WO2018227018A1 - Antibody conjugates of immune-modulatory compounds and uses thereof - Google Patents

Antibody conjugates of immune-modulatory compounds and uses thereof Download PDF

Info

Publication number
WO2018227018A1
WO2018227018A1 PCT/US2018/036554 US2018036554W WO2018227018A1 WO 2018227018 A1 WO2018227018 A1 WO 2018227018A1 US 2018036554 W US2018036554 W US 2018036554W WO 2018227018 A1 WO2018227018 A1 WO 2018227018A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
sequence
identity
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/036554
Other languages
English (en)
French (fr)
Inventor
Peter Armstrong Thompson
Badreddin EDRIS
Craig Alan Coburn
Peter Robert Baum
Valerie Odegard
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ARS Pharmaceuticals Inc
Original Assignee
Silverback Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Silverback Therapeutics Inc filed Critical Silverback Therapeutics Inc
Priority to US16/620,429 priority Critical patent/US20200199247A1/en
Priority to EP18813505.7A priority patent/EP3634485A4/en
Priority to JP2019567691A priority patent/JP2020523319A/ja
Priority to AU2018279105A priority patent/AU2018279105A1/en
Priority to CN201880047508.3A priority patent/CN110891605A/zh
Priority to CA3065852A priority patent/CA3065852A1/en
Publication of WO2018227018A1 publication Critical patent/WO2018227018A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6845Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/04Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies

Definitions

  • Autoimmune and autoinflammatory diseases can result from an abnormal response of the immune system to a normal part of the body.
  • the adaptive immune system can attack the body's own tissues.
  • one hallmark of autoimmune disease can be the production of auto-antibodies to antigens in normal tissues of the patient.
  • Persistent inflammation can be another symptom of autoimmune disease and can play a role in the pathogenesis of common autoimmune diseases such as rheumatoid arthritis, inflammatory bowel diseases, systemic lupus erythematosus, and multiple sclerosis.
  • Treatment for autoimmune diseases generally focuses on reducing immune system activity, but many patients fail to respond to current therapies or their disease becomes refractory to the treatment. Thus, new more durable treatments are needed.
  • Fibrosis can be the formation of excess fibrous connective tissue or scar tissue in an organ or tissue in a reparative or reactive process. Fibrosis can occur in many tissues within the body, typically as a result of inflammation or damage, which can include the lungs, kidney, liver, heart, and brain. Scar tissue can block arteries, immobilize joints, and damage internal organs, which can negatively impact the body's ability to maintain vital functions. Every year, millions of people are hospitalized due to the damaging effects of fibrosis.
  • a composition of a conjugate comprises: an immune-modulatory compound; an antibody construct comprising a first antigen binding domain and an Fc domain, wherein: the first antigen binding domain specifically binds to a first antigen, wherein the first antigen has at least 80% sequence identity with an antigen selected from a group consisting of Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNAR1, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFRp, Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ , CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, and CD25, and a fragment thereof; a linker attaching the antibody construct to the immune-modulatory
  • the first antigen is selected from LRRC15, Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNAR1, BDCA2, CD30, c- KIT, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ , CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, MMP14, GPX8, and F2RL2.
  • the first antigen is selected from FAP, LRRC15, Cadherin 11 (CDH11), and TNFR2.
  • the immune-modulatory compound has activity on stellate cells,
  • the immune-modulatory compound has activity on stellate cells, myofibroblasts, or immune cells.
  • a conjugate comprises: an immune-modulatory compound; a second compound; a spacer comprising 1 to 100 linear, non-hydrogen atoms covalently attached to the immune-modulatory compound and to the second compound; an antibody construct comprising a first antigen binding domain and an Fc domain, wherein: the first antigen binding domain specifically binds to a first antigen, wherein the first antigen has at least 80% sequence identity with an antigen selected from a group consisting of Cadherin 11, PDPN, LRRC15, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNAR1, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ , CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86,
  • the second compound binds to to an E3 ubiquitin ligase.
  • the second compound is a second immune- modulatory compound.
  • the second immune-modulatory compound and the immune-modulatory compound are the same.
  • the first antigen is selected from Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNAR1, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFRp, Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ , CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, and LRRC15.
  • the first antigen is selected from FAP, LRRC15, Cadherin 11, and TNFR2.
  • the immune-modulatory compound has activity on stellate cells, myofibroblasts, or immune cells.
  • a conjugate comprises: an immune-modulatory compound; an antibody construct comprising a first antigen binding domain and an Fc domain, wherein: the first antigen binding domain specifically binds to a first antigen, wherein the first antigen comprises a protein complex, a protein conformer, a post-transcriptional modification, or a post-translational modification; a linker attaching the antibody construct to the immune- modulatory compound, wherein the linker is covalently bound to the antibody construct and the linker is covalently bound to the immune-modulatory compound, and wherein a molar ratio of immune-modulatory compound to antibody construct is less than 8.
  • the first antigen is the post-translational modification or protein conformer such as a
  • the first antigen is the protein complex of an integrin pair.
  • the integrin pair comprises ⁇ .
  • the immune-modulatory compound comprises a first moiety that binds to a protein target and a second moiety that binds to an E3 ubiquitin ligase.
  • the first moiety is covalently attached to the second moiety via a spacer comprising from 5 to 20 linear, non-hydrogen atoms.
  • a Kd for binding of the first antigen binding domain to the first antigen in a presence of the immune-modulatory compound is less than about 100 nM and no greater than about 100 times a Kd for binding of the first antigen binding domain to the first antigen in the absence of the immune-modulatory compound (i.e., the immune-modulatory compound is not attached to the antibody construct).
  • a Kd for binding of the Fc domain to an Fey receptor in the presence of the immune-modulatory compound is equivalent to or no greater than 2 times, 5 times, or 10 times a Kd for binding of the Fc domain to the Fey receptor in the absence of the immune-modulatory compound (i.e., the immune-modulatory compound is not attached to the antibody construct).
  • a Kd for binding of the Fc domain to an Fey receptor is greater than 100 times a Kd for binding of an IgGl Fc domain to the Fey receptor in the absence of the immune-modulatory compound, and wherein a Kd for binding of the Fc domain to an FcRn receptor in the presence of the immune-modulatory compound is at least equivalent to or at least no greater than about 2 times, 5 times, or 10 times a Kd for binding of the Fc domain to the FcRn receptor in the absence of the immune-modulatory compound.
  • a Kd for binding of the Fc domain to an FcRn receptor in the presence of the immune- modulatory compound is at least equivalent to or at least no greater than about 2 times, 5 times, or 10 times a Kd for binding of the Fc domain to the FcRn receptor in the absence of the immune-modulatory compound.
  • the Fc domain is an Fc null.
  • the antibody construct further comprises a second binding domain.
  • the immune-modulatory compound of the conjugate lowers activity of the protein target in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface.
  • the conjugate lowers activity of the protein target by increasing target protein degradation in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface.
  • the conjugate increases activity of the protein target in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface.
  • the conjugate alters activity of the protein target in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface. In some aspects, the conjugate alters activity of the protein target in a cell, the cell expressing expressing the first antigen, the second antigen, or both, on the cell surface compared to a cell not expressing the first antigen, the second antigen, or both, on the cell surface. In some aspects, the conjugate increases activity of the protein target in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface, and wherein the first moiety is an agonist for A2aR, PP2A, PPARg, Vitamin D Receptor (VDR), or KCA3.1.
  • the first moiety is an agonist for A2aR, PP2A, PPARg, Vitamin D Receptor (VDR), or KCA3.1.
  • the conjugate lowers activity of the protein target in a cell, the cell expressing the first antigen, the second antigen, or both, on the cell surface, and wherein the first moiety is a kinase inhibitor, ion channel antagonist, or a PARP1 inhibitor. In some aspects, the conjugate lowers activity of the protein target by increasing target protein degradation in a cell, expressing the first antigen, the second antigen, or both, on the cell surface, and wherein the first moiety is a kinase inhibitor, ion channel antagonist, or a PARP1 inhibitor. In some aspects, the conjugate lowers fibrogenic activity of stellate cells or myofibroblasts.
  • the conjugate lowers activation of an activated immune cell or decreases production of one or more proinflammatory mediators. In some aspects, the conjugate increases an immunosuppressive activity or tolerogenic activity of an immune cell.
  • the second binding domain specifically binds to a second antigen.
  • the second antigen is an antagonist of an immune cell immunomodulatory target or an agonist of an immune check point target on an immune cell or tissue. In some aspects, the second antigen comprises at least 80% sequence identity with TNFR2, CD40, CD86, PD-1, TIM3, BTLA, DEC205, DCIR, CD45RB, CD45RO, HLA DR, CD38, CD73, GARP, BDCA2, or CD30.
  • the second antigen comprises at least 80% sequence identity with TNFR2, CD40, CD86, PD-1, PD-L1, TIM3, BTLA, DEC205, DCIR, CD45RB, CD45RO, HLA DR, CD38, CD73, GARP, BDCA2, or CD30.
  • the second binding domain is attached to the antibody construct at a C-terminal end of the Fc domain. In some aspects, the second binding domain is attached to a C-terminal end of a light chain of the antibody construct.
  • inflammation is decreased in the subject.
  • fibrosis is decreased is the subject.
  • the first antigen binding domain is a CD40 antagonist.
  • the second binding domain is attached to the Fc domain or the light chain of the first antigen binding domain: a) as an Fc domain-second binding domain fusion protein; b) as a light chain-second binding domain fusion protein; or c) by a conjugation via a first linker.
  • the Fc domain is attached to the first antigen binding domain: a) as an Fc domain-first antigen binding domain fusion protein; or b) by conjugation via a second linker.
  • the Fc domain is attached to both the second binding domain and to the first antigen binding domain as a second binding domain- Fc domain- first antigen binding domain fusion protein.
  • the first antigen binding domain is attached to both the Fc domain and the second binding domain as a second binding domain-first antigen binding domain-Fc domain fusion protein.
  • a) the first antigen binding domain and the Fc domain comprise an antibody and the second binding domain comprises a single chain variable fragment (scFv); or b) the second binding domain and the Fc domain comprise an antibody and the first antigen binding domain comprises a single chain variable fragment (scFv).
  • the Fc domain is an Fc domain variant comprising at least one amino acid residue change as compared to a wild type sequence of the Fc domain. In some aspects, the Fc domain variant binds to an Fc receptor with altered affinity as compared to a wild type Fc domain. In some aspects, the Fc domain variant binds to an Fc receptor with decreased affinity as compared to a wild type Fc domain.
  • an affinity of the Fc domain variant for an FcRn receptor is at least equivalent affinity or is not 10-fold lower an affinity of a wild type Fc domain for the FcRn receptor
  • the Fc domain comprises at least one amino acid residue change selected from a group consisting of: a) N297A as in Kabat numbering and relative to SEQ ID NO: 437; b) N296G N297A as in Kabat numbering and relative to SEQ ID NO: 437; c) K322A/L234A/L235A N296A as in Kabat numbering and relative to SEQ ID NO: 437; d) L234F/L235E/P331S N296A as in Kabat numbering and relative to SEQ ID NO: 437.
  • the Fc domain comprises an IgG4 Fc domain comprising S228P/L235E/P329G as in Kabat numbering.
  • a Kd for binding of the first antigen binding domain to the first antigen in the presence of the immune-modulatory compound is no greater than about two times, five times, ten times, or fifty times a Kd for binding of the first antigen binding domain to the first antigen in an absence of the immune-modulatory compound. In some aspects, a Kd for binding of the Fc domain to the Fc receptor in the presence of the immune-modulatory compound is no greater than about two times, five times, ten times, or fifty times a Kd for binding of the Fc domain to the Fc receptor in an absence of the immune-modulatory compound.
  • a Kd for binding of the second binding domain to the second antigen in the presence of the immune-modulatory compound is no greater than about two times, five times, ten times, or fifty times a Kd for binding of the second binding domain to the second antigen in an absence of the immune-modulatory compound.
  • the immune-modulatory compound is a PI3K inhibitor, Calcineurin inhibitor, mTOR inhibitor, BTK inhibitor, JAK inhibitor, CRAC inhibitor, PARP1 antagonist, PPARg agonist, Kvl.3 antagonist, KCa3.1 antagonist, PP2A agonist, IRAK4 inhibitor, MYD88 inhibitor, BCL-2 antagonist, A2aR agonist, TLR7 antagonist, c-KIT kinase inhibitor, KCA3.1 agonist, TGFpR inhibitor (e.g., TGFpRl and/or TGFpR2 inhibitor), ACC antagonist, ASK1 antagonist, GLI1 antagonist, tankyrase (TNKS) antagonist, or TNIK antagonist.
  • the immune- modulatory compound is Tacrolimus, rapamycin, everolimus, AZD8055, Filgotinib,
  • the first antigen binding domain comprises a single chain variable fragment from an antibody specific for the first antigen.
  • the first antigen binding domain of the antibody construct comprises a set of six CDRs having at least 80% sequence identity to a set of CDRs set forth in TABLE 1, wherein the assignment of CDR residues are defined according to the IMGT (the international ImMunoGeneTics information system).
  • the first antigen binding domain comprises a set of CDRs having at least 80% sequence identity to: HCDRl comprising an amino acid sequence of SEQ ID NO: 1, HCDR2 comprising an amino acid sequence of SEQ ID NO: 2, HCDR3 comprising an amino acid sequence of SEQ ID NO: 3, LCDR1 comprising an amino acid sequence of SEQ ID NO: 4, LCDR2 comprising an amino acid sequence of SEQ ID NO: 5, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 6; HCDRl comprising an amino acid sequence of SEQ ID NO: 7, HCDR2 comprising an amino acid sequence of SEQ ID NO: 8, HCDR3 comprising an amino acid sequence of SEQ ID NO: 9, LCDR1 comprising an amino acid sequence of SEQ ID NO: 10, LCDR2 comprising an amino acid sequence of SEQ ID NO: 11, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 12; HCDRl comprising an amino acid sequence of SEQ ID NO: 13, HCDR2 comprising an amino acid sequence of S
  • the second binding domain comprises a single chain variable fragment from an antibody specific for the second antigen.
  • the second binding domain comprises a set of six CDRs having at least 80% sequence identity a set of CDRs set forth in Table 1 as SEQ ID NO: 85 - SEQ ID NO: 298.
  • the second binding domain comprises at least 80% sequence identity to: HCDR1 comprising an amino acid sequence of SEQ ID NO: 85, HCDR2 comprising an amino acid sequence of SEQ ID NO: 86, HCDR3 comprising an amino acid sequence of SEQ ID NO: 87, LCDRl comprising an amino acid sequence of SEQ ID NO: 88, LCDR2 comprising an amino acid sequence of SEQ ID NO: 89, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 90;
  • HCDR1 comprising an amino acid sequence of SEQ ID NO: 91, HCDR2 comprising an amino acid sequence of SEQ ID NO: 92, HCDR3 comprising an amino acid sequence of SEQ ID NO: 93, LCDRl comprising an amino acid sequence of SEQ ID NO: 94, LCDR2 comprising an amino acid sequence of SEQ ID NO: 95, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 96; HCDR1 comprising an amino acid sequence of SEQ ID NO: 97, HCDR2 comprising an amino acid sequence of SEQ ID NO: 98, HCDR3 comprising an amino acid sequence of SEQ ID NO: 99, LCDRl comprising an amino acid sequence of SEQ ID NO: 100, LCDR2 comprising an amino acid sequence of SEQ ID NO: 101, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 102; HCDR1 comprising an amino acid sequence of SEQ ID NO: 103, HCDR2 comprising an amino acid sequence of SEQ ID NO
  • the first antigen binding domain comprises a variable region heavy and light chain having at least 80% sequence identity to a pair of variable region heavy and light chains set forth in TABLE 2. In some aspects, the first antigen binding domain comprises a pair of variable region heavy and light chains having at least 80% sequence identity to a pair of variable region heavy and light chains set forth in TABLE 2. In some aspects, the first antigen binding domain comprises a pair of variable region heavy and light chains having at least 80% sequence identity to the non-CDR regions of a pair of variable region heavy and light chains set forth in TABLE 2.
  • the first antigen binding domain comprises: a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 300, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 299; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 301, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 299; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 302, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 303; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 304, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 305; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 306, and a V
  • the second binding domain comprises a variable region heavy and light chain having at least 80% sequence identity to a pair of variable region heavy and light chains set forth in Table 2 as SEQ ID NO: 352 - SEQ ID NO: 436. In some aspects, the second binding domain comprises a variable region heavy and light chain having at least 80% sequence identity to the CDR sequences of a pair of variable region heavy and light chains set forth in Table 2 as SEQ ID NO: 352 - SEQ ID NO: 436. In some aspects, the second binding domain comprises a variable region heavy and light chain having sequences selected from the pairs of variable region heavy and light chains set forth in Table 2 as SEQ ID NO: 352 - SEQ ID NO: 436.
  • the second binding domain comprises: a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 352, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 353; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 354, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 355; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 356, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 357; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 358, and a VL sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 359; a VH sequence having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 358, and a VL sequence identity to an amino acid sequence of
  • the second binding domain-Fc domain-first antigen binding domain fusion protein comprises the first antigen binding domain of the second binding domain-Fc domain-first antigen binding domain fusion protein comprises at least 80% sequence identity to any one of SEQ ID NO: 1 - SEQ ID NO: 436 or SEQ ID NO: 440 - SEQ ID NO: 481; the second binding domain of second binding domain-Fc domain-first antigen binding domain fusion protein comprises at least 80% sequence identity to any one of SEQ ID NO: 85 - SEQ ID NO: 299, SEQ ID NO: 352 - SEQ ID NO: 436; and the Fc domain of the second binding domain-Fc domain-first antigen binding domain fusion protein comprises at least 80% sequence identity to any one of SEQ ID NO: 437 - SEQ ID NO: 439, or any fragment thereof, or an Fc domain as described herein, or a fragment thereof.
  • the second binding domain- first antigen binding domain-Fc domain fusion protein of claim as described herein comprises: the first antigen binding domain of the second binding domain-first antigen binding domain-Fc domain fusion protein comprises a set of six CDRs having at least 80% sequence identity to a set of CDRs set forth in Table 1 as SEQ ID NO: 1 - SEQ ID NO: 436 or SEQ ID NO: 440 - SEQ ID NO: 481; the second binding domain of the second binding domain-first antigen binding domain-Fc domain fusion protein comprises a set of CDRS having at least 80% sequence identity to a set of CDRs set forth in Table 1 as SEQ ID NO: 85 - SEQ ID NO: 299, SEQ ID NO: 352 - SEQ ID NO: 436, or any fragment thereof; and the Fc domain of the second binding domain-first antigen binding domain-Fc domain fusion protein comprises at least 80% sequence identity to any one of SEQ ID NO: 437 - SEQ ID NO
  • the first antigen is an antigen expressed by stellate cells, myofibroblasts, synovial fibroblasts, epithelial cells, podocytes or immune cells. In some aspects, the first antigen is an antigen expressed by stellate cells, myofibroblasts, synovial fibroblasts, epithelial cells or podocytes. In some aspects, the first antigen is an antigen expressed by stellate cells or myofibroblasts. In some aspects, the first antigen is an antigen expressed by stellate cells, a myofibroblasts or podocytes. In some aspects, the second antigen is an antigen expressed by stellate cells or a myofibroblasts.
  • an isolated nucleic acid that encodes the amino acid sequence of any antibody construct or a portion as described herein.
  • a vector that includes a nucleic acid encoding an antibody construct as described herein.
  • a host cell comprises a vector that includes a nucleic acid encoding an antibody construct as described herein.
  • a host cell that is a mammalian cell.
  • a method of producing a conjugate comprising culturing a host cell so that an antibody construct is produced and then attaching at least one immune-modulatory compounds and a linker to the antibody construct to form a conjugate.
  • a pharmaceutical composition that comprises any conjugate as described herein and a pharmaceutically acceptable carrier.
  • a method of treatment for a subject in need thereof, comprising administering a therapeutically effective dose of a conjugate described herein or a pharmaceutical composition as described herein.
  • the subject has a fibrotic disease, an autoimmune disease or inflammatory disease.
  • the fibrotic disease a fibrotic disease, an autoimmune disease or inflammatory disease.
  • composition or conjugate is administered intravenously, cutaneously, subcutaneously, or injected at a site of affliction. In some aspects, the pharmaceutical composition or conjugate is administered intraveneously. In some aspects, the
  • composition or conjugate is administered subcutaneously.
  • kits comprises a pharmaceutically acceptable dosage unit of a pharmaceutically effective amount of any conjugate described herein or any pharmaceutical composition described herein.
  • FIGURE 1A, FIGURE IB, and FIGURE 1C illustrate several formats of a conjugate comprising an antibody construct, a linker (L), an immune-modulatory compound (CI), a spacer (S), and a second compound (C2).
  • L linker
  • CI immune-modulatory compound
  • S spacer
  • C2 second compound
  • FIGURE 2 shows inhibition of the TGFp/SMAD signaling pathway by an LRRC15 conjugate (LRRC15 antibody attached to a TGFpR inhibitor via a cleavable linker), as compared to the control antibody alone and an anti-digoxin conjugate control.
  • LRRC15 conjugate LRRC15 antibody attached to a TGFpR inhibitor via a cleavable linker
  • FIGURE 3A, FIGURE 3B, and FIGURE 3C show the results of an assay for degradation of TFGpR2 by a TGFpR2-VHL PROTAC anti-HER2 antibody conjugate.
  • FIGURE 4A and FIGURE 4B show the results of an assay for antigen targeted degradation of TGFPR2 by an antibody conjugate with a PROTAC having VHL or Cereblon E3 binding moieties.
  • FIGURE 5A and FIGURE 5B show the results of an assay for cellular levels of TGFpR2 and TGFpRl in the presence of a TGFpR2/TGFpRl-VHL PROTAC with or without the addition of a proteasome inhibitor.
  • Fibrosis can occur in many tissues within the body, typically as a result of inflammation or damage, which include the lungs, liver, kidney, heart, and brain. Scar tissue blocks arteries, immobilizes joints and damages internal organs, wreaking havoc on the body's ability to maintain vital functions.
  • Autoimmune and autoinflammatory diseases can result from an abnormal response of the immune system to a normal part of the body, or a lack of an immune response to, for example, an infection.
  • the immune system can produce auto-antibodies that attack the body's own tissues, instead of fighting infections or foreign invaders.
  • Acute or chronic immune-mediated rejection of a transplanted organ or tissue is another area of unmet need. Transplant rejection is a process in which a transplant recipient's immune system can recognize the transplanted organ or tissue as foreign and can attack the transplanted organ or tissue, leading to failure of the
  • the present disclosure provides antibody construct immune-modulatory compound conjugates (also referred to as “conjugates” or “antibody conjugates”) and pharmaceutical compositions for use in the treatment or prevention of autoimmune disease, autoinflammatory disease, and/or fibrotic disease.
  • the antibody construct immune- modulatory compound conjugates and pharmaceutical compositions are used in the treatment or prevention of fibrotic diseases.
  • the antibody construct immune- modulatory compound conjugates and pharmaceutical compositions are used in the treatment or prevention of autoimmune diseases.
  • the antibody construct immune-modulatory compound conjugates and pharmaceutical compositions are used in the treatment or prevention of autoinflammatory diseases.
  • Challenges to developing targeted drug therapies include achieving high selectivity for the primary pharmacological target and maintaining prolonged target inhibition or modulation of disease while minimizing toxicity.
  • One approach to addressing these two challenges is developing a conjugate that can deliver a drug to a localized area or targeted tissue without interfering with the activity of the conjugated drug.
  • the targeting aspect of the conjugate can further inhibit or modulate fibrotic disease, autoimmune disease, autoinflammatory disease, or transplant rejection.
  • antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive toward, a specific antigen.
  • Antibody can include, for example, polyclonal, monoclonal, genetically engineered, and antigen binding fragments thereof.
  • An antibody can be, for example, murine, chimeric, humanized, heteroconjugate, bispecific, diabody, triabody, or tetrabody.
  • the antigen binding fragment can include, for example, a Fab', F(ab')2, Fab, Fv, rlgG, and scFv.
  • an "antigen binding domain” refers to a region of a molecule that specifically binds to an antigen.
  • An antigen binding domain can be an antigen-binding portion of an antibody or an antibody fragment.
  • An antigen binding domain can be one or more fragments of an antibody that can retain the ability to specifically bind to an antigen.
  • An antigen binding domain can be an antigen binding fragment.
  • an antigen binding domain can recognize a single antigen.
  • An antigen binding domain can recognize, for example, two or three antigens.
  • a "target binding domain” refers to a construct that contains an antigen binding domain from an antibody or from a non-antibody that can bind to the antigen.
  • targeting moiety refers to a structure that has a selective affinity for a target molecule relative to other non-target molecules.
  • the targeting moiety binds to a target molecule.
  • a targeting moiety may include, for example, an antibody, a peptide, a ligand, a receptor, or a binding portion thereof.
  • the target molecule may be an antigen, such as a biological receptor or other structure of a cell.
  • a “linker-payload” or “LP” refers to an immune-modulatory compound(s) attached to a linker.
  • an "Fc domain” can be an Fc domain from an antibody or from a non- antibody that can bind to an Fc receptor.
  • an "Fc null” refers to a domain that exhibits weak to no binding to any of the Fcgamma receptors.
  • an Fc null domain or region exhibits a reduction in binding affinity (e.g., increase in Kd) to Fc gamma receptors of at least 1000- fold.
  • sequence identity refers to the identity between a DNA, RNA, nucleotide, amino acid, or protein sequence to another DNA, RNA, nucleotide, amino acid, or protein sequence, respectively, according to context. Sequence identity can be expressed in terms of a percentage of sequence identity of a first sequence to a second sequence. Percent (%) sequence identity with respect to a reference DNA sequence is the percentage of DNA nucleotides in a candidate sequence that are identical with the DNA nucleotides in the reference DNA sequence after aligning the sequences and introducing gaps, as necessary.
  • Percent (%) sequence identity with respect to a reference amino acid sequence is the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference amino acid sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • L-enantiomeric amino acids are conventional and can be as follows: alanine (A, Ala); arginine (R, Arg); asparagine (N, Asn); aspartic acid (D, Asp); cysteine (C, Cys); glutamic acid (E, Glu); glutamine (Q, Gin); glycine (G, Gly); histidine (H, His); isoleucine (I, He); leucine (L, Leu); lysine (K, Lys); methionine (M, Met); phenylalanine (F, Phe); proline (P, Pro); serine (S, Ser); threonine (T, Thr);
  • X can indicate any amino acid.
  • X can be asparagine (N), glutamine (Q), histidine (H), lysine (K), or arginine (R).
  • salt or “pharmaceutically acceptable salt” refers to salts derived from a variety of organic and inorganic counter ions well known in the art.
  • Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids. Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p- toluenesulfonic acid, salicylic acid, and the like.
  • Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
  • Inorganic bases from which salts can be derived include, for example, sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum, and the like.
  • Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like, specifically such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, and ethanolamine.
  • the pharmaceutically acceptable base addition salt is chosen from ammonium, potassium, sodium, calcium, and magnesium salts.
  • C x-y when used in conjunction with a chemical moiety, such as alkyl, alkenyl, or alkynyl is meant to include groups that contain from x to y carbons in the chain.
  • C x - y alkyl refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched-chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2- trifluoroethyl, etc.
  • C x - y alkenyl and “C x - y alkynyl” refer to substituted or unsubstituted unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double or triple bond respectively.
  • Carbocycle refers to a saturated, unsaturated or aromatic ring in which each atom of the ring is carbon.
  • Carbocycle includes 3- to 10-membered monocyclic rings, 6- to 12-membered bicyclic rings, and 6- to 12-membered bridged rings.
  • Each ring of a bicyclic carbocycle may be selected from saturated, unsaturated, and aromatic rings.
  • an aromatic ring e.g., phenyl
  • a bicyclic carbocycle includes any combination of saturated, unsaturated and aromatic bicyclic rings, as valence permits.
  • a bicyclic carbocycle includes any combination of ring sizes such as 4-5 fused ring systems, 5-5 fused ring systems, 5-6 fused ring systems, and 6-6 fused ring systems.
  • Exemplary carbocycles include cyclopentyl, cyclohexyl, cyclohexenyl, adamantyl, phenyl, indanyl, and naphthyl.
  • heterocycle refers to a saturated, unsaturated or aromatic ring comprising one or more heteroatoms.
  • exemplary heteroatoms include N, O, Si, P, B, and S atoms.
  • Heterocycles include 3- to 10-membered monocyclic rings, 6- to 12-membered bicyclic rings, and 6- to 12-membered bridged rings.
  • a bicyclic heterocycle includes any combination of saturated, unsaturated and aromatic bicyclic rings, as valence permits.
  • an aromatic ring e.g., pyridyl
  • a saturated or unsaturated ring e.g., cyclohexane, cyclopentane, morpholine, piperidine or cyclohexene.
  • a bicyclic heterocycle includes any combination of ring sizes such as 4-5 fused ring systems, 5- 5 fused ring systems, 5-6 fused ring systems, and 6-6 fused ring systems.
  • heteroaryl includes aromatic single ring structures, preferably 5- to 7- membered rings, more preferably 5- to 6-membered rings, whose ring structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms.
  • heteroaryl also include polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings can be aromatic or non- aromatic carbocyclic, or heterocyclic.
  • Heteroaryl groups include, for example, pyrrole, furan, thiophene, imidazole, oxazole, thiazole, pyrazole, pyridine, pyrazine, pyridazine, and pyrimidine, and the like.
  • substituted refers to moieties having substituents replacing a hydrogen on one or more carbons or substitutable heteroatoms, e.g., an NH or N3 ⁇ 4 of a compound. It will be understood that “substitution” or “substituted with” includes the implicit proviso that such substitution is in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, i.e., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc.
  • substituted refers to moieties having substituents replacing two hydrogen atoms on the same carbon atom, such as substituting the two hydrogen atoms on a single carbon with an oxo, imino or thioxo group.
  • substituted is contemplated to include all permissible substituents of organic compounds.
  • the permissible substituents include acyclic and cyclic, branched and unbranched, carbocyclic and heterocyclic, aromatic and non-aromatic substituents of organic compounds.
  • the permissible substituents can be one or more and the same or different for appropriate organic compounds.
  • a "tautomer” refers to a molecule wherein a proton shift from one atom of a molecule to another atom of the same molecule is possible.
  • the compounds disclosed herein are used in different enriched isotopic forms, e.g., enriched in the content of 2 H, 3 H, 11 C, 13 C and/or 14 C.
  • the compound is deuterated in at least one position.
  • deuterated forms can be made by the procedure described in U.S. Patent Nos. 5,846,514 and 6,334,997.
  • deuteration can improve the metabolic stability and or efficacy, thus increasing the duration of action of drugs.
  • structures depicted herein are intended to include compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of the present disclosure.
  • the compounds of the present disclosure optionally contain unnatural proportions of atomic isotopes at one or more atoms that constitute such compounds.
  • the compounds may be labeled with isotopes, such as for example, deuterium ( 2 H), tritium ( 3 H), iodine- 125 ( 125 I) or carbon- 14 ( 14 C).
  • the compounds disclosed herein have some or all of the 1H atoms replaced with H atoms.
  • Deuterium substituted compounds are synthesized using various methods such as described in: Dean, Dennis C; Editor. Recent Advances in the Synthesis and Applications of Radiolabeled Compounds for Drug Discovery and Development. [In: Curr., Pharm. Des., 2000; 6(10)] 2000, 110 pp; George W.; Varma, Rajender S. The Synthesis of Radiolabeled Compounds via Organometallic Intermediates, Tetrahedron, 1989, 45(21), 6601-21; and Evans, E. Anthony. Synthesis of radiolabeled compounds, J. Radioanal. Chem., 1981, 64(1- 2), 9-32.
  • Deuterated starting materials are readily available and are subjected to the synthetic methods described herein to provide for the synthesis of deuterium-containing compounds. Large numbers of deuterium-containing reagents and building blocks are available
  • Compounds useful in the present invention also include crystalline and amorphous forms of those compounds, pharmaceutically acceptable salts, and active metabolites of these compounds having the same type of activity, including, for example, polymorphs,
  • pseudopolymorphs solvates, hydrates, unsolvated polymorphs (including anhydrates), conformational polymorphs, and amorphous forms of the compounds, as well as mixtures thereof.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.
  • phrases "pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • phrases "pharmaceutically acceptable excipient” or “pharmaceutically acceptable carrier” as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material. Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide;
  • attached refers to a bond, i.e., a covalent bond, between two or more groups.
  • attached may refer to the association of two or more groups via a linker, e.g., a linker binding an antigen binding domain to an Fc domain to form an antibody construct.
  • a fusion may refer to a nucleic acid sequence of two separate domains being expressed in frame.
  • a binding domain can be attached as a fusion or by conjugation via a linker to form an antibody construct.
  • a portion of an antibody construct can be fused with a second binding domain to create an antibody construct comprising the second binding domain as a fusion protein.
  • the fusion protein can be the result of the nucleic acid sequence encoding the second binding domain being expressed in frame with the nucleic acid sequence encoding the rest of the antibody construct.
  • the fusion protein can be the result of an in-frame genetic nucleotide sequence encoding the antibody construct with the binding domain or a contiguous protein sequence linking the portion of the antibody construct with the binding domain.
  • a second binding domain can be attached to an antibody construct via a linker, wherein the linker is attached (e.g., conjugated) to the binding domain and the linker is attached (e.g., conjugated) to the rest of the antibody construct.
  • the binding domain can be linked to the linker by a chemical conjugation and the remainder of the antibody construct can be linked to the linker by a chemical conjugation.
  • the binding domain can be a second binding domain and/or a third binding domain as described herein.
  • a binding domain can be a first antigen binding domain attached to an Fc domain to produce the antibody construct as described herein, which may produce the first antigen binding domain as a fusion with the Fc domain wherein the first antigen binding domain can be linked to a linker and the linker can be linked to the Fc domain.
  • an "immune-modulatory compound” may refer to a small molecule, or an entity that binds to a target.
  • An immune-modulatory compound may be an entity that can bind to a target and may activate the target's function, or an entity that binds to a target and can inhibit the target's function.
  • a target may be a protein target.
  • the inhibition of a protein target's function may be a result of an increase ubiquitin- mediated degradation.
  • the ubiquitin-mediated degradation may be ubiquitin-mediated degradation of the protein target.
  • the immune-modulatory compound may decrease inflammation, decrease an immune response, decrease fibrosis, or any combination thereof.
  • antibody constructs that may be used together with immune- modulatory compounds in conjugates.
  • immune-modulatory compounds of the disclosure are attached (e.g., conjugated) either directly or through a linker group to an immune-modulatory compound forming antibody conjugates.
  • antibody conjugates are represented by the following formula:
  • A is an antibody construct
  • L is a linker
  • D is one or more immune-modulatory compounds, e.g., 1, 2, 3, or 4 compounds
  • n is from 1 to 20.
  • n is from 1 to 10, such as from 1 to 9, such as from 1 to 8, such as from 2 to 8, such as from 1 to 6, such as from 3-5 or such as about 2.
  • n is 4.
  • n is an average.
  • antibody constructs that may be used together with immune- modulatory compounds as disclosed herein.
  • immune-modulatory compounds are attached either directly or through a linker group to an antibody construct of the disclosure forming antibody conjugates.
  • antibody conjugates may be represented by the following formula:
  • ⁇ A> is an antibody construct
  • L is a linker
  • D is an immune-modulatory compound
  • x may be from 1 to 20 (wherein each such x denotes a different immune-modulatory compound)
  • n may be from 1-20 and z may be from 1 to 20.
  • x may be 1, n may be 1 and z may be from 1 to 10, such as from 1 to 9, such as from 1 to 8, such as from 2 to 8, such as from 1 to 6, such as from 3-5 or such as about 2. In certain embodiments, z may be 4.
  • D may be an immune-modulatory compound (IMC)
  • x may be from 1-20
  • n may be from 1 to 20
  • z may be from 1 to 20.
  • antibody conjugates may be represented by the following formula:
  • ⁇ A is an antibody construct
  • L is a linker
  • S is a spacer
  • D is an immune- modulatory compound
  • x may be from 1 to 20 (wherein each x denotes a distinct immune- modulatory compound)
  • n may be from 1 to 20
  • w may be from 1 to 20
  • y may be from 1 to 20
  • z may be from 1 to 20.
  • x may be 1, n is 2, y may be 1 and z may be from 1 to 10, such as from 1 to 9, such as from 1 to 8, such as from 2 to 8, such as from 1 to 6, such as from 3 to 5 or such as 2. In certain embodiments, z may be 4.
  • D may be an immune-modulatory compound (IMC), x may be from 1-20, n may be from 1-20, w may be from 1 to 20, y may be from 1 to 20, and z may be from 1 to 20.
  • D may be a proteolysis targeting chimera (PROTAC) which may comprise an immune-modulatory compound (IMC) that may be covalently attached to an E3 ubiquitin ligase binding moiety (ULM) through a spacer (S) and where linker (L) may be covalently attached to spacer (S), n may be from 1 to 20 and z may be from 1 to 20 as represented by the formula:
  • D may be a proteolysis targeting chimera (PROTAC) which may comprise an immune-modulatory compound (IMC) that may be covalently attached to an E3 ubiquitin ligase binding moiety (ULM) through a spacer (S) and where linker (L) may be covalently attached to the immune-modulatory compound (IMC), n may be from 1 to 20 and z may be from 1 to 20 as represented by the formula:
  • D may be a proteolysis targeting chimera (PROTAC) which may comprise an immune-modulatory compound (IMC) that may be covalently attached to an E3 ubiquitin ligase binding moiety (ULM) through a spacer (S) and where linker L may be covalently attached to the ubiquitin E3 ligase moiety (ULM), n may be from 1 to 20 and z may be from 1 to 20 as represented by the formula:
  • PROTAC proteolysis targeting chimera
  • IMC immune-modulatory compound
  • ULM E3 ubiquitin ligase binding moiety
  • S spacer
  • linker L may be covalently attached to the ubiquitin E3 ligase moiety
  • n may be from 1 to 20
  • z may be from 1 to 20 as represented by the formula:
  • immune-modulatory compounds are conjugated either directly or through a linker group to an antibody construct forming antibody conjugates
  • conjugates may take the form of any conjugate as disclosed in US Patent No.
  • potency generally may be measured bioactivity and may be quantified as an EC50 or IC50. Potency may refer to the amount of a conjugate or compound needed to give an effect. For example, a potency of an immune-modulatory compound which requires a lower amount of the immune-modulatory compound to achieve an effect compared with a different immune-modulatory compound can be considered to have greater potency. Furthermore, the different immune-modulatory compound requires a greater amount of the different immune-modulatory compound to generate a response, and can therefore be considered lower potency.
  • Potencies of bioactive compositions may be measured over a concentration range and can be reported as those molar concentrations required to elicit or inhibit a percentage of the measured bioresponse. For example, a concentration required to stimulate 50% of observed maximal activity in the assay may be reported as an effective concentration 50 (EC50), to stimulate 90% activity as an EC90, or to stimulate 10% activity as an EC 10. For example, a concentration of an antagonist required to give 50% maximal inhibition of a biological activity may be reported as an inhibitory concentration 50 (IC50), to inhibit 90% as an IC90, or to inhibit 10% as an IC10. This may allow for a comparison of the potencies of bioactive compounds on a molar basis by comparison of their EC or IC values for a given bioassay.
  • EC50 effective concentration 50
  • IC50 inhibitory concentration 50
  • an immune- modulatory compound with an EC50 or IC50 that is greater than 300 times or more the EC50 ot IC50 of a control requires 300-fold higher, or more than 300-fold higher, concentration compared to the control to achieve a 50% bioresponse and has a potency weaker than the control by at least 300-fold.
  • an immune-modulatory compound that has an EC50 or IC50 not greater than about 300 times the EC50 or IC50 of a control compound may require no more than a 300-fold higher concentration than the control compound to achieve a 50% maximal bioresponse, no greater than 100 times the EC50 or IC50 requires no more than 100-fold higher concentration and no greater than 10 times the EC50 or IC50 requires no more than 10 times the concentration of the control.
  • the potency of the immune-modulatory compound may be within 300-fold or better, 100-fold or better, or 10-fold or better the potency of the control.
  • control compound refers to the immune-modulatory compound before linker attachment and antibody conjugation or, in the case of conjugates including an E3 ubiquitin ligase binding moiety, control compound refers to the a) immune-modulatory compound attached to b) the second linker that is attached to c) the E3 ubiquitin ligase moiety.
  • the potency or protein binding of an immune-modulatory compound in the conjugate may be retained or increased.
  • the IQ for the protein target of the immune-modulatory compound as a conjugate is no greater than 100-fold, 25- fold, 10-fold, or 2-fold the control compound.
  • the EC50 or IC50 of the immune-modulatory compound as a conjugate is no greater than 300-fold, 50-fold, 10-fold, or 2-fold of the control compound. In some embodiments, the EC50 or IC50 is equal to or lower than the control compound indicating increased potency of immune-modulation by the conjugate.
  • An antibody construct of the disclosure may contain, for example, two, three, four, five, six, seven, eight, nine, ten, or more antigen binding domains.
  • An antibody construct may contain two antigen binding domains in which each antigen binding domain can recognize the same antigen.
  • An antibody construct may contain two antigen binding domains in which each antigen binding domain can recognize different antigens.
  • An antigen binding domain may be in a scaffold, in which a scaffold is a supporting framework for the antigen binding domain.
  • An antigen binding domain may be in a non-antibody scaffold.
  • An antigen binding domain may be in an antibody scaffold.
  • An antibody construct may comprise an antigen binding domain in a scaffold.
  • the antibody construct may comprise a Fc fusion protein product.
  • the antibody construct is a Fc fusion protein product.
  • An antigen binding domain may specifically bind to an antigen associated with fibrotic disease, autoimmune disease, or autoinflammatory disease.
  • An antigen binding domain may specifically bind to an antigen that is at least 80%, at least 90%, at least 95%, at least 99%, or 100% identical to an antigen associated with fibrotic disease, autoimmune disease, or autoinflammatory disease.
  • An antigen binding domain may specifically bind to an antigen on an antigen presenting cell.
  • An antigen binding domain may specifically bind to an antigen that is at least 80%, at least 90%, at least 95%, at least 99%, or 100% identical to an antigen on an antigen presenting cell.
  • An antigen binding domain may specifically bind to an antigen on a T cell.
  • An antigen binding domain may specifically bind to an antigen that is at least 80%, at least 90%, at least 95%, at least 99%, or 100% identical to an antigen on a T cell.
  • a conjugate described herein can contain, for example, an immune-modulatory compound, an antibody construct, and a linker attaching the antibody construct to the immune-modulatory compound.
  • the antibody construct of the conjugate can contain, for example, a first antigen binding domain and an Fc domain, where the first antigen binding domain binds to a first antigen.
  • the first antigen can have about 50%, about 60%, about 70%, about 80%, or about 90% or about 100% sequence identity to, for example, Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin a2bl, MADCAM, Nephrin, Podocin, IFNARl, BDCA, CD30, c-KIT, FAP, CD73, CD38, PDGFRB, Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ 6, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, or CD25.
  • the first antigen is selected from Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNARl, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ 6, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, LRRC15, and
  • the first antigen is selected from Cadherin 11, PDPN, LRRC15, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ 1, MADCAM, Nephrin, Podocin, IFNARl, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, Integrin ⁇ 8, GARP, Endosialin, CTGF, Integrin ⁇ 6, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, MMP14, GPX8, and F2RL2.
  • the first antigen is selected from Cadherin 11, FAP, TNFR2, or LRRC15.
  • the first antigen is selected from LRRC15, FAP, Cadherin 11, and TNFR2.
  • the first antigen binding domain specifically binds to an antigen that is at least 80% identical to an antigen on an immune cell, such as a T cell, a B cell and an APC, a stellate cell, an endothelial cell,an epithelial cell, a tumor cell, a fibroblast cell, a fibrocyte cell, a podocyte, a myofibroblast, a synovial fibroblast, or other cell associated with the pathogenesis of fibrosis.
  • the first antigen binding domain specifically binds to an antigen that is at least 80% identical to an antigen on a T cell, an APC, and/or a B cell.
  • the first antigen binding domain may specifically bind to an antigen that is at least 80% identical to an antigen selected from the group consisting of PD-1, GARP, CD25, PD-Ll, or TNFR2. In certain embodiments, the first antigen binding domain specifically binds to an antigen that is at least 80% identical to an antigen on a stellate cell, an endothelial cell, a fibroblast cell, a fibrocyte cell, a
  • the first antigen binding domain may specifically bind to an antigen that is at least 80% identical to an antigen selected from the group consisting of PDGFRp, integrin ⁇ , integrin ⁇ 3, integrin ⁇ , integrin ⁇ 8, Endosialin, FAP, ADAM 12, LRRC15, MMP14, PDPN, CDHl l and F2RL2.
  • the first antigen binding domain may specifically bind to an antigen that is at least 80% identical to an antigen selected from the group consisting of FAP, ADAM 12, LRRC15, MMP14, PDPN, CDHl l, and F2RL2.
  • the first antigen binding domain specifically binds to an antigen on a T cell, a B cell, a stellate cell, an endothelial cell, a tumor cell, an APC, a fibroblast cell, a fibrocyte cell, a myofibroblast, a synovial fibroblast, a podocyte or other cell associated with the pathogenesis of fibrosis.
  • the first antigen binding domain specifically binds to an antigen on a T cell, an APC, and/or a B cell.
  • the first antigen binding domain may specifically bind to an antigen selected from the group consisting of PD-1, GARP, CD25, PD-L1, or TNFR2.
  • the first antigen binding domain specifically binds to an antigen on a stellate cell, an endothelial cell, a fibroblast cell, a fibrocyte cell, a myofibroblast, a synovial fibroblast, a podocyte or a cell associated with the pathogenesis of fibrosis.
  • the first antigen binding domain may specifically bind to an antigen selected from the group consisting of PDGFR ⁇ , integrin ⁇ , integrin ⁇ 3, integrin ⁇ , integrin ⁇ 8, Endosialin, FAP, ADAM 12, LRRC15, MMP14, PDPN, CDHl l and F2RL2.
  • the first antigen binding domain specifically binds to an antigen selected from the group consisting of FAP, ADAM 12, LRRC15, MMP14, PDPN, CDHl l, and F2RL2.
  • a binding domain of an antibody construct can bind to not only a particular amino acid sequence on an antigen, but also exhibit specificity for particular protein complexes, protein conformations, protein conformers, post-transcriptional modifications, or post- translational modifications.
  • the antigen of a binding domain of the conjugate can comprise a splice junction, a protein complex, a protein conformer or a post-translational modification.
  • a non- limiting example of a splice variant antigen that can be specifically recognized by a binding domain is a binding domain for the EGFRviii slice variant.
  • binding domains for specific antigens generated by a post- translational modification or protein conformer can be a binding domain for a splice variant of CD45RB or CD45RO.
  • a non-limiting example of a binding domain that can bind to a protein complex can be a binding domain that can bind to specific integrin pair, such as ⁇ .
  • the binding domain can bind tightly to ⁇ , but weakly or not at all to the individual subunits or one subunit paired with a different subunit.
  • Some additional non- limiting examples of these types of binding domains can include an anti-CD45RB antibody, an anti-CD45RO antibody, an anti- ⁇ antibody, and an anti- ⁇ antibody.
  • An antigen may be PDCDl.
  • the PDCDl gene encodes programmed cell death protein 1, also known as PD-1 and CD279 (cluster of differentiation 279), which is a cell surface receptor that plays a cell surface receptor that plays an important role in down-regulating the immune system and promoting self-tolerance by suppressing T cell inflammatory activity.
  • PD-1 is a cell surface receptor that belongs to the immunoglobulin superfamily and is expressed on T cells and pro-B cells.
  • PD-1 is an immune checkpoint and guards against autoimmunity through a dual mechanism of promoting apoptosis (programmed cell death) in antigen specific T-cells in lymph nodes while simultaneously reducing apoptosis in regulatory T cells (anti-inflammatory, suppressive T cells).
  • An antigen may be TNFRSF4.
  • the TNFRSF4 gene encodes OX40, also known as TNFRSF4 (tumor necrosis factor receptor superfamily, member 4), a member of the TNFR- superfamily of receptors which is not constitutively expressed on resting naive T cells, unlike CD28.
  • OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is expressed following their activation. Expression of OX40 is dependent on full activation of the T cell; without CD28, expression of OX40 is delayed and of fourfold lower levels.
  • An antigen may be CD27.
  • CD27 is a member of the tumor necrosis factor receptor superfamily.
  • the protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and
  • This receptor transduces signals that lead to the activation of NF- KB and MAPK8/JNK.
  • Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor.
  • CD27-binding protein (SIVA) a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
  • An antigen may be IL2RA.
  • the IL2RA gene encodes CD25, also known as IL2RA (interleukin-2 receptor alpha chain), which is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and
  • IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, mastocytosis and tumor infiltrating lymphocytes. It functions as the receptor for HTLV-1 and is consequently expressed on neoplastic cells in adult T cell lymphoma/leukemia. Its soluble form, called sIL-2R may be elevated in these diseases and is occasionally used to track disease progression.
  • An antigen may be TNFRSF18.
  • the TNFRSF18 gene encodes GITR (glucocorticoid- induced TNFR-related protein), also known as TNFRSF18 (tumor necrosis factor receptor superfamily member 18) and AITR (activation- inducible TNFR family receptor), which is a protein that is a member of the tumor necrosis factor receptor (TNF-R) superfamily.
  • GITR glucocorticoid-induced tumor necrosis factor receptor
  • TNF-R tumor necrosis factor receptor
  • An antigen may be LAG-3.
  • the LAG-3 (lymphocyte-activation gene 3) gene encodes a cell surface molecule with diverse biologic effects on T cell function.
  • LAG-3 is an immune checkpoint receptor.
  • the LAG3 protein which belongs to immunoglobulin (Ig) superfamily, comprises a 503-amino acid type I transmembrane protein with four extracellular Ig-like domains, designated Dl to D4. LAG-3 is expressed on activated T cells, natural killer cells, B cells and plasmacytoid dendritic cells.
  • An antigen may be GARP.
  • GARP glycoprotein A repetitions predominant
  • An antigen may be 4- IBB.
  • 4- IBB is a type 2 transmembrane glycoprotein belonging to the TNF superfamily, expressed on activated T Lymphocytes.
  • 4- IBB can be expressed by activated T cells.
  • 4- IBB expression can be found on dendritic cells, B cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation.
  • An antigen may be ICOS.
  • the ICOS (Inducible T-cell COStimulator) gene encodes a CD28-superfamily costimulatory molecule that is expressed on activated T cells.
  • the protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family.
  • ICOS forms homodimers and plays an important role in cell-cell signaling, immune responses and regulation of cell proliferation.
  • An antigen may be CD70.
  • CD70 is expressed on highly activated lymphocytes, such as in T- and B-cell lymphomas.
  • CD70 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes.
  • CD70 induces proliferation of co- stimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin synthesis.
  • An antigen may be PDGFRp.
  • the PDGFRP beta-type platelet-derived growth factor receptor
  • the PDGFRP encodes a typical receptor tyrosine kinase, which is a transmembrane protein consisting of an extracellular ligand binding domain, a transmembrane domain and an intracellular tyrosine kinase domain.
  • PDGFRP protein is approximately 180 kDA.
  • An antigen may be CD73.
  • CD73 cluster of differentiation 73
  • ecto-5'- nucleotidase ecto-5'-NT, EC 3.1.3.5
  • GPI glycosyl-phosphatidylinositol
  • CD73 commonly serves to convert AMP to adenosine.
  • Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP.
  • the enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation.
  • An antigen may be CD38.
  • CD38 cluster of differentiation 38
  • cyclic ADP ribose hydrolase is a glycoprotein found on the surface of many immune cells (white blood cells), including CD4 + , CD8 + , B lymphocytes, and natural killer cells.
  • CD38 also functions in cell adhesion, signal transduction and calcium signaling. The loss of CD38 function is associated with impaired immune responses, metabolic disturbances, and behavioral modifications including social amnesia possibly related to autism.
  • the CD38 protein is a marker of cell activation. It has been connected to HIV infection, leukemias, myelomas, solid tumors, type II diabetes mellitus and bone metabolism, as well as some genetically determined conditions. CD38 produces an enzyme which regulates the release of oxytocin within the central nervous system.
  • Integrin ⁇ 3 is a type of integrin that is a receptor for vitronectin. Integrin ⁇ 3 consists of two components, integrin alpha V and integrin beta 3 (CD61), and is expressed by platelets. Integrin ⁇ 3 is a receptor for phagocytosis on macrophages or dendritic cells.
  • An antigen may be Integrin ⁇ 8.
  • Integrin ⁇ 8 a VN receptor, is identified as a potential negative regulator of cell growth.
  • the cytoplasmic domain of ⁇ 8 is divergent in sequence, lacking all amino acid sequence identity with the highly homologous cytoplasmic domains of the other av-associating integrin ⁇ subunits ( ⁇ , ⁇ 3, ⁇ 5, and ⁇ 6).
  • the ⁇ 8 cytoplasmic domain is divergent in function. ⁇ 8 has a restricted distribution and is most highly expressed in nonproliferating cell types.
  • An antigen may be CD248.
  • the CD248 gene encodes endosialin.
  • Endosialin is a member of the "Group XIV", a novel family of C-type lectin transmembrane receptors which play a role not only in cell-cell adhesion processes but also in host defense. Endosialin has been associated with angiogenesis in the embryo, uterus and in tumor development and growth.
  • An antigen may be FAP.
  • FAP fibroblast activation protein alpha
  • FAP gene a 170 kDa melanoma membrane-bound gelatinase protein that in humans is encoded by the FAP gene.
  • the protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis.
  • An antigen may be LRRC15.
  • LRRC15 also known as Leucine Rich Repeat Containing 15 or LIB, is a single pass type 1 membrane protein.
  • ADAM12 is a disintegrin and metallopro tease. It is reported to be involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is interacts with alpha-actinin-2 and with syndecans and with RACK1 ; this interaction is required for PKC-dependent translocation of ADAM12 to the cell membrane.
  • An antigen may be MMP14.
  • MMP14 is an endopeptidase that degrades various components of the extracellular matrix such as collagen. It activates progelatinase A.
  • MMP14 may be involved in actin cytoskeleton reorganization by cleaving PTK7. MMP14 acts as a positive regulator of cell growth and migration via activation of MMP15, and is involved in the formation of the fibrovascular tissues in association with pro-MMP2.
  • An antigen may be F2RL2.
  • F2RL2 is a receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
  • An antigen may be Integrin av. Integrin av subunit associates with one of five integrin ⁇ subunits, ⁇ , ⁇ 3, ⁇ 5, ⁇ 6, or ⁇ 8, to form five distinct ⁇ heterodimers.
  • the integrin ⁇ heterodimers on the cell surface interact with cell adhesive proteins, such as collagen, fibrinogen, fibronectin, and vitronectin. These interactions play an important role in cell adhesion or migration, especially in tumor metastasis.
  • An antigen may be Integrin ⁇ .
  • Integrin ⁇ is an epithelial- specific integrin that is a receptor for the extracellular matrix (ECM) proteins fibronectin, vitronectin, tenascin and the latency associated peptide (LAP) of TGF- ⁇ . Integrin ⁇ is not expressed in healthy adult epithelia but is upregulated during wound healing and in cancer. Integrin ⁇ has been shown to modulate invasion, inhibit apoptosis, regulate the expression of matrix
  • ECM extracellular matrix
  • LAP latency associated peptide
  • MMPs metalloproteases
  • An antigen may be Cadherin 11.
  • Cadherin 11 is a type II classical cadherin from the cadherin superfamily, which are integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane- spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherin 11 is expressed in osteoblastic cell lines, and is upregulated during osteoblast differentiation.
  • An antigen may be PDPN.
  • PDPN podoplanin
  • the physiological function of PDPN can be related to its mucin-type character.
  • spliced transcript variants encoding different iso forms have been identified.
  • An antigen may be MADCAM.
  • MADCAM macosal vascular addressin cell adhesion molecule is an endothelial cell adhesion molecule that interacts with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin and VLA-4 (alpha4betal) on myeloid cells to direct leukocytes into mucosal and inflamed tissues.
  • MADCAM is a member of the immunoglobulin family.
  • An antigen may be Nephrin.
  • Nephrin is a member of the immunoglobulin family of cell adhesion molecules, which function in the glomerular filtration barrier in the kidney. Nephrin is expressed in renal tissues, and the protein is a type-1 transmembrane protein found at the slit diaphragm of glomerular podocytes. The slit diaphragm is an ultrafilter that can exclude albumin and other plasma macromolecules in the formation of urine. Mutations in the gene encoding nephrin can result in Finnish-type congenital nephrosis 1, characterized by severe proteinuria and loss of the slit diaphragm and foot processes.
  • An antigen may be Podocin.
  • Podocin (NPHS2) is a protein that can regulate of glomerular permeability. Mutations in the gene encoding for podocin can cause steroid- resistant nephrotic syndrome.
  • An antigen may be IFNAR1.
  • IFNAR1 Interferon Alpha And Beta Receptor Subunit 1
  • IFNARl is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of IFNARl stimulates Janus protein kinases, which in turn phosphory late several proteins, including STAT1 and STAT2. IFNARl can also function as an antiviral factor.
  • An antigen may be BDCA2.
  • BDCA2 Interferon Alpha And Beta Receptor Subunit 1 is a type II C-type lectin receptor selectively expressed on plasmacytoid dendritic cells (PDCs), where it is involved in antigen capture and in regulation of the production of interferon type I.
  • PDCs plasmacytoid dendritic cells
  • An antigen may be CD30.
  • CD30 (TNF Receptor Superfamily Member 8) is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with CD30 and mediate the signal transduction that leads to the activation of NF-kappaB.
  • CD30 is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of the gene encoding CD30 have been reporting leading to the translation of distinct isoforms of CD30.
  • An antigen may be c-KIT.
  • c-KIT KIT Proto- Oncogene Receptor Tyrosine
  • kinase/CDl 17 is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in the gene encoding for c-KIT are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for the gene encoding c-KIT.
  • An antigen may be CTGF.
  • CTGF Connective Tissue Growth Factor
  • CTGF is a mitogen that is secreted by vascular endothelial cells.
  • CTGF plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in the gene encoding CTGF have been linked with a higher incidence of systemic sclerosis.
  • An antigen may be CD40.
  • Cluster of Differentiation 40 (CD40) is a member of the Tumor Necrosis Factor Receptor (TNF-R) family.
  • CD40 can be a 50 kDa cell surface glycoprotein that can be constitutively expressed in normal cells, such as monocytes, macrophages, B lymphocytes, dendritic cells, endothelial cells, smooth muscle cells, fibroblasts and epithelium, and in tumor cells, including B-cell lymphomas and many types of solid tumors.
  • Expression of CD40 can be increased in antigen presenting cells in response to IL- ⁇ , IFN- ⁇ , GM-CSF, and LPS induced signaling events.
  • An antigen may be TIM-3.
  • TIM-3 T-cell immunoglobulin and mucin-domain containing-3) can function as a T-cell inhibitory receptor. Galectin-9 triggering of Tim-3 can induce cell death in Tim-3+ Thl cells and ameliorate experimental autoimmune encephalomyelitis. Tim-3 can also be required for the induction of tolerance, as both Tim-3- deficient mice and mice treated with a Tim-3-Ig fusion protein exhibit defects in the induction of antigen- specific tolerance. Overall, TIM-3 is an immune checkpoint receptor that functions specifically to limit the duration and magnitude of Thl and Tel T-cell responses.
  • TNFR2 tumor necrosis factor receptor 2
  • TNFRSFIB tumor necrosis factor receptor super family IB
  • CD 120b CD 120b
  • soluble TNFR2 can be generated via two distinct mechanisms: (1) shedding via proteolytic processing of the full membrane anchored from, and (2) translation from an alternatively spliced message encoding the extracellular domains of TNFR2.
  • TNFR2 is the receptor with high affinity for TNF-alpha and approximately 5-fold lower affinity for homotrimeric lymphotoxin-alpha.
  • TNFR2 Tumor Necrosis Factor Receptor Type II
  • TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAPl and C-IAP2, which possess E3 ubiquitin ligase activity.
  • c-IAPl can potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals.
  • Knockout studies in mice suggest a role of TNFR2 in protecting neurons from apoptosis by stimulating antioxidative pathways.
  • An antigen may be DEC205.
  • DEC205 is a type I cell surface protein expressed primarily by dendritic cells. DEC205 is found on interdigitating dendritic cells in T-cell areas of lymphoid tissues, bone marrow-derived DC, Langerhan's cells, and at low levels on macrophages and T cells. DEC205 can be upregulated during the maturation of dendritic cells. DEC-205 has also been shown to be expressed at moderate levels by B cells and can be upregulated during the pre-B cell to B cell transition. Structurally, the DEC205 family is characterized by a cysteine rich N-terminal domain followed by a fibronectin type II domain and multiple carbohydrate recognition domains (CRDs). DEC-205 has ten CRDs. The single transmembrane domain is followed by a short cytoplasmic tail.
  • An antigen may be DCIR.
  • DCIR Densiclear cell immunoreceptor/CLEC4A
  • CTL/CTLD C-type lectin-like domain
  • DCIR can have diverse functions such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response.
  • the encoded type 2 transmembrane protein can play a role in inflammatory and immune response.
  • Multiple transcript variants encoding distinct isoforms have been identified for the gene encoding DCIR.
  • An antigen may be CD86.
  • CD86 Cluster of Differentiation 86
  • CD86 Cluster of Differentiation 86
  • CD86 is a type I membrane protein that is a member of the immunoglobulin superfamily.
  • CD86 is expressed by antigen- presenting cells, and is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4.
  • Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 protein with cytotoxic T- lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.
  • An antigen may be CD45RB or CD45RB/RO.
  • CD45RB is an isoform of CD45 with exon 5 splicing.
  • CD45RB is a 220 kD glycoprotein expressed on peripheral B cells, naive T cells, thymocytes, macrophages, and dendritic cells.
  • CD45RB can play a role in TCR and BCR signaling.
  • T cells become activated and progress from naive to memory cells, CD45RB expression is downregulated.
  • functionally distinct CD4+ T cell subsets, which secrete differing cytokine profiles, can be separated by CD45RB intensity.
  • the primary ligands for CD45 are galectin-1, CD2, CD3, CD4, and Thy-1.
  • CD45RO is the antigenic isoform expressed on effector or memory T cells as they downregulate the CD45A and CD45B isoforms.
  • An antigen binding domain of an antibody may comprise one or more light chain (L) CDRs and one or more heavy chain (H) CDRs.
  • an antibody binding domain of an antibody may comprise one or more of the following: a light chain complementary determining region 1 (LCDR1), a light chain complementary determining region 2 (LCDR2), or a light chain complementary determining region 3 (LCDR3).
  • an antibody binding domain may comprise one or more of the following: a heavy chain complementary determining region 1 (HCDR1), a heavy chain complementary determining region 2 (HCDR2), or a heavy chain complementary determining region 3 (HCDR3).
  • an antibody binding domain of an antibody may comprise one or more of the following: LCDR1, LCDR2, LCDR3, HCDR1, HCDR2, and HCDR3.
  • an antibody binding domain of an antibody may comprise all six of the following: LCDR1, LCDR2, LCDR3, HCDR1, HCDR2, and HCDR3.
  • the antigen binding domain of an antibody construct may be selected from any domain that specifically binds to the antigen including, but not limited to, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional (antigen binding) fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), or may be a DARPin, an affimer, an avimer, a knottin, a mo nobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an
  • immunocytokine a T cell receptor, a bicyclic peptide, a fynomer, or a recombinant T cell receptor.
  • the antigen binding domain of an antibody construct may be at least 80% identical to a particular antigen binding domain that binds to an antigen, where the antigen binding domain is selected from, but not limited to, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), or may be a DARPin, an affimer, an avimer, a knottin, a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, a T cell receptor, a bicyclic peptide, a fynomer, an anticalin, a VNAR, or a recombinant T cell receptor.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • DARPin an affimer
  • an antibody construct comprises an Fc region comprising an Fc domain, in which the Fc domain may be the part of the Fc region that interacts with Fc receptors.
  • the Fc domain of an antibody construct may interact with Fc-receptors (FcRs) found on immune cells.
  • FcRs Fc-receptors
  • the Fc domain may also mediate the interaction between effector molecules and cells, which can lead to activation of the immune system.
  • the Fc region may be derived from IgG, IgA, or IgD antibody isotypes, and may comprise two identical protein fragments, which are derived from the second and third constant domains of the antibody's heavy chains.
  • the Fc region may comprise a highly-conserved N-glycosylation site, which may be essential for FcR-mediated downstream effects.
  • the Fc region may be derived from IgM or IgE antibody isotypes, in which the Fc region may comprise three heavy chain constant domains.
  • Fc domain may interact with different types of FcRs.
  • the different types of FcRs may include, for example, FcyRI, FcyRI, FcyRIIA, FcyRIIB, FcyRIIIA, FcyRIIIB, FcaRI, Fc ⁇ R, FcsRI, FcsRII, and FcRn.
  • FcRs may be located on the membrane of certain immune cells including, for example, B lymphocytes, natural killer cells, macrophages, neutrophils, follicular dendritic cells, eosinophils, basophils, platelets, and mast cells.
  • the FcR may initiate functions including, for example, clearance of an antigen-antibody complex via receptor-mediated endocytosis, antibody-dependent cell- mediated cytotoxicity (ADCC), antibody dependent cell-mediated phagocytosis (ADCP), and ligand-triggered transmission of signals across the plasma membrane that can result in alterations in secretion, exocytosis, and cellular metabolism.
  • FcRs may deliver signals when FcRs are aggregated by antibodies and multivalent antigens at the cell surface.
  • ITAMs immunoreceptor tyro sine-based activation motifs
  • SRC family tyrosine kinases may sequentially activate SRC family tyrosine kinases and SYK family tyrosine kinases.
  • IT AM comprises a twice-repeated YxxL sequence flanking seven variable residues.
  • the SRC and SYK kinases may connect the transduced signals with common activation pathways.
  • an Fc domain or region can exhibit reduced binding affinity to one or more Fc receptors. In some embodiments, an Fc domain or region can exhibit reduced binding affinity to one or more Fcgamma receptors. In some embodiments, an Fc domain or region can exhibit reduced binding affinity to FcRn receptors. In some embodiments,
  • an Fc domain or region can exhibit reduced binding affinity to Fcgamma and FcRn receptors.
  • an Fc domain is an Fc null domain or region.
  • an "Fc null” refers to a domain that exhibits weak to no binding to any of the Fcgamma receptors.
  • an Fc null domain or region exhibits a reduction in binding affinity (e.g., increase in Kd) to Fc gamma receptors of at least 1000-fold.
  • the Fc domain may have one or more, two or more, three or more, or four or more amino acid substitutions that decrease binding of the Fc domain to an Fc receptor.
  • an Fc domain exhibits decreased binding to FcyRI (CD64), FcyRIIA (CD32), FcyRIIIA (CD 16a), FcyRIIIB (CD 16b), or any combination thereof.
  • the Fc domain or region may comprise one or more substitutions that have the effect of reducing the affinity of the Fc domain or region to an Fc receptor.
  • the one or more substitutions comprise any one or more of IgGl heavy chain mutations corresponding to E233P, L234V, L234A, L235A, L235E, AG236, G237A, E318A, K320A, K322A, A327G, A330S, or P331S according to the EU index of Kabat numbering.
  • the Fc domain or region can comprise a sequence of the IgGl isoform that has been modified from the wild-type IgGl sequence.
  • a modification can comprise a substitution at more than one amino acid residue, such as at 5 different amino acid residues including L235V/F243L/R292P/Y300L/P396L (IgGlVLPLL) according to the EU index of Kabat numbering.
  • a modification can comprise a substitution at more than one amino acid residue such as at 2 different amino acid residues including S239D/I332E
  • a modification can comprise a substitution at more than one amino acid residue such as at 3 different amino acid residues including S298A/E333A/K334A (IgGlAAA) according to the EU index of Kabat numbering.
  • the Fc domain or region can comprise a sequence of an IgG isoform that has been modified from the wild-type IgG sequence. In some embodiments, the Fc domain or region can comprise a sequence of the IgGl isoform that has been modified from the wild-type IgGl sequence. In some embodiments, the modification comprises substitution of one or more amino acids that reduce binding affinity of an IgG Fc domain or region to all Fey receptors.
  • a modification can be substitution of E233, L234 and L235, such as E233P/L234V/L235A or E233P/L234V/L235A/AG236, according to the EU index of Kabat.
  • a modification can be substitution of L235, F243, R292, Y300 and P396, such as L235V/F243L/R292P/Y300L/P396L (IgGlVLPLL) according to the EU index of Kabat.
  • a modification can be a substitution of P238, such as P238A, according to the EU index of Kabat.
  • a modification can be a substitution of D265, such as D265A, according to the EU index of Kabat.
  • a modification can be a substitution of N297, such as N297A, according to the EU index of Kabat.
  • a modification can be a substitution of A327, such as A327Q, according to the EU index of Kabat.
  • a modification can be a substitution of P329, such as P239A, according to the EU index of Kabat.
  • an IgG Fc domain or region comprises at least one amino acid substitution that reduces its binding affinity to FcyRl, as compared to a wild-type or reference IgG Fc domain.
  • a modification can comprise a substitution at F241, such as F241A, according to the EU index of Kabat.
  • a modification can comprise a substitution at F243, such as F243A, according to the EU index of Kabat.
  • a modification can comprise a substitution at V264, such as V264A, according to the EU index of Kabat.
  • a modification can comprise a substitution at D265, such as D265A according to the EU index of Kabat.
  • an IgG Fc domain or region comprises at least one amino acid substitution that increases its binding affinity to FcyRl, as compared to a wild-type or reference IgG Fc domain.
  • a modification can comprise a substitution at A327 and P329, such as A327Q/P329A, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that reduce binding affinity of an IgG Fc domain or region to FcyRII and FcyRIIIA receptors.
  • a modification can be a substitution of D270, such as D270A, according to the EU index of Kabat.
  • a modification can be a substitution of Q295, such as Q295A, according to the EU index of Kabat.
  • a modification can be a substitution of A327, such as A237S, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that increases binding affinity of an IgG Fc domain or region to FcyRII and FcyRIIIA receptors.
  • a modification can be a substitution of T256, such as T256A, according to the EU index of Kabat.
  • a modification can be a substitution of K290, such as K290A, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that increases binding affinity of an IgG Fc domain or region to FcyRII receptor.
  • a modification can be a substitution of R255, such as R255A, according to the EU index of Kabat.
  • a modification can be a substitution of E258, such as E258A, according to the EU index of Kabat.
  • a modification can be a substitution of S267, such as S267A, according to the EU index of Kabat.
  • a modification can be a substitution of E272, such as E272A, according to the EU index of Kabat.
  • a modification can be a substitution of N276, such as N276A, according to the EU index of Kabat.
  • a modification can be a substitution of D280, such as D280A, according to the EU index of Kabat.
  • a modification can be a substitution of H285, such as H285A, according to the EU index of Kabat.
  • a modification can be a substitution of N286, such as N286A, according to the EU index of Kabat.
  • a modification can be a substitution of T307, such as T307A, according to the EU index of Kabat.
  • a modification can be a substitution of L309, such as L309A, according to the EU index of Kabat.
  • a modification can be a substitution of N315, such as N315A, according to the EU index of Kabat.
  • a modification can be a substitution of K326, such as K326A, according to the EU index of Kabat.
  • a modification can be a substitution of P331, such as P331A, according to the EU index of Kabat.
  • a modification can be a substitution of S337, such as S337A, according to the EU index of Kabat.
  • a modification can be a substitution of A378, such as A378A, according to the EU index of Kabat.
  • a modification can be a substitution of E430, such as E430, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that increases binding affinity of an IgG Fc domain or region to FcyRII receptor and reduces the binding affinity to FcyRIIIA receptor.
  • a modification can be a substitution of H268, such as H268A, according to the EU index of Kabat.
  • a modification can be a substitution of R301, such as R301A, according to the EU index of Kabat.
  • a modification can be a substitution of K322, such as K322A, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that decreases binding affinity of an IgG Fc domain or region to FcyRII receptor but does not affect the binding affinity to FcyRIIIA receptor.
  • a modification can be a substitution of R292, such as R292A, according to the EU index of Kabat.
  • a modification can be a substitution of K414, such as K414A, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that decreases binding affinity of an IgG Fc domain or region to FcyRII receptor and increases the binding affinity to FcyRIIIA receptor.
  • a modification can be a substitution of S298, such as S298A, according to the EU index of Kabat.
  • a modification can be substitution of S239, 1332 and A330, such as S239D/I332E/A330L.
  • a modification can be substitution of S239 and 1332, such as S239D/I332E.
  • the modification comprises substitution of one or more amino acids that decreases binding affinity of an IgG Fc domain or region to FcyRIIIA receptor and does not affect the binding affinity to FcyRII receptor.
  • a modification can be a substitution of S239, such as S239A, according to the EU index of Kabat.
  • a modification can be a substitution of E269, such as E269A, according to the EU index of Kabat.
  • a modification can be a substitution of E293, such as E293A, according to the EU index of Kabat.
  • a modification can be a substitution of Y296, such as Y296F, according to the EU index of Kabat.
  • a modification can be a substitution of V303, such as V303A, according to the EU index of Kabat.
  • a modification can be a substitution of A327, such as A327G, according to the EU index of Kabat.
  • a modification can be a substitution of K338, such as K338A, according to the EU index of Kabat.
  • a modification can be a substitution of D376, such as D376A, according to the EU index of Kabat.
  • the modification comprises substitution of one or more amino acids that increases binding affinity of an IgG Fc domain or region to FcyRIIIA receptor and does not affect the binding affinity to FcyRII receptor.
  • a modification can be a substitution of E333, such as E333A, according to the EU index of Kabat.
  • a modification can be a substitution of K334, such as K334A, according to the EU index of Kabat.
  • a modification can be a substitution of A339, such as A339T, according to the EU index of Kabat.
  • a modification can be substitution of S239 and 1332, such as S239D/I332E.
  • an IgG Fc domain or region comprises at least one amino acid substitution that reduces the binding affinity to FcRn, as compared to a wild-type or reference IgG Fc domain.
  • a modification can comprise a substitution at H435, such as H435A according to the EU index of Kabat.
  • a modification can comprise a substitution at 1253, such as 1253 A according to the EU index of Kabat.
  • a modification can comprise a substitution at H310, such as H310A according to the EU index of Kabat.
  • a modification can comprise substitutions at 1253, H310 and H435, such as I253A/H310A/H435A according to the EU index of Kabat.
  • a modification can comprise a substitution of one amino acid residue that increases the binding affinity of an IgG Fc domain for FcRn, relative to a wildtype or reference IgG Fc domain.
  • a modification can comprise a substitution at V308, such as V308P according to the EU index of Kabat.
  • a modification can comprise a substitution at M428, such as M428L according to the EU index of Kabat.
  • a modification can comprise a substitution at N434, such as N434A according to the EU index of Kabat or N434H according to the EU index of Kabat.
  • a modification can comprise substitutions at T250 and M428, such as T250Q and M428L according to the EU index of Kabat.
  • a modification can comprise substitutions at M428 and N434, such as M428L and N434S, N434A or N434H according to the EU index of Kabat.
  • a modification can comprise substitutions at M252, S254 and T256, such as
  • a modification can be a substitution of one or more amino acids selected from P257L, P257N, P257I, V279E, V279Q, V279Y, A281S, E283F, V284E, L306Y, T307V, V308F, Q311V, D376V, and N434H.
  • Other substitutions in an IgG Fc domain that affect its interaction with FcRn are disclosed in U.S. Patent No. 9,803,023 (the disclosure of which is incorporated by reference herein).
  • An antibody of the disclosure may consist of two identical light protein chains and two identical heavy protein chains, all held together covalently by disulfide linkages.
  • the N- terminal regions of the light and heavy chains together may form the antigen recognition site of an antibody.
  • various functions of an antibody may be confined to discrete protein domains (i.e., regions).
  • the sites that can recognize and can bind antigen are the three complementarities determining regions (CDRs) that may lie within the variable heavy chain region and variable light chain region at the N-terminal end of the heavy chain and the light chain.
  • the constant domains provide the general framework of the antibody and may not be involved directly in binding the antibody to an antigen, but may be involved in various effector functions, such as participation of the antibody in antibody-dependent cellular cytotoxicity, and may bind Fc receptors.
  • the constant domains may form an Fc region.
  • the constant domains may include an Fc domain.
  • the domains of natural light and heavy chain variable regions may have the same general structures, and each variable domain may comprise four framework regions, whose sequences can be somewhat conserved, connected by the CDRs.
  • the four framework regions may largely adopt a ⁇ - sheet conformation and the CDRs can form loops connecting, and in some aspects forming part of, the ⁇ -sheet structure.
  • An antibody construct may comprise a light chain of an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine, or ten modifications and in certain embodiments, not more than 40, 35, 30, 25, 20, 15, or 10 modifications of the amino acid sequence relative to the natural or original amino acid sequence.
  • An antibody construct may comprise a heavy chain of an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine, or ten modifications and in certain embodiments, not more than 40, 35, 30, 25, 20, 15, or 10 modifications of the amino acid sequence relative to the natural or original amino acid sequence.
  • An antibody of an antibody construct may include an antibody of any type, which may be assigned to different classes of immunoglobins, e.g., IgA, IgD, IgE, IgG, and IgM. Several different classes may be further divided into isotypes, e.g., IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
  • An antibody may further comprise a light chain and a heavy chain, often more than one chain.
  • An antibody with an IgG4 Fc domain paired with a wild type IgG4-hinge region can undergo strand swap, in which one arm of the bivalent antibody dissociates and pairs with a strand of another IgG4 antibody with a different antigen specificity. Strand swap may be prevented by pairing the IgG4 Fc-domain with a S228P mutation of the IgG4 hinge.
  • Exemplary heavy chain sequences of reference antibodies can be used to identify residue variants and mutants.
  • An exemplary heavy chain sequence for human IgGl heavy chain is that of the human IgGl antibody, and can comprise:
  • An exemplary heavy chain reference sequence for human IgG2 heavy chain can comprise:
  • An exemplary heavy chain reference sequence for human IgG4 heavy chain can comprise:
  • the heavy-chain constant regions (Fc) that corresponds to the different classes of immunoglobulins may be ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the light chains may be one of either kappa ( ⁇ ) or lambda ( ⁇ ), based on the amino acid sequences of the constant domains.
  • the Fc region may contain an Fc domain.
  • An Fc receptor may bind an Fc domain.
  • An Fc domain can comprise amino acid residues 216 to 447 of a human IgGl, which are included in SEQ ID NO: 437.
  • An Fc domain can comprise amino acid residues 216 to 442 of a human IgG2, which areincluded in SEQ ID NO: 438.
  • An Fc domain can comprise amino acid residues 216 to 44 of an IgG4, which are included in SEQ ID NO: 439.
  • An antibody construct may comprise an antigen-binding antibody fragment.
  • An antibody fragment may include: (i) a Fab fragment, a monovalent fragment consisting of the L, V H, C L and C HI domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; and (iii) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody.
  • the two domains of the Fv fragment, V L and V H may be coded for by separate genes, they may be linked by a synthetic linker to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules.
  • F(ab') 2 and Fab' moieties may be produced recombinantly or by treating
  • immunoglobulin e.g., monoclonal antibody
  • a protease such as pepsin and papain
  • the Fab fragment may also contain the constant domain of the light chain and the first constant domain (C HI ) of the heavy chain.
  • Fab' fragments may differ from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain C HI domain including one or more cysteine(s) from the antibody hinge region.
  • An Fv may be the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region may consist of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. In this configuration, the three CDRs of each variable domain may interact to define an antigen-binding site on the surface of the V H -V L dimer. A single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) may recognize and bind antigen, although the binding can be at a lower affinity than the affinity of the entire binding site.
  • An antibody may include an Fc region comprising an Fc domain.
  • the Fc domain of an antibody may interact with FcRs found on immune cells.
  • the Fc domain may also mediate the interaction between effector molecules and cells, which may lead to activation of the immune system.
  • the Fc region may comprise two identical protein fragments, which can be derived from the second and third constant domains of the antibody's heavy chains.
  • the Fc regions may comprise three heavy chain constant domains.
  • the Fc regions may comprise a highly-conserved N-glycosylation site, which may be important for FcR-mediated downstream effects.
  • An antibody used herein may be "chimeric” or “humanized.” Chimeric or humanized forms of non-human (e.g., murine) antibodies can be chimeric immunoglobulins,
  • the humanized antibody may comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence.
  • the humanized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
  • an antibody described herein may be a human antibody.
  • human antibodies can include antibodies having, for example, the amino acid sequence of a human immunoglobulin and may include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins that do not express endogenous immunoglobulins. Human antibodies may be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which may express human immunoglobulin genes. Completely human antibodies that recognize a selected epitope may be generated using guided selection. In this approach, a selected non- human monoclonal antibody, e.g., a mouse antibody, may be used to guide the selection of a completely human antibody recognizing the same epitope.
  • An antibody described herein may be a bispecific antibody or a dual variable domain antibody (DVD).
  • Bispecific and DVD antibodies may be monoclonal, often human or humanized, antibodies that can have binding specificities for at least two different antigens.
  • An antibody described herein may be a derivatized antibody.
  • derivatized antibodies may be modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein.
  • an antibody described herein may have a sequence that has been modified to alter at least one constant region-mediated biological effector function relative to the corresponding wild type sequence.
  • the antibody can be modified to reduce at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., reduced binding to the Fc receptor (FcR).
  • FcR binding may be reduced by, for example, mutating the immunoglobulin constant region segment of the antibody at particular regions necessary for FcR interactions.
  • An antibody or Fc domain as described herein may be modified to acquire or improve at least one constant region-mediated biological effector function relative to an unmodified antibody or Fc domain, e.g., to enhance FcyR interactions.
  • an antibody with a constant region that binds to FcyRIIA, FcyRIIB, and/or FcyRIIIA with greater affinity than the corresponding wild type constant region may be produced according to the methods described herein.
  • An Fc domain that binds to FcyRIIA, FcyRIIB, and/or FcyRIIIA with greater affinity than the corresponding wild type Fc domain may be produced according to the methods described herein.
  • An antibody construct may comprise an antibody with modifications of at least one amino acid residue. Modifications may be substitutions, additions, mutations, deletions, or the like. An antibody modification can be an insertion of an unnatural amino acid.
  • An antibody construct may comprise an antigen binding domain that specifically binds to an antigen on an immune cell, such as an immune cell (e.g., a T cell, a B cell or an APC), a stellate cell, an epithelial cell, a fibroblast cell, a fibrocyte cell, a myofibroblast, a synovial fibroblast, a podocyte, or other cell associated with the pathogenesis of fibrosis.
  • An antibody construct may comprise an antigen binding domain comprising one or more CDRs that facilitate specific binding to an antigen.
  • An antigen binding domain may comprise a set of CDRs, or pair of variable regions having at least 80% sequence identity to a set of CDRs or pair of variable regions set forth in TABLE 1 or TABLE 2, respectively.
  • An antibody construct may comprise an antigen binding domain that binds to an antigen, wherein the antigen binding domain comprises a set of CDRs having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to a set of CDRs set forth in in TABLE 1.
  • An antibody construct may comprise an antigen binding domain that binds to an antigen, wherein the antigen binding domain comprises at least at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to: a) HCDRl comprising an amino acid sequence of SEQ ID NO: 1, HCDR2 comprising an amino acid sequence of SEQ ID NO: 2, HCDR3 comprising an amino acid sequence of SEQ ID NO: 3, LCDRl comprising an amino acid sequence of SEQ ID NO: 4, LCDR2 comprising an amino acid sequence of SEQ ID NO: 5, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 6; b) HCDRl comprising an amino acid sequence of SEQ ID NO: 7, HCDR2 comprising an amino acid sequence of SEQ ID NO: 8, HCDR3 comprising an amino acid sequence of SEQ ID NO: 9, LCDRl
  • HCDRl comprising an amino acid sequence of SEQ ID NO: 10
  • LCDR2 comprising an amino acid sequence of SEQ ID NO: 11
  • LCDR3 comprising an amino acid sequence of SEQ ID NO: 12
  • HCDRl comprising an amino acid sequence of SEQ ID NO: 13
  • HCDR2 comprising an amino acid sequence of SEQ ID NO: 14
  • HCDR3 comprising an amino acid sequence of SEQ ID NO: 15
  • LCDRl comprising an amino acid sequence of SEQ ID NO: 16
  • LCDR2 comprising an amino acid sequence of SEQ ID NO: 17, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 18
  • HCDRl comprising an amino acid sequence of SEQ ID NO: 19
  • HCDR2 comprising an amino acid sequence of SEQ ID NO: 20
  • HCDR3 comprising an amino acid sequence of SEQ ID NO: 21
  • LCDRl comprising an amino acid sequence of SEQ ID NO: 22
  • LCDR2 comprising an amino acid sequence of SEQ ID NO
  • An antibody construct may comprise an antigen binding domain comprising one or more variable domains.
  • An antibody construct may comprise an antigen binding domain comprising a light chain variable domain (V L domain).
  • a binding domain may comprise a light chain variable regionshaving at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to any V L sequence in Table 2.
  • An antibody construct may comprise an antigen binding domain comprising a heavy chain variable domain (V H domain).
  • An antigen binding domain may comprise a heavy chain variable region having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to any V H sequence in TABLE 2.
  • An antigen binding domain can comprise a pair of heavy and light chain variable regions having at least 80% sequence identity a pair of variable regions set forth in TABLE 2.
  • An antigen binding domain can comprise a pair of heavy and light chain variable regions having at least 80% sequence identity to the non-CDR regions of a pair of variable regions set forth in TABLE 2.
  • An antibody construct may comprise an antigen binding domain that specifically binds to an antigen, wherein the antigen binding domain comprises: a) a V H sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 300, and a V L sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 299; b) a V H sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 301, and a V L sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO:
  • the antibody construct as described herein may comprise a sequence from TABLE 1 and/or TABLE 2.
  • the antibody construct may comprise a set of six CDRs selected from a selet of CDRs set forth in TABLE 1.
  • the antibody construct may comprise a pair of variable regions selected from the pairs of variable regions set forth in TABLE 2.
  • Antibody 1 to HCDR1 49 GYTFTSYG MADCAM HCDR2 50 ISVYSGNT
  • Antibody 2 to HCDR1 55 GYTFTSYG MADCAM HCDR2 56 ISVYSGNT
  • ZinbrytaTM HCDR1 85 GYTFTSYR (Daclizumab) HCDR2 86 INPSTGYT
  • Etaracizumab HCDR1 190 GFTFSSYD (Integrin ⁇ 3) HCDR2 191 VSSGGGST
  • HCDR3 216 AREGPLRGDYYYGLDV
  • HCDR1 220 GFTFSSYA (CD73)
  • HCDR2 221 ISGSGGRT
  • Antibody HCDR1 470 NYWLG muAD210.40.9 to HCDR2 471 DIYPGGGNTYYNEKLKG LRRC15
  • LCDR1 479 RSSKSLLHSNGNTHLY
  • Antibody 1 to V H 344 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGINW MADCAM VRQAPGQGLEWMGWISVYSGNTNYAQKVQGRVTM TADTSTSTAYMDLRSLRSDDTAVYYCAREGSSSSGDY YYGMDVWGQGTTVTVSS
  • Antibody 2 to V H 346 QVQLVQSGAEVKKPGASVKVSCEASGYTFTSYGIDW MADCAM VRQAPGQGLEWMGWISVYSGNTNYAQKLQGRVTMS TDTSTSTAYMELRSLRSDDTAVYYCAREGSSSSGDYY YGMDVWGQGTTVTVSS ANTIBODY REGION SEQ ID NO SEQUENCE
  • Antibody 1 to V H 407 EVQLVESGAEVKKPGASVKVSCKASGYTFTNYIIHWV CD45RB/RO KQEPGQGLEWIGYFNPYNHGTKYNEKFKGRATLTAN
  • Antibody 2 to V H 409 EVQLVESGAEVKKPGASVKVSCKASGYTFTNYIIHWV CD45RB/RO KQEPGQGLEWIGYFNPYNHGTKYNEKFKGRATLTAN
  • Antibody V H 482 EVQLVQSGAEVKKPGASVKVSCKASGYKFSSYWIEW huM25 to VKQAPGQGLEWIGEILPGSDTTNYNEKFKDRATFTSD LRRC15 TSINTAYMELSRLRSDDTAVYYCARDRGNYRAWFGY
  • Antibody V H 484 EVQLVQSGAEVKKPGSSVKVSCKASGFTFTDYYIHW huAD208.4.1 to VKQAPGQGLEWIGLVYPYIGGTNYNQKFKGKATLTV LRRC15 DTSTTTAYMEMSSLRSEDTAVYYCARGDNKYDAMD
  • Antibody V H 486 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTNYWMH huAD208.12.1 WVKQAPGQGLEWIGMIHPNSGSTKHNEKFRGKATLT to LRRC15 VDESTTTAYMELSSLRSEDTAVYYCARSDFGNYRWY
  • a binding domain can modulate an immune response by
  • binding domain can modulate the activity of a cell type or tissue by binding to its antigen on the cell type or in the tissue.
  • Some non-limiting examples of binding domains that can modulate an immune response by binding its antigen are a DEC-205 binding domain or a DCIR binding domain that can modulate immune activity of dendritic cells, or a FAP binding domain that can modulate immune activity of myofibroblasts at fibrotic tissue sites.
  • Other non-limiting examples of binding domains are an LRRC15 binding domain, a TNFR2 binding domain or a Cadherinl l binding domain.
  • a binding domain can be a first antigen binding domain in an antibody construct as described herein.
  • a first antigen binding domain can bind an antigen on a diseased tissue, which can thereby target an attached or linked immune-modulatory compound to disease sites in the body.
  • the first antigen binding domain can recognize an antigen expressed on a stellate cell or a myofibroblast at sites of fibrosis.
  • the first antigen binding domain can recognize an antigen expressed on cells at sites of tissue-specific inflammation and autoimmunity, such as synovial fibroblasts, gut epithelial cells, and podocytes.
  • the first antigen binding domain can recognize an antigen expressed on a cell of a transplanted organ.
  • the antigen of the first antigen binding domain can be found on stellate cells, myofibroblasts, synovial fibroblasts, epithelial cells, or podocytes, such as Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ , Nephrin, Podocin, FAP, CD73, CD38, PDGFRp, Integrin ⁇ , Integrin ⁇ 3, GARP, Endosialin, CTGF, c-KIT, or Integrin ⁇ .
  • stellate cells myofibroblasts, synovial fibroblasts, epithelial cells, or podocytes, such as Cadherin 11, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ , Nephrin, Podocin, FAP, CD73, CD38, PDGFRp, Integrin ⁇ , Integrin ⁇ 3, GARP, Endosial
  • the antigen of the first antigen binding domain can be found on stellate cells, myofibroblasts, synovial fibroblasts, epithelial cells, or podocytes, such as Cadherin 11, LRRC15, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ , Nephrin, Podocin, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, GARP, Endosialin, CTGF, c-KIT, or Integrin ⁇ .
  • stellate cells myofibroblasts, synovial fibroblasts, epithelial cells, or podocytes, such as Cadherin 11, LRRC15, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ , Nephrin, Podocin, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, GARP, Endosialin, CTGF, c-KIT, or Integrin ⁇
  • the antigen of the first antigen binding domain can be found on stellate cells, myofibroblasts, synovial fibroblasts, epithelial cells, or podocytes, such as Cadherin 11, LRRC15, PDPN, Integrin ⁇ 4 ⁇ 7, Integrin ⁇ 2 ⁇ , Nephrin, Podocin, FAP, CD73, CD38, PDGFR ⁇ , Integrin ⁇ , Integrin ⁇ 3, GARP, Endosialin, CTGF, c-KIT, Integrin ⁇ , MMP14, GPX8, or F2RL2.
  • the antigen of the first antigen binding domain is Cadherin 11, LRRC15, or FAP.
  • the antigen of the first antigen binding domain is TNFR2.
  • the first antigen binding domain can bind an antigen on an immune cell, such as BDCA2, CD30, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, or CD25.
  • a conjugate described herein can contain an antibody construct, where the antibody construct contains a first antigen binding domain and a second antigen binding domain.
  • the second antigen binding domain can bind to an antigen that is the same or different than the antigen bound by the first antigen binding domain.
  • the second antigen binding domain may be an antigen-binding portion of an antibody or an antibody fragment.
  • the second antigen binding domain may be one or more fragments of an antibody that can retain the ability to specifically bind to an antigen.
  • the second antigen binding domain may be any antigen binding fragment.
  • the second antigen binding domain may be in a scaffold, in which a scaffold is a supporting framework for the second antigen binding domain.
  • the second antigen binding domain may comprise an antigen binding domain in a scaffold.
  • the second antigen is selected from TNFR2, CD40, CD86, PD-1, TIM3, BTLA, DEC205, DCIR, CD45RB, CD45RO, HLA DR, CD38, CD73, GARP, BDCA2, or CD30.
  • the second antigen is selected from TNFR2, CD40, CD86, PD-1, TIM3, BTLA, DEC205, DCIR, CD45RB, CD45RO, HLA DR, CD38, CD73, GARP, BDCA2, PD-L1, or CD30.
  • the second antigen binding domain may have, for example, about 50%, about 60%, about 70%, about 80%, or about 90% sequence identity to TNFR2.
  • the second antigen binding domain can be an antagonist of, for example, immune cell immune-modulatory targets, an agonist of an immune checkpoint target, which can be found, for example, on immune cells, or mediate internalization of a cell surface antigen on immune cell types, for example, on an antigen presenting cell, and immune tissues.
  • the second antigen binding domain may be, for example, an antagonist of CD40, CD86, an agonist of PD-1, TIM-3, or BTLA, or a binding domain to DEC-205.
  • the second antigen binding domain may have, for example, about 50%, about 60%, about 70%, about 80%, or about 90% sequence identity to an antagonist of CD40, CD86, or PD-L1, an agonist of PD-1, TIM-3, or BTLA, or a binding domain to DEC-205.
  • the second antigen binding domain may be expressed from a single construct encoding the antibody construct and the first antigen binding domain.
  • a second antigen binding domain may comprise an antigen binding domain which can refer to a portion of an antibody comprising the antigen recognition portion, i.e., an antigenic determining variable region of an antibody sufficient to confer recognition and binding of the antigen recognition portion to a target, such as an antigen, i.e., the epitope.
  • a second antigen binding domain may comprise an antigen binding domain of an antibody.
  • An Fv can be the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region may consist of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. In this configuration, the three CDRs of each variable domain may interact to define an antigen-binding site on the surface of the V H -V L dimer. A single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) can recognize and bind antigen, although at a lower affinity than the entire binding site.
  • a second antigen binding domain may be at least 80% identical to a specific antigen binding domain selected from, but not limited to, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), a single chain variable fragment (scFv), a DARPin, an affimer, an avimer, a knottin, a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, a T cell receptor, an anticalin, a VNAR, a bicyclic peptide, or a recombinant T cell receptor.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • scFv single chain variable fragment
  • DARPin an affimer, an avimer,
  • a second antigen binding domain may be attached to an antibody construct.
  • a portion of an antibody construct may be fused with a second antigen binding domain to create an antibody construct comprising the second antigen binding domain as a fusion protein.
  • the fusion protein may be the result of the nucleic acid sequence encoding the second antigen binding domain being expressed in frame with the nucleic acid sequence encoding the remainder of the antibody construct.
  • the fusion protein may be the result of an in-frame genetic nucleotide sequence encoding the antibody construct with the antigen binding domain or a contiguous protein sequence of the antibody construct with the antigen binding domain.
  • a second antigen binding domain may be linked to a portion of an antibody construct.
  • a second antigen binding domain may be linked to a portion of an antibody construct by a chemical conjugation.
  • a second antigen binding domain may be attached to a terminus of an Fc region.
  • a second antigen binding domain may be attached to a terminus of an Fc domain.
  • a second antigen binding domain may be attached to a terminus of a protion of an antibody construct.
  • a second antigen binding domain may be attached to a terminus of an antibody.
  • a second antigen binding domain may be attached to a light chain of an antibody.
  • a second antigen binding domain may be attached to a terminus of a light chain of an antibody.
  • a second antigen binding domain may be attached to a heavy chain of an antibody.
  • a second antigen binding domain may be attached to terminus of a heavy chain of an antibody.
  • the terminus may be a C-terminus.
  • An antibody construct may be attached to 1, 2, 3, and/or 4 second antigen binding domains.
  • the second antigen binding domain may direct the antibody construct to, for example, a particular cell or cell type.
  • a second antigen binding domain of an antibody construct may be selected in order to recognize an antigen, e.g., an antigen expressed on an immune cell, or an antigen associated with fibrotic disease, autoimmune disease, or autoinflammatory disease.
  • An antigen can be a peptide or fragment thereof.
  • An antigen may be expressed on an immune cell.
  • An antigen may be expressed on an antigen-presenting cell.
  • An antigen may be expressed on a dendritic cell, a macrophage, or a B cell.
  • the second antigen binding domains When multiple second antigen binding domains are attached to an antibody construct, the second antigen binding domains may bind to the same antigen. When multiple second antigen binding domains are part of an antibody construct, the second antigen binding domains may bind to a different antigen(s).
  • an antibody construct as described herein can comprise a second binding domain to a second antigen specific to an immune cell.
  • the second binding domain can further increase an immune-modulatory activity of the conjugate as compared to a conjugate as described herein without a second binding domain.
  • second binding domains can be a non- activating CD40 binding domain that can blocks CD40L binding to CD40, or a PD-1 binding domain that can increase a PD-1 signal without blocking PD-L1 or PD-L2 binding to PD-1.
  • a second binding domain can bind to a TNFRSF member as a scFv at the C-terminus of the Fc domain of the antibody construct or C terminus of the light chain of the first antigen binding domain, which can confer a lack of agonism while retaining binding on the TNFRSF binding domain, allowing for targeting with appropriate immune- modulation.
  • a second binding domain can comprise a set of six CDRs having at least at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to a set of CDRs set forth in Table 1 as SEQ ID NO: 85 - SEQ ID NO: 298.
  • a second binding domain can comprise a set of CDRs having at least at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to: a) HCDRl comprising an amino acid sequence of SEQ ID NO: 85, HCDR2 comprising an amino acid sequence of SEQ ID NO: 86, HCDR3 comprising an amino acid sequence of SEQ ID NO: 87, LCDR1 comprising an amino acid sequence of SEQ ID NO: 88, LCDR2 comprising an amino acid sequence of SEQ ID NO: 89, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 90; b) HCDRl comprising an amino acid sequence of SEQ ID NO: 91, HCDR2 comprising an amino acid sequence of SEQ ID NO: 92, HCDR3 comprising an amino acid sequence of SEQ ID NO: 93, LCDR1 comprising an amino acid sequence of SEQ ID NO: 94, LCDR2 comprising an amino acid sequence of
  • LCDR3 comprising an amino acid sequence of SEQ ID NO: 96; c) HCDRl comprising an amino acid sequence of SEQ ID NO: 97, HCDR2 comprising an amino acid sequence of SEQ ID NO: 98, HCDR3 comprising an amino acid sequence of SEQ ID NO: 99, LCDR1 comprising an amino acid sequence of SEQ ID NO: 100, LCDR2 comprising an amino acid sequence of SEQ ID NO: 101, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 102; d) HCDR1 comprising an amino acid sequence of SEQ ID NO: 103, HCDR2 comprising an amino acid sequence of SEQ ID NO: 104, HCDR3 comprising an amino acid sequence of SEQ ID NO: 105, LCDR1 comprising an amino acid sequence of SEQ ID NO: 106, LCDR2 comprising an amino acid sequence of SEQ ID NO: 107, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 108; e) HCDR1 comprising
  • An antibody construct may comprise a second binding domain that specifically binds to an antigen, wherein the second binding domain comprises a pair of variable regions having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to a pair of variable regions set forth in Table 2 as SEQ ID NO: 352 - SEQ ID NO: 436.
  • An antibody construct may comprise a second binding domain that specifically binds to an antigen, wherein the second binding domain comprises: a) a V H sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 352, and a V L sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 353; b) a V H sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 354, and a V L sequence having at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to an amino acid sequence of SEQ ID NO: 355;
  • the antibody construct immune-modulatory compound conjugates may also be referred to as antibody conjugates.
  • Antibody conjugates described herein may comprise a linker, e.g., a peptide linker.
  • Linkers of the conjugates and methods described herein may not affect the binding of active portions of a conjugate (e.g., active portions include antigen binding domains, Fc domains, targeting binding domains, antibodies, immune modulators, inhibitors, or the like) to a target, which can be a cognate binding partner such as an antigen.
  • a linker can form a linkage between different parts of a conjugate, e.g., between an antibody construct and a compound of the disclosure (an immune-modulatory compound).
  • an antibody conjugate comprises multiple linkers.
  • the linkers may be the same linkers or different linkers.
  • a linker may be bound, i.e., covalently bound, to an antibody construct by a bond between the antibody construct and the linker.
  • a linker may be bound covalently to an anti- fibrosis associated antigen antibody construct by a bond between the anti-fibrosis associated antigen antibody construct and the linker.
  • a linker may be bound covalently to an anti- autoimmune associated antigen antibody construct by a bond between the anti-autoimmune associated antigen antibody construct and the linker.
  • a linker may be bound covalently to an anti-autoinflammatory associated antigen antibody construct by a bond between the anti- auto inflammatory associated antigen antibody construct and the linker.
  • a linker may be bound covalently to an anti-APC (antigen presenting cell) molecule antibody by a bond between the anti-APC molecule antibody and the linker.
  • a linker may be bound covalently to a terminus of an amino acid sequence of an antibody construct, or could be bound covalently to a side chain modification to the antibody construct, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a no n- natural amino acid residue, glutamine or glutamic acid residue.
  • a linker may be bound covalently to a terminus of an amino acid sequence of an Fc region of an antibody construct, or may be bound covalently to a side chain modification of an Fc region of an antibody construct, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a non-natural amino acid residue, glutamine or glutamic acid residue.
  • a linker may be covalently bound to a terminus of an amino acid sequence of an Fc domain of an antibody construct, or may be bound covalently to a side chain modification of an Fc domain of an antibody construct, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a non-natural amino acid residue, glutamine or glutamic acid residue.
  • a linker may be bound covalently to an antibody construct at a hinge cysteine.
  • a linker may be bound covalently to an antibody construct at a light chain constant domain lysine.
  • a linker may be bound covalently to an antibody construct at an engineered cysteine in the light chain.
  • a linker may be bound covalently to an antibody construct at an Fc region lysine.
  • a linker may be bound covalently to an antibody construct at an Fc domain lysine.
  • a linker may be bound covalently to an antibody construct at an Fc region cysteine.
  • a linker may be bound covalently to an antibody construct at an Fc domain cysteine.
  • a linker may be bound covalently to an antibody construct at an engineered light chain glutamine.
  • a linker may be bound covalently to an antibody construct at an unnatural amino acid engineered into the light chain.
  • a linker may be bound covalently to an antibody construct at an unnatural amino acid engineered into the heavy chain.
  • a linker may be bound covalently to an antibody construct at a lysine in the heavy chain.
  • a linker may be bound covalently to an antibody construct at an engineered cysteine in the heavy chain.
  • Amino acids can be engineered into an amino acid sequence of an antibody construct as described herein, for example, attachment of a linker of a conjugate.
  • Engineered amino acids may be added to a sequence of existing amino acids.
  • Engineered amino acids may be substituted for one or more existing amino acids of a sequence of amino acids.
  • a linker may be conjugated to an antibody construct via a sulfhydryl group.
  • a linker may be conjugated to an antibody construct via a primary amine.
  • a linker may be a link created between an unnatural amino acid on an antibody construct reacting with oxime bond that was formed by modifying a ketone group with an alkoxyamine on an immune- modulatory compound.
  • an engineered cysteine is introduced in an antibody construct so that a linker can be attached at such engineered cysteine.
  • an engineered cysteine can be introduced into an IgG (typically an IgGl) at T114 (heavy chain), A140 (heavy chain), L174 (heavy chain), L179 (heavy chain), T187 (heavy chain), T209 (heavy chain), S239 (heavy chain), V262 (heavy chain), G371 (heavy chain), Y373 (heavy chain), E382 (heavy chain), S400 (heavy chain), S424 (heavy chain), N434 (heavy chain), Q438 (heavy chain), 1106 (light chain), R108 (light chain), A118 (heavy chain), R142 (light chain), K149 (light chain), and/or V205 (light chain), according to the EU numbering of Kabat.
  • an Fc domain of the antibody construct can bind to Fc receptors.
  • an antibody construct bound to a linker or an antibody construct bound to a linker bound to a TGFpRl inhibitor retains the ability of the Fc domain of the antibody to bind to Fc receptors.
  • an antibody construct bound to a linker or an antibody construct bound to a linker bound to a TGFPR2 inhibitor retains the ability of the Fc domain of the antibody to bind to Fc receptors.
  • an antibody construct bound to a linker or an antibody construct bound to a linker bound to a TNKS inhibitor retains the ability of the Fc domain of the antibody to bind to Fc receptors.
  • an antibody construct bound to a linker or an antibody construct bound to a linker bound to a TNIK retains the ability of the Fc domain of the antibody to bind to Fc receptors.
  • the antigen binding domain of an antibody construct bound to a linker or an antibody construct bound to a linker bound to an immune-modulatory compound can bind its antigen.
  • a second antigen binding domain of an antibody construct bound to a linker or an antibody construct bound to a linker bound to an immune-modulatory compound can bind its antigen.
  • a linker or linker bound to an immune-modulatory compound disclosed herein may not be attached to an amino acid residue of an IgGl Fc domain selected from: 221, 224, 227, 228, 230, 231, 223, 233, 234, 235, 236, 237, 238, 239,
  • a linker or linker bound to an immune-modulatory compound disclosed herein may be attached to an amino acid residue of an IgGl Fc domain selected from: 221, 224, 227, 228, 230, 231, 223, 233, 234, 235, 236, 237, 238, 239, 240,
  • the K d of the first antigen binding domain for the first antigen may be retained.
  • the K d for binding of the first antigen binding domain of an antibody construct immune-modulatory compound conjugate to the first antigen in the presence of an immune-modulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the first antigen binding domain to the first antigen of an antibody construct in the absence of the immune-modulatory compound.
  • the K d for binding of the first antigen binding domain of an antibody construct immune-modulatory compound conjugate to the first antigen in the presence of the immune-modulatory compound can be less than 10 nM.
  • the K d for binding of the first antigen binding domain of an antibody construct immune- modulatory compound conjugate to the first antigen in the presence of the immune- modulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d of the second antigen binding domain for the second antigen may be retained.
  • the K d for binding of the second antigen binding domain of an antibody construct immune-modulatory compound conjugate to the second antigen in the presence of an immune-modulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the second antigen binding domain to the second antigen of an antibody construct in the absence of the immune-modulatory compound.
  • the K d for binding of the second antigen binding domain of an antibody construct immune-modulatory compound conjugate to the second antigen in the presence of the immune-modulatory compound can be less than 10 nM.
  • the K d for binding of the second antigen binding domain of an antibody construct immune- modulatory compound conjugate to the second antigen in the presence of the immune- modulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d of the first antigen binding domain for the first antigen may be retained and the K d of the second antigen binding domain for the second antigen may be retained.
  • the K d for binding of the first antigen binding domain of an antibody construct immune-modulatory compound conjugate to the first antigen in the presence of an immune- modulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the first antigen binding domain to the first antigen of an antibody construct in the absence of the immune-modulatory compound, and the K d for binding of the second antigen binding domain of an antibody construct immune-
  • the K d for binding of the first antigen binding domain of an antibody construct immune-modulatory compound conjugate to the first antigen in the presence of the immune-modulatory compound can be less than 10 nM
  • the K d for binding of the second antigen binding domain of an antibody construct immune-modulatory compound conjugate to the second antigen in the presence of the immune-modulatory compound can be less than 10 nM.
  • the K d for binding of the first antigen binding domain of an antibody construct immune-modulatory compound conjugate to the first antigen in the presence of the immune-modulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM
  • the K d for binding of the second antigen binding domain of an antibody construct immune-modulatory compound conjugate to the second antigen in the presence of the immune-modulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to a Fc receptor in the presence of the immune-modulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the Fc domain to the Fc receptor in the absence of the immune-modulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an Fc receptor in the presence of the immune-modulatory compound can be less than 10 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an Fc receptor in the presence of the immune-modulatory compound can be less than 10 ⁇ M, less than 1 ⁇ , less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to a Fey receptor in the presence of the immune-modulatory compound may be equivalent to or no less than 2 times, 5 times, or 10 times a Kd for binding of the Fc domain to the Fey receptor in the absence of the immune-modulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to a Fey receptor in the presence of the immune-modulatory compound no less than about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times a K d for binding of the Fc domain to the Fey receptor in the absence of the immune- modulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an Fey receptor in the presence of the immune- modulatory compound can be less than 10 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an Fey receptor in the presence of the immune-modulatory compound can be less than 10 ⁇ M, less than 1 ⁇ , less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to a FcRn receptor in the presence of the immune-modulatory compound may be at least equivalent to or at least no greater than about 2 times, 5 times, or 10 times a K d for binding of the Fc domain to the FcRn receptor in the absence of the immune-modulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to a FcRn receptor in the presence of the immune- modulatory compound may be at least equivalent to or at least no greater than about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times a K d for binding of the Fc domain to the FcRn receptor in the absence of the immune-modulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an FcRn receptor in the presence of the immune-modulatory compound can be less than 10 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-modulatory compound conjugate to an FcRn receptor in the presence of the immune-modulatory compound can be less than 10 ⁇ M, less than 1 ⁇ , less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the Fc domain activity (e.g., binding to a specific profile of Fc receptors) can be retained after covalent attachment of an immune-modulatory compound to an antibody construct.
  • an Fc domain can retain binding to FcRn as determined by retained Kd for FcRn or retention of half-life by the conjugate in an animal.
  • the Fc domain of the antibody construct can retain binding to Fey receptors as determined by retained Kd for Fey receptors or the retained ability to generate Fey receptor-mediated activity in cells expressing a specific set of Fey receptors, but not an antigen of a binding domain of the conjugate.
  • an Fc domain of an antibody construct of a conjugate can be selected to lack binding to Fey receptors, which can be shown to retain this lack of binding by binding assays, cell based assays, or a combination thereof.
  • An antibody construct can be conjugated to a linker via lysine-based bioconjugation.
  • An antibody construct can be exchanged into an appropriate buffer, for example, phosphate, borate, PBS, histidine, Tris-Acetate at a concentration of about 2 mg/mL to about 10 mg/mL.
  • An appropriate number of equivalents of a construct of an amino-pyrazinecarboxamide compound, and a linker, linker-pay load, as described herein, can be added as a solution with stirring.
  • a co-solvent can be introduced prior to the addition of the linker-payload to facilitate solubility.
  • An antibody construct can be conjugated to a linker via cysteine-based
  • An antibody construct can be exchanged into an appropriate buffer, for example, phosphate, borate, PBS, histidine, Tris-Acetate at a concentration of about 2 mg/mL to about 10 mg/mL with an appropriate number of equivalents of a reducing agent, for example, dithiothreitol or tris(2-carboxyethyl)phosphine.
  • a reducing agent for example, dithiothreitol or tris(2-carboxyethyl)phosphine.
  • the resultant solution can be stirred for an appropriate amount of time and temperature to effect the desired reduction.
  • a construct of an amino-pyrazinecarboxamide compound and a linker can be added as a solution with stirring.
  • Dependent on the physical properties of the linker-payload a co-solvent can be introduced prior to the addition of the linker-payload to facilitate solubility.
  • the reaction can be stirred at room temperature for about 1 hour to about 12 hours depending on the observed reactivity.
  • the progression of the reaction can be monitored by liquid chromatography-mass spectrometry (LC-MS).
  • LC-MS liquid chromatography-mass spectrometry
  • the remaining free linker- payload can be removed by applicable methods and the antibody conjugate can be exchanged into the desired formulation buffer.
  • Monomer content and drug- antibody ratios can be determined by methods described herein.
  • An immune-modulatory compound can be a compound, such as a small molecule, large molecule, or other molecule that binds to a protein target and can activate the protein target's function, or an entity that binds to a protein target and can inhibit the protein target's function.
  • an immune-modulatory compound is not a nucleic acid.
  • an immune-modulatory compound binds to an intracellular protein target.
  • an immune-modulatory compound can be designed to increase ubiquitin-mediated protein target destruction.
  • Increased ubiquitin-mediated protein target destruction can use a small molecule(s) that binds to a protein subunit of an E3 ubiquitin ligase.
  • the ubiquitin proteasome mediated protein degradation system of cells involves the covalent attachment of multiple ubiquitin molecules to lysine residues on a target protein, thereby marking the target protein for degradation by cellular proteasomes.
  • the process of attaching ubiquitin molecules to a protein target typically involves 3 enzymes and steps: 1) an El enzyme that activates ubiquitin, and 2) an E2 enzyme that transfers activated ubiquitin to 3) a multi-subunit E3 enzyme ligase that catalyzes a ubiquitin attachment to the target protein.
  • PROTACs Some examples of small molecules that can bind a subunit protein of a specific E3 ligase can be referred to as "PROTACs," which can harness the ubiquitin proteasome system to degrade a chosen protein target for therapeutic use.
  • PROTACs can comprise a small molecule that binds to a protein target and can be covalently attached by a linker to a small molecule that can bind an E3 ligase subunit. Harnessing the enzymatic machinery of the ubiquitin proteasome pathway can increase the potency of protein target inhibition.
  • an immune-modulatory compound can, for example, tolerize, suppress, repress, divert an immune response, or lower an inflammatory response against a patient tissue, patient cell, or patient antigen.
  • an immune-modulatory compound described herein can be, for example, a PI3K inhibitor, a Calcineurin inhibitor, an mTOR inhibitor, a BTK inhibitor, a JAK inhibitor, a CRAC inhibitor, a PARPl antagonist, a PPARg agonist, a Kvl.3 antagonist, a KCa3.1 antagonist, a PP2A agonist, an IRAK4 inhibitor, an MYD88 inhibitor, a BCL-2 antagonist, an A2ar agonist, a TLR7 antagonist, a c-KIT kinase inhibitor, a KCA3.1 agonist, a TGFPR1 inhibitor, a TGFPR2 inhibitor, an ACC antagonist, an ASK1 antagonist, GLI1 inhibitor, a TNKS antagonist, or a TNIK
  • an immune-modulatory compound can be, for example, a PI3K inhibitor, a calcineurin inhibitor, an mTOR inhibitor, a BTK inhibitor, a JAK inhibitor, a CRAC (ORA11) inhibitor, a PARPl antagonist, a PPARy agonist, a Kvl.3 antagonist, a KCa3.1 antagonist, a PP2A agonist, an IRAK4 inhibitor, a MYD88 inhibitor, BCL-2, A2aR agonist, a vitamin D receptor (VDR) agonist, or GLI1 inhibitor.
  • an immune-modulatory compound is a TGFpRl inhibitor TGFpR2 inhibitor, TNKS antagonist, or TNIK antagonist.
  • inhibitors of TGFpRl kinase include those disclosed in US Published Application 2018/0127426, US Patent No. 8,080,568, WO 2012/002680, WO 2009/009059, WO 2007/076127, WO 2007076086, WO 2006026306, Bioorg. Med. Chem., 2014, 22, 2724-2732 and J. Med. Chem. 2014, 57, 4213-4238, the disclosures of which are incorporated by reference herein.
  • inhibitors of the TGFPR2 kinase include those disclosed in WO 2015/136073, Bioorg. Med. Chem. Lett., 2013, 23, 3248-3252, Acta Cryst., 2016, D72, 658-674, WO 2016/020864, US Published Application 2014/0249135, US Published Application 20120225061 and compounds such as 3-amino-6-(4-(aminomethyl)phenyl)-N- (4-morpholinopyridin-3-yl)pyrazine-2-carboxamide, the disclosures of which are
  • inhibitors of TNKS include those disclosed CN 107226808, EP 3313177, US Patent No. 9,505,749, US Published Application No. 2015/0045368, WO 2014/036022, WO 2017/076484, WO 2018/046933, WO 2018/003962, Eur. J. Med. Chem., 2017, 142, 506-522, the disclosures of which are incorporated by reference herein.
  • inhibitors of TNIK include those disclosed US Published Application 2016/0264555, WO 2015/083833, US Published Application 2010/0216795, US Published Application 20100137386, Med. Chem. Commun., 2015, 6, 1564-1572, and Bioorg. Med. Chem. Lett., 2013, 23, 569-573, the disclosures of which are incorporated by reference herein.
  • systemic lupus erythematosus can be treated using an antibody conjugate described herein.
  • the compound conjugated to the antibody conjugate can be a TLR7 antagonist.
  • mastocytosis/uticaria pigmentosa can be treated using an antibody conjugate described herein.
  • the compound conjugated to the antibody construct to form a conjugate can be a c-KIT kinase inhibitor.
  • a fibrotic disease described herein can be treated using an antibody conjugate described herein.
  • the compound conjugated to the antibody construct to form a conjugate can be a KCa3.1 agonist.
  • the compound conjugated to the antibody construct to form a conjugate can be an ACC inhibitor, such asGS-0976.
  • the compound conjugated to the antibody construct to form a conjugate can be an ASK1 inhibitor.
  • the compound conjugated to the antibody construct to form a conjugate can be a TGFpRl inhibitor.
  • the compound conjugated to the antibody construct to form a conjugate can be a TGFPR2 inhibitor.
  • the compound conjugated to the antibody construct to form a conjugate can be a TNKS inhibitor. In some embodiments, the compound conjugated to the antibody construct to form a conjugate can be a TNIK inhibitor. In some embodiments, the compound conjugated to the antibody construct to form a conjugate can be a GLI1 inhibitor.
  • multiple sclerosis can be treated using an antibody conjugate described herein.
  • the compound conjugated to the antibody construct to form a conjugate can be fingolimod.
  • Binding of an immune-modulatory compound to its target or target protein can increase the activity of a protein expressed in a myofibroblast, an immune cell, or both.
  • Some non-limiting examples can include immune-modulatory compounds that are agonists of the adenine-receptor A2Ra such as CGS-21680 or sphingosine-1 analogues that increase activity of the phosphatase PP2A such as FTY720 and derived analogues.
  • Binding of an immune-modulatory compound to its target or protein target can inhibit the function of the protein target expressed in a myofibroblast, an immune cell, or both.
  • immune-modulatory compounds can include: protein kinase inhibitors for mTOR kinases such as rapamycin, LIST, in immune cells; inhibitors of the TGFPR2 kinase such as 3-amino-6-(4-(aminomethyl)phenyl)-N-(4-morpholinopyridin-3- yl)pyrazine-2-carboxamide, in myofibroblasts, immune cells or both; inhibitors of one or both of ⁇ 3 ⁇ and PI3K5 such as Duvelisib, TG 100713, and PF 04691502 in immune cells; and inhibitors of TNIK such as KY-05009 and NCB-0846 [4-((2-((4-(aminomethyl)-lH- benzo[d]imidazol-6-yl)amino)quinazolin-8-yl)oxy)cyclohexan- l-ol] in myofibroblasts, immune cells or both.
  • An immune-modulatory compound can mediate target inhibition by covalent attachment to a target or target protein.
  • a non- limiting example of an immune-modulatory compound that can inhibit a target protein can be a compound that can bind to an active site of TGFpRl kinase.
  • a non- limiting example of an immune-modulatory compound that can inhibit a target protein can be a compound that can bind to an active site of TGFPR2 kinase.
  • a non- limiting example of an immune-modulatory compound that can inhibit a target protein can be a compound that can bind to an active site of TNKS.
  • a non- limiting example of an immune-modulatory compound that can inhibit a target protein can be a compound that can bind to an active site of TNIK.
  • An immune-modulatory compound can bind to a protein target and can inhibit the function of the protein target by mediating degradation of the target protein expressed in a myofibroblast, an immune cell, or both.
  • Non-limiting examples of immune-modulatory compounds can include inhibitors of TGFpRl, TGFPR2, TNKS and TNIK described above.
  • Non-limiting examples of immune-modulatory compounds can further include inhibitors of TGFpRl, TGFpR2, TNKS and TNIK described above covalently attached or linked to an E3 ubiquitin ligase binding moiety, such as from a VHL binding moiety such as (S)-2-amino- Nl-(4-(5-amino-6-((4-morpholinopyridin-3-yl)carbamoyl)pyrazin-2-yl)benzyl)-N5-(2-(3- (((S)-l-((2S,4R)-4-hydroxy-2-((4-(4-methylthiazol-5-yl)benzyl)carbamoyl)pyrrolidin-l-yl)- 3,3-dimethyl- l-oxobutan-2-yl)amino)-3-oxopropoxy)ethyl)pentanediamide (Compound 1.1) or a cereblon binding moiety such
  • VHL may be hydroxyproline compounds such as those disclosed in WO2013/106643, and other compounds described in US 2016/0045607, WO 2014/187777, US 2014/0356322, and US 9,249,153.
  • Other compounds that bind to cereblon include thalidomide, lenalidomide, pomalidomide and analogs thereof.
  • Other small molecule compounds that bind to cereblon are also known, e.g., the compounds disclosed as an in US 2016/0058872 and
  • an E3 ubiquitin ligase binding moiety can be a second moiety.
  • an E3 ubiquitin ligase binding moiety can bind to an E3 ubiquitin ligase, such as Von Hippel-Lindaue E3 ubiquitin ligase (VHL), cereblon, mouse double minute 2 homolog (MDM2), AMFR, APC/Cdc20, APC/Cdhl, C6orfl57, Cbl, CBLL1, CHFR, CHIP, DTL (Cdt2), E6-AP, HACE1, HECTD1, HECTD2, HECTD3, HECW1, HECW2, HERC2, HERC3, HERC4, HERC5, HUWE1, HYD, ITCH, LNX1, mahogunin, MARCH-I, MARCH-II, MARCH-III, MARCH-IV, MARCH- VI, MARCH- VII
  • a conjugate as described herein can alter the activity of a protein target of the immune-modulatory compound within a target cell.
  • a conjugate can increase activity of a protein target of the immune-modulatory compound in a cell comprising a first antigen binding domain, a second binding domain, or a combination thereof.
  • the conjugate can lower activity of the protein target of the immune-modulatory compound in a cell comprising a first antigen binding domain, a second binding domain, or a combination thereof.
  • the conjugate can lower activity of the protein target of the immune-modulatory compound by increasing target protein degradation in a cell comprising a first antigen binding domain, a second binding domain, or a combination thereof.
  • the antigen targeted delivery of the conjugate to immune cells, myofibroblasts, or inflamed tissues can lower systemic toxicity of the immune-modulatory compound.
  • Some non- limiting examples are immune-modulatory compounds that can inhibit TGFpRl, TGFPR2 or mTOR kinases.
  • the antigen targeted delivery of the conjugate to an immune cell or myofibroblast can increase the potency of the immune-modulation.
  • Some non- limiting examples can be comprised of conjugates that can promote target protein degradation using an immune-modulatory compound or first moiety linked with a second moiety or an E3 ubiquitin ligase binding moiety due to the relatively low cell permeability of larger non- attached immune-modulatory compound or first moiety.
  • the present disclosure provides a method for treating fibrosis, comprising administering an immune-modulatory compound or salt as described herein to a subject in need thereof. In some aspects, the present disclosure provides a method for treating fibrosis, comprising administering a conjugate comprising an immune-modulatory compound or salt as described herein to a subject in need thereof.
  • salts particularly pharmaceutically acceptable salts, of the immune-modulatory compounds described herein.
  • the immune-modulatory compounds of the present disclosure that possess a sufficiently acidic, a sufficiently basic, or both functional groups, may react with any of a number of inorganic bases, and inorganic and organic acids, to form a salt.
  • immune-modulatory compounds that are inherently charged, such as those with a quaternary nitrogen may form a salt with an appropriate counterion, e.g., a halide such as bromide, chloride, or fluoride, particularly bromide.
  • the immune-modulatory compounds described herein may in some cases exist as diastereomers, enantiomers, or other stereoisomeric forms.
  • the immune-modulatory compounds presented herein include all diastereomeric, enantiomeric, and epimeric forms as well as the appropriate mixtures thereof. Separation of stereoisomers may be performed by chromatography or by forming diastereomers and separating by recrystallization, or chromatography, or any combination thereof. (Jean Jacques, Andre Collet, Samuel H. Wilen, "Enantiomers, Racemates and Resolutions", John Wiley And Sons, Inc., 1981, herein incorporated by reference for this disclosure). Stereoisomers may also be obtained by stereoselective synthesis.
  • the methods and conjugates and compositions described herein include the use of amorphous forms as well as crystalline forms (also known as polymorphs) of immune- modulatory compounds.
  • the immune-modulatory compounds described herein may be in the form of pharmaceutically acceptable salts.
  • active metabolites of these immune- modulatory compounds having the same type of activity are included in the scope of the present disclosure.
  • the immune-modulatory compounds described herein may exist in unsolvated as well as solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like.
  • the solvated forms of the immune-modulatory compounds presented herein are also considered to be disclosed herein.
  • immune-modulatory compounds or salts may be prodrugs, e.g., wherein a hydroxyl in the parent compound is presented as an ester or a carbonate, or carboxylic acid present in the parent compound is presented as an ester.
  • prodrug is intended to encompass compounds which, under physiologic conditions, are converted into pharmaceutical agents of the present disclosure.
  • One method for making a prodrug is to include one or more selected moieties which are hydro lyzed under physiologic conditions to reveal the desired molecule.
  • the prodrug is converted by an enzymatic activity of the host animal such as specific target cells in the host animal.
  • esters or carbonates e.g., esters or carbonates of alcohols or carboxylic acids and esters of phosphonic acids
  • Prodrug forms of the herein described compounds, wherein the prodrug is metabolized in vivo to produce an immune-modulatory compound are included within the scope of the claims.
  • some of the herein-described immune-modulatory compounds may be a prodrug for another derivative or active compound.
  • Prodrugs are often useful because, in some situations, they may be easier to administer than the parent drug. They may, for instance, be bioavailable by oral
  • Prodrugs may help enhance the cell permeability of a compound relative to the parent drug.
  • the prodrug may also have improved solubility in pharmaceutical compositions over the parent drug.
  • Prodrugs may be designed as reversible drug derivatives, for use as modifiers to enhance drug transport to site-specific tissues or to increase drug residence inside of a cell.
  • the prodrug may be converted, e.g., enzymatically or chemically, to the parent compound under the conditions within a cell.
  • the parent compound comprises an acidic moiety, e.g., resulting from the hydrolysis of the prodrug, which may be charged under the conditions within the cell.
  • the prodrug is converted to the parent compound once it has passed through the cell membrane into a cell.
  • the parent compound has diminished cell membrane permeability properties relative to the prodrug, such as decreased lipophilicity and increased hydrophilicity.
  • the parent compound with the acidic moiety is retained within a cell for a longer duration than the same compound without the acidic moiety.
  • the parent compound, with an acidic moiety may be retained within the cell, i.e., drug residence, for 10% or longer, such as 15% or longer, such as 20% or longer, such as 25% or longer, such as 30% or longer, such as 35% or longer, such as 40% or longer such as 45% or longer, such as 50% or longer, such as 55% or longer, such as 60% or longer, such as 65% or longer, such as 70% or longer, such as 75% or longer, such as 80% or longer, such as 85% or longer, or even 90% or longer relative to the same compound without an acidic moiety.
  • the design of a prodrug increases the lipophilicity of the pharmaceutical agent. In some embodiments, the design of a prodrug increases the effective water solubility. See, e.g., Fedorak et al., Am. J. Physiol., 269:G210-218 (1995); McLoed et al, Gastroenterol, 106:405-413 (1994); Hochhaus et ah, Biomed. Chrom., 6:283-286 (1992); J. Larsen and H. Bundgaard, Int. J. Pharmaceutics, 37, 87 (1987); J. Larsen et al., Int. J.
  • the present disclosure provides methods of producing the above-defined compounds.
  • the compounds may be synthesized using conventional techniques.
  • these compounds are conveniently synthesized from readily available starting materials.
  • the immune-modulatory compounds and salts described herein are bound covalently to a linker, e.g., a cleavable or non-cleavable linker.
  • the linker is also bound covalently to an antibody and referred to as an antibody conjugate or conjugate.
  • Linkers of the conjugates described herein may not affect the binding of active portions of a conjugate or antibody construct, e.g., the first antigen binding domains, Fc domains, second antigen binding domains, antibodies, immune-modulatory compounds, antagonists, agonists, or the like, to a target, which can be a cognate binding partner such as an antigen.
  • a conjugate can comprise multiple linkers. These linkers can be the same linkers or different linkers.
  • a linker described herein can be a multi-functional linker linking two small molecule binding moieties and linking the linked small molecules to an antibody.
  • a linker can be short, flexible, rigid, cleavable, non-cleavable, hydrophilic, or hydrophobic.
  • a linker can contain segments that have different characteristics, such as segments of flexibility or segments of rigidity.
  • the linker can be chemically stable to extracellular environments, for example, chemically stable in the blood stream, or may include linkages that are not stable.
  • the linker can include linkages that are designed to cleave and/or immolate or otherwise breakdown specifically or non-specifically inside cells.
  • a cleavable linker can be sensitive to enzymes.
  • a cleavable linker can be cleaved by enzymes such as proteases.
  • a cleavable linker can contain a valine-citrulline peptide or a valine- alanine peptide.
  • a valine-citrulline or valine- alanine containing linker can contain a pentafluorophenyl group.
  • a valine-citrulline or valine- alanine containing linker can contain a succinimide group.
  • a valine-citrulline or valine- alanine containing linker can contain a para aminobenzoic acid (PABA) group.
  • PABA para aminobenzoic acid
  • a linker containing a valine-citrulline, valine-alanine (VA), or a glycine-glycine-phenylalanine-glycine (GGFG) tetrapeptide can contain a PABA group and a pentafluorophenyl group.
  • a peptide based linker can contain a PABA group and a succinimide group.
  • a non-cleavable linker can be protease insensitive.
  • a non-cleavable linker can be maleimidocaproyl linker.
  • a maleimidocaproyl linker can comprise N- maleimidomethylcyclohexane-l-carboxylate.
  • a maleimidocaproyl linker can contain a succinimide group.
  • a linker can be a combination of a maleimidocaproyl group and one or more polyethylene glycol molecules.
  • a linker can be a maleimide-PEG4 linker.
  • a linker can be a combination of a maleimidocaproyl linker containing a succinimide group and one or more polyethylene glycol molecules.
  • a linker can contain maleimides linked to polyethylene glycol molecules in which the polyethylene glycol can allow for more linker flexibility or can be used.
  • a linker can also contain an alkylene, alkenylene, alkynylene, polyether, polyester or polyamide group(s) and/or contain polyamino acids, polypeptides, cleavable peptides, or aminobenzylcarbamates.
  • a linker can contain a maleimide at one end and an N- hydroxysuccinimidyl ester at the other end.
  • a linker can contain a lysine with an N-terminal amine acetylated, and a valine-citrulline cleavage site.
  • a linker can be a link created by a microbial transglutaminase, wherein the link can be created between an amine-containing moiety and a moiety engineered to contain glutamine as a result of the enzyme catalyzing a bond formation between the acyl group of a glutamine side chain and the primary amine of a lysine chain.
  • a linker can contain a reactive primary amine.
  • a linker can be a Sortase A linker.
  • a Sortase A linker can be created by a Sortase A enzyme fusing an LPXTG (SEQ ID NO: 492) recognition motif to an N-terminal GGG motif to regenerate a native amide bond. The linker created can therefore link a moiety attached to the LPXTG recognition motif with a moiety attached to the N-terminal GGG motif.
  • an immune-modulatory compound or salt is linked to the antibody construct by way of linkers.
  • the linker linking the compound or salt to the antibody of a conjugate may be short, long, hydrophobic, hydrophilic, flexible or rigid, or may be composed of segments that each independently have one or more of the above- mentioned properties such that the linker may include segments having different properties.
  • the linkers may be polyvalent such that they covalently link more than one compound or salt to a single site on the antibody, or monovalent such that covalently they link a single compound or salt to a single site on the antibody.
  • the linkers may link an immune- modulatory compound to the antibody by a covalent linkage between the linker and the antibody construct and compound.
  • the expression "linker” is intended to include (i) unconjugated forms of the linker that include a functional group capable of covalently linking the linker to an immune-modulatory compound and a functional group capable of covalently linking the linker to an antibody; (ii) partially conjugated forms of the linker that include a functional group capable of covalently linking the linker to an antibody construct and that is covalently linked to an immune-modulatory compound or vice versa; and (iii) fully conjugated forms of the linker that is covalently linked to both an immune- modulatory compound and an antibody construct.
  • One embodiment pertains to a conjugate formed by contacting an antibody that binds to a cell surface receptor or tumor associated antigen expressed on a tumor cell with a linker or linker-immune-modulatory compound described herein under conditions in which the linker or linker-immune-modulatory compound covalently links to the antibody.
  • One embodiment pertains to a method of making a conjugate formed by contacting a linker or linker-immune-modulatory compound described herein under conditions in which the linker or linker-immune-modulatory compound covalently links to the antibody.
  • Fleximer® linker technology has the potential to enable high-DAR ADCs with good physicochemical properties. As shown below, the Fleximer® linker technology is based on incorporating drug molecules into a solubilizing poly-acetal backbone via a sequence of ester bonds. The methodology renders highly-loaded conjugates (DAR up to 20) whilst maintaining good physicochemical properties.
  • an aliphatic alcohol can be present or introduced into the immune-modulatory compound.
  • the alcohol moiety is then conjugated to an alanine moiety, which is then synthetically incorporated into the Fleximer® linker. Liposomal processing of the ADC in vitro releases the parent alcohol-containing drug.
  • Cleavable linkers can be cleavable in vitro and in vivo.
  • Cleavable linkers can include chemically or enzymatically unstable or degradable linkages.
  • Cleavable linkers can rely on processes inside the cell to liberate an immune-modulatory compound, such as reduction in the cytoplasm, exposure to acidic conditions in the lysosome, or cleavage by specific proteases or other enzymes within the cell.
  • Cleavable linkers can incorporate one or more chemical bonds that are either chemically or enzymatically cleavable while the remainder of the linker can be non-cleavable.
  • a linker can contain a chemically labile group such as hydrazone and/or disulfide groups.
  • Linkers comprising chemically labile groups can exploit differential properties between the plasma and some cytoplasmic compartments.
  • the intracellular conditions that can facilitate immune-modulatory compound release for hydrazone containing linkers can be the acidic environment of endosomes and lysosomes, while the disulfide containing linkers can be reduced in the cytosol, which can contain high thiol concentrations, e.g., glutathione.
  • the plasma stability of a linker containing a chemically labile group can be increased by introducing steric hindrance using substituents near the chemically labile group.
  • Acid-labile groups such as hydrazone
  • This pH dependent release mechanism can be associated with nonspecific release of the drug.
  • the linker can be varied by chemical modification, e.g., substitution, allowing tuning to achieve more efficient release in the lysosome with a minimized loss in circulation.
  • Hydrazone-containing linkers can contain additional cleavage sites, such as additional acid-labile cleavage sites and/or enzymatically labile cleavage sites.
  • Antibody construct immune-modulatory compound conjugates including exemplary hydrazone- containing linkers can include, for example, the following structures:
  • linker (la) the linker can comprise two cleavable groups- a disulfide and a hydrazone moiety.
  • linkers such as (lb) and (Ic) can be effective with a single hydrazone cleavage site.
  • linkers include czs-aconityl- containing linkers, cis- Aconityl chemistry can use a carboxylic acid juxtaposed to an amide bond to accelerate amide hydrolysis under acidic conditions.
  • Cleavable linkers can also include a disulfide group.
  • Disulfides can be
  • thermodynamically stable at physiological pH can be designed to release the immune- modulatory compound upon internalization inside cells, wherein the cytosol can provide a significantly more reducing environment compared to the extracellular environment.
  • Scission of disulfide bonds can require the presence of a cytoplasmic thiol cofactor, such as (reduced) glutathione (GSH), such that disulfide-containing linkers can be reasonably stable in circulation, selectively releasing the immune-modulatory compound in the cytosol.
  • GSH cytoplasmic thiol cofactor
  • the intracellular enzyme protein disulfide isomerase, or similar enzymes capable of cleaving disulfide bonds can also contribute to the preferential cleavage of disulfide bonds inside cells.
  • GSH can be present in cells in the concentration range of 0.5-10 mM compared with a significantly lower concentration of GSH or cysteine, the most abundant low-molecular weight thiol, in circulation at approximately 5 ⁇ .
  • Tumor cells where irregular blood flow can lead to a hypoxic state, can result in enhanced activity of reductive enzymes and therefore even higher glutathione concentrations.
  • the in vivo stability of a disulfide-containing linker can be enhanced by chemical modification of the linker, e.g., use of steric hindrance adjacent to the disulfide bond.
  • Antibody conjugates including exemplary disulfide-containing linkers can include the following structures:
  • n represents the number of compounds bound to linkers (LP) bound to the antibody construct and R is independently selected at each occurrence from hydrogen or alkyl, for example.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2018/036554 2017-06-07 2018-06-07 Antibody conjugates of immune-modulatory compounds and uses thereof Ceased WO2018227018A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
US16/620,429 US20200199247A1 (en) 2017-06-07 2018-06-07 Antibody conjugates of immune-modulatory compounds and uses thereof
EP18813505.7A EP3634485A4 (en) 2017-06-07 2018-06-07 CONJUGATES OF ANTIBODIES CONTAINING IMMUNOMODULATOR COMPOUNDS AND THEIR USES
JP2019567691A JP2020523319A (ja) 2017-06-07 2018-06-07 免疫調節化合物の抗体コンジュゲートおよびその使用
AU2018279105A AU2018279105A1 (en) 2017-06-07 2018-06-07 Antibody conjugates of immune-modulatory compounds and uses thereof
CN201880047508.3A CN110891605A (zh) 2017-06-07 2018-06-07 免疫调节化合物的抗体缀合物及其用途
CA3065852A CA3065852A1 (en) 2017-06-07 2018-06-07 Antibody conjugates of immune-modulatory compounds and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762516638P 2017-06-07 2017-06-07
US62/516,638 2017-06-07

Publications (1)

Publication Number Publication Date
WO2018227018A1 true WO2018227018A1 (en) 2018-12-13

Family

ID=64567206

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/036554 Ceased WO2018227018A1 (en) 2017-06-07 2018-06-07 Antibody conjugates of immune-modulatory compounds and uses thereof

Country Status (7)

Country Link
US (1) US20200199247A1 (https=)
EP (1) EP3634485A4 (https=)
JP (1) JP2020523319A (https=)
CN (1) CN110891605A (https=)
AU (1) AU2018279105A1 (https=)
CA (1) CA3065852A1 (https=)
WO (1) WO2018227018A1 (https=)

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
WO2020215049A1 (en) * 2019-04-19 2020-10-22 ImmunoBrain Checkpoint, Inc. Modified anti-pd-l1 antibodies and methods and uses for treating a neurodegenerative disease
WO2021023117A1 (zh) * 2019-08-02 2021-02-11 康方药业有限公司 抗ctla4-抗pd-1双特异性抗体及其用途
EP3802518A1 (en) * 2018-05-25 2021-04-14 Silverback Therapeutics, Inc. Amino-pyrazinecarboxamide compounds, conjugates, and uses thereof
WO2021102332A1 (en) * 2019-11-22 2021-05-27 Silverback Therapeutics, Inc. Tgfbetar2 inhibitor-lrrc15 antibody conjugates and uses thereof
WO2021118968A1 (en) * 2019-12-12 2021-06-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Antibody-drug conjugates specific for cd276 and uses thereof
WO2021151889A1 (en) * 2020-01-27 2021-08-05 Medimmune Limited ANTI-αVβ8 INTEGRIN ANTIBODIES FOR USE IN TREATING KIDNEY DISEASE
WO2021202642A3 (en) * 2020-04-01 2021-11-11 The Regents Of The University Of California Immunotheranostic agent targeting mesenchymal stem cell-derived cancer cells and mesenchymal stem cell associated disease
US11179473B2 (en) 2020-02-21 2021-11-23 Silverback Therapeutics, Inc. Nectin-4 antibody conjugates and uses thereof
WO2021243136A3 (en) * 2020-05-29 2022-01-06 New York Society For The Relief Of The Ruptured And Crippled, Maintaining The Hospital For Special Surgery Methods and compositions for treating, preventing the onset and/or slowing progression of osteoarthritis
CN114026120A (zh) * 2019-05-10 2022-02-08 礼进生物医药科技(上海)有限公司 人源化抗cd137抗体及其用途
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
JP2022540946A (ja) * 2019-07-19 2022-09-20 ウーシー バイオロジクス アイルランド リミテッド コンジュゲーションのためのポリペプチド複合体及びその応用
EP3865152A4 (en) * 2018-10-09 2022-11-16 Eubulus Biotherapeutics Inc. TARGETED PROTEASE DEGRADATION PLATFORM
US11541126B1 (en) 2020-07-01 2023-01-03 Silverback Therapeutics, Inc. Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof
WO2023275394A1 (en) 2021-07-02 2023-01-05 Merck Patent Gmbh Anti-protac antibodies and complexes
US11583593B2 (en) 2016-01-14 2023-02-21 Synthis Therapeutics, Inc. Antibody-ALK5 inhibitor conjugates and their uses
JP2023509760A (ja) * 2020-01-08 2023-03-09 シンシス セラピューティクス,インコーポレイテッド Alk5阻害剤複合体およびその使用
JP2023520940A (ja) * 2020-04-09 2023-05-22 ユーブラス バイオセラピューティクス インコーポレーテッド 標的プロテアーゼ分解(ted)プラットフォーム
WO2024141496A1 (en) 2022-12-27 2024-07-04 Merck Patent Gmbh Vhh anti-protac antibodies and complexes
WO2024138128A3 (en) * 2022-12-23 2024-07-25 Genentech, Inc. Cereblon degrader conjugates, and uses thereof
US12091458B2 (en) 2018-11-26 2024-09-17 Forty Seven, Inc. Humanized antibodies against c-Kit
WO2024200987A1 (en) * 2023-03-31 2024-10-03 Avacta Life Sciences Limited Tnfr2 binding polypeptides and methods of use
FR3147278A1 (fr) * 2023-03-31 2024-10-04 Avacta Life Sciences Limited Polypeptides de liaison au tnfr2 et procedes d'utilisation
FR3147292A1 (fr) * 2023-03-31 2024-10-04 Affyxell Therapeutics Co., Ltd. Cellules genetiquement modifiees dans lesquelles un acide nucleique codant pour des variantes de la proteine stefine a se liant specifiquement au tnfr2 ou une proteine de fusion comprenant celle-ci a ete introduite, et leurs utilisations
WO2024243545A1 (en) * 2023-05-24 2024-11-28 President And Fellows Of Harvard College Compositions targeting endothelial cells and uses thereof
WO2024238872A3 (en) * 2023-05-18 2024-12-19 Firefly Bio, Inc. Isoindolinone-glutarimide antibody conjugates, and uses thereof
EP4595981A1 (en) * 2024-02-01 2025-08-06 Jack Elands Antibody-drug conjugates comprising an anti-integrin v 6 binding antibody
WO2025163120A1 (en) * 2024-02-01 2025-08-07 Adcytherix Sas ANTIBODY-DRUG CONJUGATES COMPRISING AN ANTI-INTEGRIN ΑVβ6 BINDING ANTIBODY
WO2025216667A1 (en) * 2024-04-12 2025-10-16 Joint Stock Company «Biocad» Monoclonal antibody that specifically binds to bdca-2
EP4444759A4 (en) * 2021-12-09 2025-11-26 Genequantum Healthcare Suzhou Co Ltd ANTIBODY-CYTOKINE FUSION PROTEINS AND THEIR APPLICATIONS
EP4458830A4 (en) * 2021-12-30 2025-12-03 Sichuan Kelun Biotech Biopharmaceutical Co Ltd TRICYCLIC COMPOUND, ITS PREPARATION PROCESS AND ITS USE

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2020521452A (ja) 2017-05-24 2020-07-27 パンディオン・セラピューティクス・インコーポレイテッド 標的化免疫寛容
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
US10174091B1 (en) 2017-12-06 2019-01-08 Pandion Therapeutics, Inc. IL-2 muteins
WO2020236875A1 (en) 2019-05-20 2020-11-26 Pandion Therapeutics, Inc. Madcam targeted immunotolerance
US11981715B2 (en) 2020-02-21 2024-05-14 Pandion Operations, Inc. Tissue targeted immunotolerance with a CD39 effector
EP4149627A4 (en) * 2020-05-14 2024-05-29 The General Hospital Corporation POLYPEPTIDE AGONISTS OF THE TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY
IL298695A (en) * 2020-06-02 2023-02-01 Childrens Medical Center Nanobody conjugates (VHH) and their uses
KR102506295B1 (ko) * 2020-08-28 2023-03-08 국립암센터 디그옥시제닌에 대한 인간화 항체 및 이의 용도
CN114146095A (zh) * 2020-09-07 2022-03-08 是光隽恒(北京)生物科技有限公司 用于组织损伤修复的组合物及其制备方法和用途
WO2022053864A1 (en) * 2020-09-08 2022-03-17 Kwon Byoung S Pd-1 polypeptide variants
EP4247434A4 (en) * 2020-11-18 2024-10-23 Pandion Operations, Inc. THERAPEUTIC AGENTS TARGETING MADCAM AND THEIR USES
AU2022254042A1 (en) * 2021-04-07 2023-09-14 Mythic Therapeutics, Inc. Antigen-binding protein constructs and antibodies and uses thereof
JP7717832B2 (ja) 2021-04-10 2025-08-04 ジェンマブ エー/エス Folr1結合剤、そのコンジュゲートおよびこれを使用する方法
WO2022226317A1 (en) 2021-04-23 2022-10-27 Profoundbio Us Co. Anti-cd70 antibodies, conjugates thereof and methods of using the same
TW202320857A (zh) 2021-07-06 2023-06-01 美商普方生物製藥美國公司 連接子、藥物連接子及其結合物及其使用方法
AU2023347072A1 (en) * 2022-09-20 2025-01-02 Currus Biologics Pty Ltd Bispecific polypeptides and uses thereof
AU2024353316A1 (en) 2023-09-26 2026-03-26 Genmab A/S Ptk7 binding agents, conjugates thereof and methods of using the same
WO2025149661A1 (en) 2024-01-10 2025-07-17 Genmab A/S Slitrk6 binding agents, conjugates thereof and methods of using the same
WO2025181219A1 (en) 2024-02-29 2025-09-04 Genmab A/S Egfr and c-met bispecific binding agents, conjugates thereof and methods of using the same

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060127407A1 (en) * 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
WO2011040973A2 (en) * 2009-10-02 2011-04-07 Ludwig Institute For Cancer Research Ltd. Tnf-immunoconjugates with fibroblast activation protein antibodies and methods and uses thereof
US20120213775A1 (en) * 2010-08-27 2012-08-23 Jochen Reiser Treatment of renal diseases
US20120258119A1 (en) * 2009-10-02 2012-10-11 Christoph Renner Anti-fibroblast activation protein antibodies and methods and uses thereof
US20140356322A1 (en) * 2012-01-12 2014-12-04 Yale University Compounds & Methods for the Enhanced Degradation of Targeted Proteins & Other Polypeptides by an E3 Ubiquitin Ligase
US20150017188A1 (en) * 2004-09-23 2015-01-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
US20170058033A1 (en) * 2015-08-24 2017-03-02 Eli Lilly And Company PD-L1 Antibodies
US20170080103A1 (en) * 2014-05-22 2017-03-23 Synthon Biopharmaceutical B.V. Site-specific conjugation of linker drugs to antibodies and resulting adcs

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EA201892619A1 (ru) * 2011-04-29 2019-04-30 Роше Гликарт Аг Иммуноконъюгаты, содержащие мутантные полипептиды интерлейкина-2
EP2808100B1 (en) * 2012-01-26 2018-01-17 Yorozu Corporation Method for manufacturing curved hollow pipe
EP3383910A1 (en) * 2015-11-30 2018-10-10 AbbVie Inc. ANTI-huLRRC15 ANTIBODY DRUG CONJUGATES AND METHODS FOR THEIR USE
AU2016365114A1 (en) * 2015-11-30 2018-05-17 Abbvie Biotherapeutics Inc. Anti-huLRRC15 antibody drug conjugates and methods for their use
US20210154188A1 (en) * 2018-04-02 2021-05-27 Silverback Therapeutics, Inc. Alk5 inhibitors, conjugates, and uses thereof
MX2020012679A (es) * 2018-05-25 2021-02-09 Silverback Therapeutics Inc Compuestos de amino-pirazincarboxamida, conjugados, y usos de los mismos.

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150017188A1 (en) * 2004-09-23 2015-01-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
US20060127407A1 (en) * 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
WO2011040973A2 (en) * 2009-10-02 2011-04-07 Ludwig Institute For Cancer Research Ltd. Tnf-immunoconjugates with fibroblast activation protein antibodies and methods and uses thereof
US20120258119A1 (en) * 2009-10-02 2012-10-11 Christoph Renner Anti-fibroblast activation protein antibodies and methods and uses thereof
US20120213775A1 (en) * 2010-08-27 2012-08-23 Jochen Reiser Treatment of renal diseases
US20140356322A1 (en) * 2012-01-12 2014-12-04 Yale University Compounds & Methods for the Enhanced Degradation of Targeted Proteins & Other Polypeptides by an E3 Ubiquitin Ligase
US20170080103A1 (en) * 2014-05-22 2017-03-23 Synthon Biopharmaceutical B.V. Site-specific conjugation of linker drugs to antibodies and resulting adcs
US20170058033A1 (en) * 2015-08-24 2017-03-02 Eli Lilly And Company PD-L1 Antibodies

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3634485A4 *

Cited By (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11583593B2 (en) 2016-01-14 2023-02-21 Synthis Therapeutics, Inc. Antibody-ALK5 inhibitor conjugates and their uses
US11987558B1 (en) 2016-01-14 2024-05-21 Synthis Therapeutics, Inc. ALK5 inhibitors and their uses
US12473377B2 (en) 2016-01-14 2025-11-18 Synthis Therapeutics, Inc. Antibody-ALK5 inhibitor conjugates and their uses
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US11547761B1 (en) 2016-07-07 2023-01-10 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US11110178B2 (en) 2016-07-07 2021-09-07 The Board Of Trustees Of The Leland Standford Junior University Antibody adjuvant conjugates
EP3802518A1 (en) * 2018-05-25 2021-04-14 Silverback Therapeutics, Inc. Amino-pyrazinecarboxamide compounds, conjugates, and uses thereof
EP3865152A4 (en) * 2018-10-09 2022-11-16 Eubulus Biotherapeutics Inc. TARGETED PROTEASE DEGRADATION PLATFORM
US12091458B2 (en) 2018-11-26 2024-09-17 Forty Seven, Inc. Humanized antibodies against c-Kit
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
WO2020215049A1 (en) * 2019-04-19 2020-10-22 ImmunoBrain Checkpoint, Inc. Modified anti-pd-l1 antibodies and methods and uses for treating a neurodegenerative disease
US10995141B2 (en) 2019-04-19 2021-05-04 ImmunoBrain Checkpoint, Inc. Modified anti-PD-L1 antibody and methods and uses for treating a neurodegenerative disease
CN114026120A (zh) * 2019-05-10 2022-02-08 礼进生物医药科技(上海)有限公司 人源化抗cd137抗体及其用途
CN114026120B (zh) * 2019-05-10 2024-03-19 礼进生物医药科技(上海)有限公司 人源化抗cd137抗体及其用途
JP2022540946A (ja) * 2019-07-19 2022-09-20 ウーシー バイオロジクス アイルランド リミテッド コンジュゲーションのためのポリペプチド複合体及びその応用
KR102949500B1 (ko) * 2019-07-19 2026-04-09 우시 엑스디씨 싱가포르 프라이빗 리미티드 접합을 위한 폴리펩티드 복합체 및 이의 용도
JP7455188B2 (ja) 2019-07-19 2024-03-25 ウーシー・エックスディシー・シンガポール・プライベイト・リミテッド コンジュゲーションのためのポリペプチド複合体及びその応用
IL290255B1 (en) * 2019-08-02 2025-08-01 Akeso Pharmaceuticals Inc Anti-ctla4/anti-pd-1 bispecific antibody and use thereof
IL290255B2 (en) * 2019-08-02 2025-12-01 Akeso Pharmaceuticals Inc Anti-ctla4/anti-pd-1 bispecific antibody and use thereof
WO2021023117A1 (zh) * 2019-08-02 2021-02-11 康方药业有限公司 抗ctla4-抗pd-1双特异性抗体及其用途
WO2021102332A1 (en) * 2019-11-22 2021-05-27 Silverback Therapeutics, Inc. Tgfbetar2 inhibitor-lrrc15 antibody conjugates and uses thereof
JP7679380B2 (ja) 2019-12-12 2025-05-19 ザ ユナイテッド ステイツ オブ アメリカ, アズ リプレゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ Cd276に特異的な抗体-薬物コンジュゲートおよびその使用
WO2021118968A1 (en) * 2019-12-12 2021-06-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Antibody-drug conjugates specific for cd276 and uses thereof
JP2023506158A (ja) * 2019-12-12 2023-02-15 ザ ユナイテッド ステイツ オブ アメリカ, アズ リプレゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ Cd276に特異的な抗体-薬物コンジュゲートおよびその使用
JP2023509760A (ja) * 2020-01-08 2023-03-09 シンシス セラピューティクス,インコーポレイテッド Alk5阻害剤複合体およびその使用
JP2023511686A (ja) * 2020-01-27 2023-03-22 メドイミューン・リミテッド 腎疾患の治療に使用するための抗αvβ8インテグリン抗体
AU2021213403B2 (en) * 2020-01-27 2025-04-10 Medimmune Limited Anti-αvβ8 integrin antibodies for use in treating kidney disease
JP7706458B2 (ja) 2020-01-27 2025-07-11 メディミューン リミテッド 腎疾患の治療に使用するための抗αvβ8インテグリン抗体
WO2021151889A1 (en) * 2020-01-27 2021-08-05 Medimmune Limited ANTI-αVβ8 INTEGRIN ANTIBODIES FOR USE IN TREATING KIDNEY DISEASE
CN115151305A (zh) * 2020-01-27 2022-10-04 免疫医疗有限公司 用于治疗肾脏疾病的抗αvβ8整联蛋白抗体
US12364768B2 (en) 2020-02-21 2025-07-22 Araris Biotech Ag Nectin-4 antibody conjugates and uses thereof
US11179473B2 (en) 2020-02-21 2021-11-23 Silverback Therapeutics, Inc. Nectin-4 antibody conjugates and uses thereof
WO2021202642A3 (en) * 2020-04-01 2021-11-11 The Regents Of The University Of California Immunotheranostic agent targeting mesenchymal stem cell-derived cancer cells and mesenchymal stem cell associated disease
JP2023520940A (ja) * 2020-04-09 2023-05-22 ユーブラス バイオセラピューティクス インコーポレーテッド 標的プロテアーゼ分解(ted)プラットフォーム
WO2021243136A3 (en) * 2020-05-29 2022-01-06 New York Society For The Relief Of The Ruptured And Crippled, Maintaining The Hospital For Special Surgery Methods and compositions for treating, preventing the onset and/or slowing progression of osteoarthritis
US11541126B1 (en) 2020-07-01 2023-01-03 Silverback Therapeutics, Inc. Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof
WO2023275394A1 (en) 2021-07-02 2023-01-05 Merck Patent Gmbh Anti-protac antibodies and complexes
EP4444759A4 (en) * 2021-12-09 2025-11-26 Genequantum Healthcare Suzhou Co Ltd ANTIBODY-CYTOKINE FUSION PROTEINS AND THEIR APPLICATIONS
EP4458830A4 (en) * 2021-12-30 2025-12-03 Sichuan Kelun Biotech Biopharmaceutical Co Ltd TRICYCLIC COMPOUND, ITS PREPARATION PROCESS AND ITS USE
WO2024138128A3 (en) * 2022-12-23 2024-07-25 Genentech, Inc. Cereblon degrader conjugates, and uses thereof
WO2024141496A1 (en) 2022-12-27 2024-07-04 Merck Patent Gmbh Vhh anti-protac antibodies and complexes
WO2024200988A1 (en) * 2023-03-31 2024-10-03 Avacta Life Sciences Limited Tnfr2 binding polypeptides and methods of use
FR3147292A1 (fr) * 2023-03-31 2024-10-04 Affyxell Therapeutics Co., Ltd. Cellules genetiquement modifiees dans lesquelles un acide nucleique codant pour des variantes de la proteine stefine a se liant specifiquement au tnfr2 ou une proteine de fusion comprenant celle-ci a ete introduite, et leurs utilisations
FR3147278A1 (fr) * 2023-03-31 2024-10-04 Avacta Life Sciences Limited Polypeptides de liaison au tnfr2 et procedes d'utilisation
WO2024200987A1 (en) * 2023-03-31 2024-10-03 Avacta Life Sciences Limited Tnfr2 binding polypeptides and methods of use
WO2024238872A3 (en) * 2023-05-18 2024-12-19 Firefly Bio, Inc. Isoindolinone-glutarimide antibody conjugates, and uses thereof
WO2024243545A1 (en) * 2023-05-24 2024-11-28 President And Fellows Of Harvard College Compositions targeting endothelial cells and uses thereof
EP4595981A1 (en) * 2024-02-01 2025-08-06 Jack Elands Antibody-drug conjugates comprising an anti-integrin v 6 binding antibody
WO2025163120A1 (en) * 2024-02-01 2025-08-07 Adcytherix Sas ANTIBODY-DRUG CONJUGATES COMPRISING AN ANTI-INTEGRIN ΑVβ6 BINDING ANTIBODY
WO2025216667A1 (en) * 2024-04-12 2025-10-16 Joint Stock Company «Biocad» Monoclonal antibody that specifically binds to bdca-2

Also Published As

Publication number Publication date
EP3634485A1 (en) 2020-04-15
CA3065852A1 (en) 2018-12-13
US20200199247A1 (en) 2020-06-25
CN110891605A (zh) 2020-03-17
AU2018279105A1 (en) 2019-12-19
EP3634485A4 (en) 2021-07-21
JP2020523319A (ja) 2020-08-06

Similar Documents

Publication Publication Date Title
US20200199247A1 (en) Antibody conjugates of immune-modulatory compounds and uses thereof
EP3595668B1 (en) Benzazepine compounds, conjugates, and uses thereof
EP3634401A1 (en) Antibody construct conjugates
US20220362396A1 (en) Amino-pyrazinecarboxamide compounds, conjugates, and uses thereof
WO2020056198A2 (en) Substituted benzazepine compounds, conjugates, and uses thereof
EP3999501A1 (en) Alk5 inhibitors, conjugates, and uses thereof
US20210154317A1 (en) Compositions and methods for the treatment of viral infections
EP3386536A2 (en) Composition of antibody construct-agonist conjugates and methods of use thereof
CA3131104A1 (en) Cyclic amino-pyrazinecarboxamide compounds and uses thereof
KR20210061995A (ko) Adam9를 표적으로 하는 면역콘쥬게이트 및 이를 이용하는 방법들
WO2022006340A1 (en) Alk5 inhibitors, conjugates, and uses thereof
WO2022076905A1 (en) Alk5 inhibitors, conjugates, and uses thereof
GB2552041A (en) Compositions of antibody construct-agonist conjugates and methods thereof
HK40021778A (en) Benzazepine compounds, conjugates, and uses thereof
HK40021778B (en) Benzazepine compounds, conjugates, and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18813505

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3065852

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019567691

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018279105

Country of ref document: AU

Date of ref document: 20180607

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018813505

Country of ref document: EP

Effective date: 20200107