellitus comprising the peptide analogue according to any one of claims 12 to 22, which is accompanied by obesity or overweight comprising a pharmaceutically acceptable excipient.
PCT/KR2018/009425 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog WO2019035672A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
EP18846196.6A EP3670529B1 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
NZ761754A NZ761754B2 (en) 2018-08-16 Acylated oxyntomodulin peptide analog
JP2020508489A JP7211659B2 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analogs
CN202410003809.3A CN117603337A (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analogues
AU2018318672A AU2018318672B2 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
BR112020003319-7A BR112020003319A2 (en) 2017-08-16 2018-08-16 acylated oxintomodulin peptide analog
CA3073011A CA3073011C (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
MX2020001761A MX2020001761A (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog.
SG11202001283PA SG11202001283PA (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
CN201880053473.4A CN111094331B (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analogues
CN202310958807.5A CN116854804A (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analogues
EP22170622.9A EP4079757A1 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
RU2020108518A RU2752787C1 (en) 2017-08-16 2018-08-16 Peptide analog of acylated oxyntomodulin
US16/638,970 US11236142B2 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
IL272606A IL272606A (en) 2017-08-16 2020-02-11 Acylated oxyntomodulin peptide analog
PH12020500338A PH12020500338A1 (en) 2017-08-16 2020-02-14 Acylated oxyntomodulin peptide analog
SA520411366A SA520411366B1 (en) 2017-08-16 2020-02-16 Acylated oxyntomodulin peptide analog
US17/410,697 US11713344B2 (en) 2017-08-16 2021-08-24 Acylated oxyntomodulin peptide analog
JP2021175902A JP7443315B2 (en) 2017-08-16 2021-10-27 Acylated oxyntomodulin peptide analogs

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2017-0103798 2017-08-16
KR20170103798 2017-08-16
KR10-2018-0095717 2018-08-16
KR1020180095717A KR102230363B1 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin analogues

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/638,970 A-371-Of-International US11236142B2 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog
US17/410,697 Division US11713344B2 (en) 2017-08-16 2021-08-24 Acylated oxyntomodulin peptide analog

Publications (1)

Publication Number Publication Date
WO2019035672A1 true WO2019035672A1 (en) 2019-02-21

Family

ID=65361996

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/009425 WO2019035672A1 (en) 2017-08-16 2018-08-16 Acylated oxyntomodulin peptide analog

Country Status (1)

Country Link
WO (1) WO2019035672A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2799327C1 (en) * 2020-04-29 2023-07-04 Тон-А Ст Ко., Лтд. Long-acting double agonist of glucagon-like peptide-1 and glucagon receptors
JP2023533413A (en) * 2020-04-29 2023-08-03 ドン-ア エスティ カンパニー リミテッド Long-Acting GLP-1 and Glucagon Receptor Dual Agonists

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20120139579A (en) 2011-06-17 2012-12-27 한미사이언스 주식회사 A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
WO2016049190A1 (en) * 2014-09-24 2016-03-31 Indiana University Research And Technology Corporation Incretin-insulin conjugates

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20120139579A (en) 2011-06-17 2012-12-27 한미사이언스 주식회사 A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
WO2016049190A1 (en) * 2014-09-24 2016-03-31 Indiana University Research And Technology Corporation Incretin-insulin conjugates

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
ACS CHEM BIOL., vol. 11, 2016, pages 324 - 328
ANIM SCI J., vol. 87, no. 9, 2016, pages 1090 - 1098
DIABETES, OBESITY AND METABOLISM, vol. 18, 2016, pages 1176 - 1190
DIABETES, vol. 54, 2005, pages 2390 - 2395
DIABETES, vol. 58, no. 10, 2009, pages 2258 - 2266
DIABETES, vol. 62, no. 1, 2013, pages A48
EXPERT REV CARDIOVASC THER., vol. 13, no. 7, 2015, pages 753 - 767
J BIOL CHEM., vol. 278, 2002, pages 22418 - 22423
J CLIN ENDOCRINOL METAB., vol. 88, 2003, pages 4696 - 4701
KOREAN J MED., vol. 87, no. 1, 2014, pages 9 - 13
LANCET, vol. 391, 2018, pages 2607 - 2618
MIRANDA, L. P. ET AL.: "Design and Synthesis of Conformationally Constrained Glucagon-like Peptide-1 Derivatives with Increased Plasma Stability and Prolonged in Vivo Activity", JOURNAL OF MEDICINAL CHEMISTRY, vol. 51, 2008, pages 2758 - 2765, XP007909689, DOI: doi:10.1021/jm701522b *
MOLECULAR METABOLISM, vol. 2, 2013, pages 468 - 479
MOLECULAR METABOLISM., vol. 3, 2014, pages 241 - 251
MURAGE, E. N. ET AL.: "Search for a-helical Propensity in the Receptor-bound Conformation of Glucagon-like Peptide-1", BIOORGANIC & MEDICINAL CHEMISTRY, vol. 16, 2008, pages 10106 - 10112, XP025691312, DOI: doi:10.1016/j.bmc.2008.10.006 *
PHYSIOL REV., vol. 87, no. 4, 2007, pages 1409 - 1439
SWEDBERG, J. E. ET AL.: "Cyclic Alpha-conotoxin Peptidomimetic Chimeras as Potent GLP-1R Agonists", EUROPEAN JOURNAL OF MEDICINAL CHEMISTRY, vol. 103, 2015, pages 175 - 184, XP029295239, DOI: doi:10.1016/j.ejmech.2015.08.046 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2799327C1 (en) * 2020-04-29 2023-07-04 Тон-А Ст Ко., Лтд. Long-acting double agonist of glucagon-like peptide-1 and glucagon receptors
JP2023533413A (en) * 2020-04-29 2023-08-03 ドン-ア エスティ カンパニー リミテッド Long-Acting GLP-1 and Glucagon Receptor Dual Agonists
JP7440663B2 (en) 2020-04-29 2024-02-28 ドン-ア エスティ カンパニー リミテッド Long-acting GLP-1 and glucagon receptor dual agonist

Similar Documents

Publication Publication Date Title
WO2017116205A1 (en) Persistent conjugate of triple activator activating glucagon, glp-1 and gip receptor
WO2012173422A1 (en) A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
WO2018056764A1 (en) Insulin analog having reduced binding force to insulin receptor, and use thereof
WO2019066586A1 (en) Long-acting conjugate of glucagon-like peptide-2 (glp-2) derivative
WO2017116207A1 (en) Fgf21 analog, fgf21 conjugate, and use thereof
WO2018174668A2 (en) Insulin analog complex with reduced affinity for insulin receptor and use thereof
WO2020130749A1 (en) Pharmaceutical composition comprising insulin and triple agonist having activity with respect to all of glucagon and glp-1 and gip receptor
WO2019066570A1 (en) Long-acting single-chain insulin analog and conjugate thereof
EP1756156B1 (en) Selective vpac2 receptor peptide agonists
WO2021066600A1 (en) Glucagon, composition comprising glp-1 receptor and gip receptor dual agonist and therapeutic use thereof
WO2019035672A1 (en) Acylated oxyntomodulin peptide analog
WO2022015115A1 (en) Therapeutic use of combination containing triple agonistic long-acting conjugate or triple agonist
WO2022015082A1 (en) Therapeutic use of glucagon derivative or conjugate thereof for liver disease
WO2021215801A1 (en) Preventive or therapeutic pharmaceutical composition for hyperlipidemia comprising triple agonist acting on all of glucagon, glp-1 and gip receptors, or conjugate thereof, and preventive or therapeutic method
WO2020214013A1 (en) Therapeutic use, for hyperlipideamia, of triple agonist having activity with respect to all of glucagon, glp-1, and gip receptors, or conjugate thereof
WO2021133087A1 (en) Pharmaceutical composition for preventing or treating metabolic bone diseases, comprising glp-2 or conjugate thereof
WO2020242268A1 (en) Physiologically active substance bound to biotin moiety, and composition for oral administration including same
WO2020263063A1 (en) Therapeutic use, for liver disease, of triple agonist having activity with respect to all of glucagon, glp-1, and gip receptors, or conjugate thereof
WO2021107519A1 (en) Biotin moiety-conjugated polypeptide and pharmaceutical composition for oral administration comprising the same
WO2021194228A1 (en) Pharmaceutical composition for prevention or treatment of cancer
WO2024080824A1 (en) Novel glp-1 receptor antagonist, and pharmaceutical composition for preventing or treating congenital hyperinsulinemia or hypoglycemia, comprising same
WO2023277620A1 (en) Therapeutic use of combination comprising triple activator having activity on all of glucagon, glp-1 and gip receptor
WO2022035302A1 (en) Hypotensive pharmaceutical composition comprising triple activator having activity for all of glucagon, glp-1, and gip receptors
WO2023132609A1 (en) Long-acting fatty acid-peptide derivative and use thereof
WO2022139552A1 (en) Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18846196

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3073011

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020508489

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018318672

Country of ref document: AU

Date of ref document: 20180816

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020003319

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2018846196

Country of ref document: EP

Effective date: 20200316

ENP Entry into the national phase

Ref document number: 112020003319

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200217

WWE Wipo information: entry into national phase

Ref document number: 520411366

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: P-2024/0329

Country of ref document: RS