WO2018115017A2 - Gremlin-1 crystal structure and inhibitory antibody - Google Patents
Gremlin-1 crystal structure and inhibitory antibody Download PDFInfo
- Publication number
- WO2018115017A2 WO2018115017A2 PCT/EP2017/083650 EP2017083650W WO2018115017A2 WO 2018115017 A2 WO2018115017 A2 WO 2018115017A2 EP 2017083650 W EP2017083650 W EP 2017083650W WO 2018115017 A2 WO2018115017 A2 WO 2018115017A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- gremlin
- seq
- human
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B2200/00—Indexing scheme relating to specific properties of organic compounds
- C07B2200/13—Crystalline forms, e.g. polymorphs
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- This invention relates to crystals of the human Gremlin- 1 protein, and the human Gremlin- 1 protein in complex with an inhibitory antibody.
- the invention also relates to the structure of human Gremlin- 1 (on its own, or in complex with the antibody) and uses of these structures in screening for agents which modulate Gremlin- 1 activity.
- the invention further provides antibodies which bind an allosteric inhibitory site on Gremlin- 1, together with pharmaceutical compositions and medical uses of such antibodies and agents identified by the screening methods.
- Gremlin- 1 (also known as Drm and CKTSF1B1) is a 184 amino acid glycoprotein which forms part of the DAN family of cystine-knot secreted proteins (along with Cerberus and Dan amongst others). Gremlin binds and inhibits the ability of BMP-2, 4, and 7 to signal along with a documented pro-angiogenic role possibly through agonism of VEGFR2. The main role of Gremlin- 1 is during development, in which it is vital during kidney formation and during limb bud formation. These vital roles make gremlin homozygous knock-outs lethal in embryonic mice.
- gremlin In adulthood, increased levels of gremlin have been associated with idiopathic pulmonary fibrosis and pulmonary arterial hypertension in which BMP-2, 4 and 7 signalling is reduced with an associated rise in TGF- ⁇ levels. In both diabetic and chronic allograft nephropathy, Gremlin- 1 expression has been correlated with fibrosis score. Increased levels of gremlin are also linked to scleroderma, diabetic nephropathy and colorectal cancer. Gremlin- 1 has been shown to activate cancer cell invasion and proliferation and is thought to play a role in uterine cervix, lung, ovary, kidney, breast, colon, pancreatic and sarcoma carcinomas.
- Gremlin- 1 and there is a lack of general understanding around Gremlin- 1 (and its partner Gremlin-2). BMP biology is complex, and high homology exists between species.
- Gremlin- 1 is a difficult protein to work with, and there is a lack of suitable tools and reagents for shading its biology. Making Gremlin- 1 is also not a straightforward process; cysteine-knot proteins are notoriously difficult to produce and the free cysteine of Gremlin- 1 adds to the challenge. Gremlin- 1 is difficult to express let alone purify. Until now, structural information has not been available and there is very little information on this protein in the literature.
- Gremlin- 1 as used in the present invention typically has the sequence as set out in the UniProt entry 060565 (SEQ ID NO: 1).
- the term Gremlin- 1 may also refer to a Gremlin- 1 polypeptide which:
- (a) comprises or consists of the amino acid sequence of SEQ ID NO: 1 with or without the N-terminal signal peptide, i.e. may comprise or consist of the mature peptide sequence as shown in SEQ ID NO: 21; or
- (b) is a derivative having one or more amino acid substitutions, modifications, deletions or insertions relative to the amino acid sequence of SEQ ID NO: 1 with or without the N-terminal signal peptide (as shown in SEQ ID NO: 21), which retains the activity of Gremlin- 1 , such as the amino acid sequence of SEQ ID NO : 20.
- variants typically retain at least about 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94% or 95% identity to SEQ ID NO: 1 (or SEQ ID NO: 20 or 21) (or even about 96%, 97%, 98% or 99% identity).
- such variants may retain about 60% - about 99% identity to SEQ ID NO: 1, suitably about 80% - about 99% identity to SEQ ID NO: 1 , more suitably about 90% - about 99% identity to SEQ ID NO: 1 and most suitably about 95% - about 99% identity to SEQ ID NO: 1.
- residue numbers are typically quoted based on the sequence of SEQ ID NO: 1. However, residue numbering could readily be extrapolated by the skilled person to a derivative or variant sequence as discussed above. Where residue numbers are quoted, the invention also encompasses these residues on a variant or derivative sequence.
- the present inventors have crystallised human Gremlin- 1 alone, and in complex with an antibody termed Ab 7326 (Fab fragments). Crystallisation of Gremlin- 1 has allowed putative residues in the BMP binding site to be determined. Furthermore, crystallisation with Ab 7326, which is an allosteric inhibitory antibody, has allowed residues in the antibody epitope to be determined. Antibodies binding this epitope have potential as therapeutic agents in the treatment of diseases associated with Gremlin- 1. Accordingly, the present invention provides a crystal of Gremlin- 1.
- the presention invention also provides the structure of human Gremlin- 1 as defined by the coordinates in Table 1. Furthermore, the invention provides:
- a machine readable data storage medium which comprises data storage material encoded with machine readable data defined by the structure coordinates of Gremlin- 1 in Table 1 or coordinates defining homologues of the structure.
- a method of screening for modulatory agents of Gremlin- 1 activity comprising the steps of: (a) identifying a ligand binding site from the structural coordinates in Table 1 ;
- a Gremlin- 1 modulating agent as identified by the screening method is provided.
- An antibody which binds to an epitope on Gremlin- 1 comprising at least one residue selected from Ilel31, Lysl47, Lysl48, Phel49, Thrl50, Thrl51, Argl69, Lysl74 and Gin 175, wherein the residue numbering is based on SEQ ID NO: 1.
- An anti-Gremlin- 1 antibody which comprises heavy chain complementarity determining region (HCDR) sequences contained within a heavy chain variable region (HCVR) of SEQ ID NO: 10 or 12 and/or light chain complementarity determining region (LCDR) sequences contained within a light chain variable region (LCVR) of SEQ ID NO: 11 or 13.
- HCDR heavy chain complementarity determining region
- LCDR light chain complementarity determining region
- An anti-Gremlin- 1 antibody which comprises at least one HCDR sequence selected from SEQ ID NOs: 3, 4, 5 and 6 and/or at least one LCDR sequence selected from SEQ ID NOs: 7, 8 and 9.
- An isolated polynucleotide encoding the antibodies An expression vector carrying the polynucleotide.
- a host cell comprising the vector.
- a method of producing the antibody comprising culturing the host cell under conditions permitting production of the antibody, and recovering the produced antibody. • A pharmaceutical composition comprising an antibody.
- idiopathic pulmonary fibrosis pulmonary arterial hypertension
- angiogenesis pulmonary fibrosis
- cancer comprising administering a therapeutically effective amount of an antibody or a pharmaceutical composition to a patient in need therefore.
- Figure 1 presents the structural data for Gremlin- 1 crystallography.
- Figure 2 shows the structure of human Gremlin- 1. Ribbon representations of each monomer are shown in different shades of grey, fingers 1 & 2 (Fl & F2) are marked along with the "wrist” regions (w) and the cystine-knots (CK). Cysteines forming disulphide bonds are shown as black sticks.
- Figure 3 shows a sequence alignment of human Gremlin- 1 and mouse Gremlin- 2 (PRDC). Residues marked with an asterisk are important in BMP binding and residues forming key contacts in the dimer interface are boxed.
- Figure 4 shows surface rendering highlighting the hydrophobic BMP binding residues. The monomers are shown in two shades of grey and the six key residues involved in BMP binding are shown in white.
- Figure 5 presents an overlay of human Gremlin- 1 and mouse Gremlin-2.
- the upper image is a ribbon representation with the two proteins aligned.
- the lower image shows in detail the amino acids involved in BMP binding as sticks (with mouse Gremlin- 2 in white and human Gremlin- 1 in black).
- Figure 6(A) shows a representation of the inhibitory effects of full length Gremlin- 1 in the Hek Idl reporter gene assay.
- Figure 6(B) shows a representation of the inhibitory effects of truncated Gremlin- 1 in the Hek Idl reporter gene assay.
- Figure 7 shows percentage restoration of signal for the immunisation derived antibodies in the Hek-Idl reporter gene assay.
- Figure 8 shows percentage restoration of signal for library derived antibodies in the Hek-Idl reporter gene assay.
- Figure 9 shows results for the Hek-Idl reporter gene assay with titrations of human Gremlin ( Figure 9A) and mouse Gremlin ( Figure 9B) and the effect of antibody 7326 (shown as antibody PB376) in restoring signalling of BMP.
- Figure 10 shows a structural model of the Gremlin-Fab complex, with the possible BMP binding regions and the Fab epitope highlighted.
- FIG 11 shows surface rendering depicting each Gremlin- 1 monomer in two shades of grey, the six key residues identified by mutagenesis to be involved in BMP binding in black and all residues on the surface within 6 A of those six key residues.
- Figure 12 Assessment of right ventricular systolic pressures (RVSP).
- RVSP right ventricular systolic pressures
- RVSP right heart hypertrophy
- SEQ ID NO: 1 shows the sequence of human Gremlin- 1 including the 24 amino acid N- terminal signal sequence (Uniprot ID 060565).
- SEQ ID NO: 2 shows the sequence of truncated human Gremlin- 1 used in crystallography including an N-terminal tag.
- SEQ ID NO: 3 shows the Ab 7326 HCDR1 (Chothia).
- SEQ ID NO: 4 shows the Ab 7326 HCDR1 (Kabat).
- SEQ ID NO: 5 shows the Ab 7326 HCDR2 (Kabat).
- SEQ ID NO: 6 shows the Ab 7326 HCDR3 (Kabat).
- SEQ ID NO: 7 shows the Ab 7326 LCDR1 (Kabat).
- SEQ ID NO: 8 shows the Ab 7326 LCDR2 (Kabat).
- SEQ ID NO: 9 shows the Ab 7326 LCDR3 (Kabat).
- SEQ ID NO: 10 shows the Ab 7326 heavy chain variable region (variant 1).
- SEQ ID NO: 11 shows the Ab 7326 light chain variable region (variant 1).
- SEQ ID NO: 12 shows the Ab 7326 heavy chain variable region (variant 2).
- SEQ ID NO: 13 shows the Ab 7326 light chain variable region (variant 2).
- SEQ ID NO: 14 shows the mouse Ab 7326 full length IgGl heavy chain (variant 1).
- SEQ ID NO: 15 shows the mouse Ab 7326 full length IgGl light chain (variant 1).
- SEQ ID NO: 16 shows the human Ab 7326 full length IgGl heavy chain (variant 2).
- SEQ ID NO: 17 shows the human Ab 7326 full length IgGl light chain (variant 2).
- SEQ ID NO: 18 shows the Ab 7326 Fab heavy chain (variant 1).
- SEQ ID NO: 19 shows the Ab 7326 Fab light chain (variant 1).
- SEQ ID NO: 20 shows the sequence of truncated human Gremlin- 1 used in crystallography without the N-terminal tag.
- SEQ ID NO: 21 shows the sequence of mature Gremlin- 1 (SEQ ID NO: 1 without the signal peptide).
- SEQ ID NO: 22 shows the human IgG4P heavy chain (variant 1).
- SEQ ID NO: 23 shows the human IgG4P light chain (variant 1).
- SEQ ID NO: 24 shows the human IgGl heavy chain DNA (variant 1).
- SEQ ID NO: 25 shows the human IgGl light chain DNA (variant 1).
- SEQ ID NO: 26 shows the human IgG4P heavy chain DNA (variant 1).
- SEQ ID NO: 27 shows the human IgG4P light chain DNA (variant 1).
- SEQ ID NO: 28 shows the mouse full length IgGl heavy chain (variant 2).
- SEQ ID NO: 29 shows the mouse full length IgGl light chain (variant 2).
- SEQ ID NO: 30 shows the human full length IgGl heavy chain (variant 1).
- SEQ ID NO: 31 shows the human full length IgGl light chain (variant 1).
- SEQ ID NO: 32 shows the Fab heavy chain (variant 2).
- SEQ ID NO: 33 shows the Fab light chain (variant 2).
- SEQ ID NO: 34 shows the human IgG4P heavy chain (variant 2).
- SEQ ID NO: 35 shows the human IgG4P light chain (variant 2).
- Gremlin-1 crystal structure The present invention provides the structural coordinates of human Gremlin- 1.
- the present invention further provides for a crystal of Gremlin-1 in complex with an antibody, more specifically a Fab with a heavy chain of SEQ ID NO: 18 and a light chain ofSEQ ID NO: 19.
- the invention further provides a machine readable data storage medium which comprises data storage material encoded with machine readable data defined by the structure coord nates of Gremlin- 1 in Table 1 or coordinates defining homologues of the structure.
- the invention provides for use of the structural data in table 1, and the machine readable data storage meduium, as a structural model for Gremlin- 1.
- a structural model may be used to screen for agents that interact with Gremlin- 1.
- the screening may be high throughput screening.
- An agent that interacts with Gremlin- 1 is typically an agent which binds Gremlin- 1.
- Agents that interact with Gremlin- 1 may modulate Gremlin- 1.
- An inhibitory modulating agent may have an effect on any of the functions of Gremlin- 1, but typically reduces binding of Gremlin- 1 to BMP (BMP 2/4/7).
- Gremlin- 1 is a negative regulator of BMP, so reduced binding increases signalling through BMP.
- An activating modulating agent may increase binding of Gremlin- 1 to BMP.
- BMP binding and signalling may be detected by any method known in the art.
- the Examples of the present application describe a SMAD phosphorylation assay.
- SMADl, 5 and 8 are phosphorylated upon BMP signalling.
- An increase in SMAD phosphorylation may therefore be used to determine increased BMP signalling, which may reflect a reduction in binding to Gremlin- 1.
- the Examples also describe an Idl reporter gene assay, where the Idl gene is a target gene of BMP signalling. An increase in recovery of the signal in this assay may therefore also be used to determine if an agent inhibits Gremlin- 1 binding to BMP.
- An agent as referred to herein could be any molecule which could potentially interact with Gremlin- 1, but is preferably a small molecule or antibody.
- the invention also provides a method of screening for modulatory agents of Gremlin- 1 activity, comprising the steps of:
- the ligand binding site could be any putative site on Gremlin- 1 which interacts with a protein (ligand).
- the ligand binding site is typically the BMP binding site.
- the present inventors have identified a putative BMP binding site based on the Gremlin- 1 crystal structure. This binding site comprises the following amino acids: Trp93, Phell7, Tyrll9, Phel25, Tyrl26 and Phel38, wherein the residue numbering is based on SEQ ID NO: 1.
- the screening method of the invention may therefore comprise identifying agents which interact with one or more of these residues, preferably at least 2, 3, 4 or all 6 of these residues.
- Interaction of an agent with protein residues may be determined by any appropriate method known in the art, such as distances between the residue and agent as determined by x-ray crystallography (typically less than 6 A, or less than 4 A).
- the region of Gremlin- 1 which may be targeted by a therapeutic may include amino acids Asp92-Leu99, Argl 16-Hisl30, Serl37-Serl42, Cysl76-Cysl78. These are within 6 A of those mutated on the surface of Gremlin- 1.
- Steps (a) and (b) of the screening method are typically performed in silico, and the agent may be obtained and synthesised by any method known in the art.
- the present invention provides an antibody which binds to an epitope on Gremlin- 1 comprising at least one residue selected from Trp93, Phell7, Tyrll9, Phel25, Tyrl26 and Phel38, wherein the residue numbering is according to SEQ ID NO: 1.
- the present invention also provides an antibody, which binds an epitope comprising all of Trp93, Phel 17, Tyrl 19, Phel25, Tyrl26 and Phel38.
- the invention also provides for use of this BMP binding region of Gremlin- 1 for generating (potentially inhibitory) antibodies.
- the invention provides an antigen comprising at least one (preferably all) of the residues listed above, which can be used for antibody generation.
- an agent may act allosterically.
- an agent binds away from the normal binding site but is still capable of modulating the activity of Gremlin- 1 e.g. through induced conformational changes in the protein.
- the structural model and screening method of the invention may therefore also be used to identify allosteric modulators of Gremlin- 1.
- the Ab 7326 antibody of the invention has been found to act allosterically.
- the epitope of this antibody comprises the following residues: Ilel31, Lysl47, Lysl48, Phel49, Thrl50, Thrl51, Argl69, Lysl74 and Glnl75, wherein the residue numbering is based on SEQ ID NO: 1.
- the screening method of the invention may involve identifying agents which interact with at least 1, 2, 3, 4, 5 or all 9 of these residues. Such agents can then be tested e.g. using the assays described in the Examples for inhibition of BMP binding.
- Lysl47, Lysl48, Phel49, Thrl50, Thrl51, Argl69, Lysl74 and Gin 175 are located on one monomer of Gremlin- 1 and Ilel31 is located on the other monomer of Gremlin- 1 (Gremlin- 1 (timers bind to BMP (timers).
- the invention also encompasses an antigen comprising at least one (preferably all) of these residues for producing anti-Gremlin- 1 antibodies.
- agents may be identified as interacting with these residues by any appropriate method known in the art.
- the agent is preferably a small molecule or antibody.
- the present invention provides antibodies that bind Gremlin- 1.
- antibody as referred to herein includes whole antibodies and any antigen binding fragment (i.e., "antigen-binding portion") or single chains thereof.
- An antibody refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen-binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed f amework regions (FR).
- CDR complementarity determining regions
- FR f amework regions
- the constant regions of the antibodies may mediate the binding of the antibodies
- immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- various cells of the immune system e.g., effector cells
- the first component (Clq) of the classical complement system e.g., Clq
- An antibody of the invention may be a monoclonal antibody or a polyclonal antibody, and will typically be a monoclonal antibody.
- An antibody of the invention may be a chimeric antibody, a CDR-grafted antibody, a nanobody, a human or humanised antibody or an antigen-binding portion of any thereof.
- the experimental animal is typically a non-human mammal such as a goat, rabbit, rat or mouse but the antibody may also be raised in other species.
- Polyclonal antibodies may be produced by routine methods such as immunisation of a suitable animal, with the antigen of interest. Blood may be subsequently removed from the animal and the IgG fraction purified.
- Antibodies against Gremlin- 1 may be obtained, where immunisation of an animal is necessary, by administering the polypeptides to an animal, e.g. a non-human animal, using well-known and routine protocols, see for example Handbook of Experimental Immunology, D. M. Weir (ed.), Vol 4, Blackwell Scientific Publishers, Oxford, England, 1986). Many warm-blooded animals, such as rabbits, mice, rats, sheep, cows, camels or pigs may be immunized. However, mice, rabbits, pigs and rats are generally most suitable.
- Monoclonal antibodies may be prepared by any method known in the art such as the hybridoma technique (Kohler & Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today, 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, pp77-96, Alan R Liss, Inc., 1985).
- Antibodies of the invention may also be generated using single lymphocyte antibody methods by cloning and expressing immunoglobulin variable region cDNAs generated from single lymphocytes selected for the production of specific antibodies by for example the methods described by Babcook, J. et al., 1996, Proc. Natl. Acad. Sci. USA 93(15): 7843-78481; WO92/02551; WO2004/051268 and WO2004/106377.
- the antibodies of the present invention can also be generated using various phage display methods known in the art and include those disclosed by Brinkman et al. (in J. Immunol. Methods, 1995, 182: 41-50), Ames et al. (J. Immunol. Methods, 1995,
- Fully human antibodies are those antibodies in which the variable regions and the constant regions (where present) of both the heavy and the light chains are all of human origin, or substantially identical to sequences of human origin, but not necessarily from the same antibody.
- Examples of fully human antibodies may include antibodies produced, for example by the phage display methods described above and antibodies produced by mice in which the murine immunoglobulin variable and optionally the constant region genes have been replaced by their human counterparts e.g. as described in general terms in EP 0546073, U5,545,806, US 5,569,825, US 5,625,126, US 5,633,425, US 5,661,016, US 5,770,429, EP 0438474 and EP 0463151.
- an antibody according to the invention may be produced by a method comprising immunising a non-human mammal with a Gremlin- 1 immunogen; obtaining an antibody preparation from said mammal; deriving therefrom monoclonal antibodies that recognise Gremlin- 1.
- the antibody molecules of the present invention may comprise a complete antibody molecule having full length heavy and light chains or a fragment or antigen- binding portion thereof.
- the term "antigen-binding portion" of an antibody refers to one or more fragments of an antibody that retain the ability to selectively bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- the antibodies and fragments and antigen binding portions thereof may be, but are not limited to Fab, modified Fab, Fab', modified Fab', F(ab')2, Fv, single domain antibodies (e.g.
- VH or VL or VHH VH or VL or VHH
- scFv bi, tri or tetra-valent antibodies
- Bis-scFv diabodies
- triabodies triabodies
- tetrabodies and epitope-binding fragments of any of the above (see for example Holliger and Hudson, 2005, Nature Biotech.
- Multi-valent antibodies may comprise multiple specificities or may be monospecific (see for example WO 92/22853 and WO
- the constant region domains of the antibody molecule of the present invention may be selected having regard to the proposed function of the antibody molecule, and in particular the effector functions which may be required.
- the constant region domains may be human IgA, IgD, IgE, IgG or IgM domains.
- human IgG constant region domains may be used, especially of the IgGl and IgG3 isotypes when the antibody molecule is intended for therapeutic uses and antibody effector functions are required.
- IgG2 and IgG4 isotypes may be used when the antibody molecule is intended for therapeutic purposes and antibody effector functions are not required.
- An antibody of the invention may be prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for the immunoglobulin genes of interest or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody of interest, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of immunoglobulin gene sequences to other DNA sequences.
- An antibody of the invention may be a human antibody or a humanised antibody.
- human antibody is intended to include antibodies having variable regions in which both the f amework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human f amework sequences.
- Such a human antibody may be a human monoclonal antibody.
- Such a human monoclonal antibody may be produced by a hybridoma that includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- Human antibodies may be prepared by in vitro immunisation of human lymphocytes followed by transformation of the lymphocytes with Epstein-Barr virus.
- human antibody derivatives refers to any modified form of the human antibody, e.g., a conjugate of the antibody and another agent or antibody.
- humanized antibody is intended to refer to CDR-grafted antibody molecules in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- the term 'CDR-grafted antibody molecule' refers to an antibody molecule wherein the heavy and/or light chain contains one or more CDRs (including, if desired, one or more modified CDRs) from a donor antibody (e.g. a murine or rat monoclonal antibody) grafted into a heavy and/or light chain variable region framework of an acceptor antibody (e.g. a human antibody).
- a donor antibody e.g. a murine or rat monoclonal antibody
- acceptor antibody e.g. a human antibody
- only one or more of the specificity determining residues from any one of the CDRs described herein above are transferred to the human antibody framework (see for example, Kashmiri et al., 2005, Methods, 36, 25-34).
- only the specificity determining residues from one or more of the CDRs described herein above are transferred to the human antibody framework.
- only the specificity determining residues from each of the CDRs described herein above are transferred to the human antibody framework.
- any appropriate acceptor variable region f amework sequence may be used having regard to the class/type of the donor antibody from which the CDRs are derived, including mouse, primate and human framework regions.
- the CDR-grafted antibody according to the present invention has a variable domain comprising human acceptor framework regions as well as one or more of the CDRs or specificity determining residues described above.
- a neutralising CDR-grafted antibody wherein the variable domain comprises human acceptor framework regions and non-human donor CDRs.
- KOL and NEWM can be used for the heavy chain
- REI can be used for the light chain
- EU can be used for the light chain
- TEI can be used for the light chain
- POM can be used for both the heavy chain and the light chain.
- human germline sequences may be used; these are available for example at: http://www.vbase2.org/ (see Retter et al, Nucl. Acids Res. (2005) 33 (supplement 1), D671-D674).
- the acceptor heavy and light chains do not necessarily need to be derived from the same antibody and may, if desired, comprise composite chains having framework regions derived from different chains.
- the framework regions need not have exactly the same sequence as those of the acceptor antibody. For instance, unusual residues may be changed to more frequently occurring residues for that acceptor chain class or type. Alternatively, selected residues in the acceptor framework regions may be changed so that they correspond to the residue found at the same position in the donor antibody (see Reichmann et al., 1998, Nature, 332, 323-324). Such changes should be kept to the minimum necessary to recover the affinity of the donor antibody.
- a protocol for selecting residues in the acceptor framework regions which may need to be changed is set forth in WO 91/09967.
- antibodies may undergo a variety of posttranslational modifications.
- the type and extent of these modifications often depends on the host cell line used to express the antibody as well as the culture conditions.
- modifications may include variations in glycosylation, methionine oxidation, diketopiperazine formation, aspartate isomerization and asparagine
- the antibody heavy chain comprises a CHI domain and the antibody light chain comprises a CL domain, either kappa or lambda.
- Biological molecules such as antibodies or fragments, contain acidic and/or basic functional groups, thereby giving the molecule a net positive or negative charge.
- the amount of overall "observed" charge will depend on the absolute amino acid sequence of the entity, the local environment of the charged groups in the 3D structure and the environmental conditions of the molecule.
- the isoelectric point (pi) is the pH at which a particular molecule or surface carries no net electrical charge.
- the antibody or fragment according to the present disclosure has an isoelectric point (pi) of at least 7.
- the antibody or fragment has an isoelectric point of at least 8, such as 8.5, 8.6, 8.7, 8.8 or 9.
- the pi of the antibody is 8.
- Antibodies which bind to the epitope disclosed herein may comprise at least one, at least two or all three heavy chain CDR sequences of SEQ ID NOS: 4 to 6
- HCDR1/HCDR2/HCDR3 are the HCDR1/HCDR2/HCDR3 sequences of the Ab 7326 antibody of the Examples as determined using Kabat methodology.
- the Kabat and Chothia methods for determining CDR sequences are well known in the art (as well as other techniques). CDR sequences may be determined using any appropriate method and in the present invention, whilst Kabat is typically employed, other techniques could be used as well.
- SEQ ID NO: 3 presents the Ab 7326 HCDR1 sequence as determined using a combined Chothia & Kabat defintion.
- Antibodies of the invention may comprise at least one, at least two or all three light chain CDR sequences of SEQ ID NOS: 7 to 9 (LCDR1/LCDR2/LCDR3
- the antibody preferably comprises at least a HCDR3 sequence of SEQ ID NO: 6.
- the antibody comprises at least one heavy chain CDR sequence selected from SEQ ID NOS: 3 to 5 and at least one light chain CDR sequence selected from SEQ ID NOS 7 to 9.
- the antibody may comprise at least two heavy chain CDR sequences selected from SEQ ID NOS: 3 to 5 and at least two light chain CDR sequences selected from SEQ ID NOS: 7 to 9.
- the antibody typically comprises all three heavy chain CDR sequences of SEQ ID NOS: 3 to 5 (HCDR1/HCDR2/HCDR3 respectively) and all three light chain CDR sequences SEQ ID NOS: 7 to 9 (LCDR1/LCDR2/LCDR3 respectively).
- the antibodies may be chimeric, human or humanised antibodies.
- the antibody may comprise a heavy chain variable region (HCVR) sequence of SEQ ID NO: 10 or 12 (the HCVR of Ab 7326 variants 1 and 2).
- the antibody may comprise a light chain variable region (LCVR) sequence of SEQ ID NO: 11 or 13 (the LCVR of Ab 7326 variants 1 and 2).
- the antibody preferably comprises the heavy chain variable region sequence of SEQ ID NO: 10 or 12 and the light chain variable region sequence of SEQ ID NO: 11 or 13 (especially HCVR/LVCR pairs of SEQ ID NOs: 10/11 or 12/13).
- the antibody may comprise a heavy chain (H-chain) sequence of
- SEQ ID NO: 14 mouse full length IgGl heavy chain variant 1, or
- SEQ ID NO: 28 mouse full length IgGl heavy chain variant 2, or
- SEQ ID NO: 22 human full length IgG4P heavy chain variant 1, or
- SEQ ID NO: 34 human full-length IgG4P heavy chain variant 2, or
- the antibody may comprise a light chain (L-chain) sequence of
- SEQ ID NO: 31 human full length IgGl light chain variant 1 , or
- SEQ ID NO: 17 human full length IgGl light chain variant 2, or
- SEQ ID NO: 23 human full length IgG4P light chain variant 1, or
- SEQ ID NO: 35 human full-length IgG4P light chain variant 2, or
- the antibody comprises a heavy chain / light chain sequence pair of
- the antibody may comprise a heavy chain / light chain sequence pair of
- the antibodies may be chimeric, human or humanised antibodies.
- the antibody may alternatively be or may comprise a variant of one of the specific sequences recited above.
- a variant may be a substitution, deletion or addition variant of any of the above amino acid sequences.
- a variant antibody may comprise 1, 2, 3, 4, 5, up to 10, up to 20 or more (typically up to a maximum of 50) amino acid substitutions and/or deletions from the specific sequences discussed above.
- “Deletion” variants may comprise the deletion of individual amino acids, deletion of small groups of amino acids such as 2, 3, 4 or 5 amino acids, or deletion of larger amino acid regions, such as the deletion of specific amino acid domains or other features.
- “Substitution” variants typically involve the replacement of one or more amino acids with the same number of amino acids and making conservative amino acid substitutions.
- an amino acid may be substituted with an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- Derivatives or “variants” generally include those in which instead of the naturally occurring amino acid the amino acid which appears in the sequence is a structural analog thereof. Amino acids used in the sequences may also be derivatized or modified, e.g. labelled, providing the function of the antibody is not significantly adversely affected.
- Derivatives and variants as described above may be prepared during synthesis of the antibody or by post- production modification, or when the antibody is in recombinant form using the known techniques of site- directed mutagenesis, random mutagenesis, or enzymatic cleavage and/or ligation of nucleic acids.
- Variant antibodies may have an amino acid sequence which has more than about 60%, or more than about 70%, e.g. 75 or 80%, typically more than about 85%, e.g. more than about 90 or 95% amino acid identity to the amino acid sequences disclosed herein (particularly the HCVR/LCVR sequences and the H- and L-chain sequences).
- the antibody may be a variant which has more than about 60%, or more than about 70%, e.g. 75 or 80%, typically more than about 85%, e.g. more than about 90 or 95% amino acid identity to the HCVR/LCVR sequences and the H- and L-chain sequences disclosed herein, whilst retaining the exact CDRs disclosed for these sequences.
- Variants may retain at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the HCVR/LCVR sequences and to the H- and L-chain sequences disclosed herein (in some circumstances whilst retaining the exact CDRs).
- Variants typically retain about 60% - about 99% identity, about 80% - about 99% identity, about 90% - about 99% identity or about 95% - about 99% identity. This level of amino acid identity may be seen across the full length of the relevant SEQ ID NO sequence or over a part of the sequence, such as across about 20, 30, 50, 75, 100, 150, 200 or more amino acids, depending on the size of the full length polypeptide.
- sequence identity refers to sequences which have the stated value when assessed using ClustalW (Thompson et al., 1994, supra) with the following parameters:
- Pairwise alignment parameters -Method accurate, Matrix: PAM, Gap open penalty: 10.00, Gap extension penalty: 0.10;
- Antibodies having specific sequences and variants which maintain the function or activity of these chains are therefore provided.
- Antibodies may compete for binding to Gremlin- 1 with, or bind to the same epitope as, those defined above in terms of H-chain L-chain, HCVR/LCVR or CDR sequences.
- an antibody may compete for binding to Gremlin- 1 with, or bind to the same epitope as, an antibody which comprises a
- An antibody may compete for binding to Gremlin- 1 with, or bind to the same epitope as, an antibody which comprises a HCVR and LCVR sequence pair of SEQ ID NOs: 10/11 or 12/13 or full length chains of SEQ ID Nos: 14/15 or 16/17.
- epitope is a region of an antigen that is bound by an antibody.
- Epitopes may be defined as structural or functional. Functional epitopes are generally a subset of the structural epitopes and have those residues that directly contribute to the affinity of the interaction. Epitopes may also be conformational, that is, composed of non-linear amino acids. In certain embodiments, epitopes may include determinants that are chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl groups, or sulfonyl groups, and, in certain embodiments, may have specific three-dimensional structural characteristics, and/or specific charge characteristics.
- the above-described binding methodology is performed in two orientations. In a first orientation, the reference antibody is allowed to bind to a protein/peptide under saturating conditions followed by assessment of binding of the test antibody to the protein/peptide molecule. In a second orientation, the test antibody is allowed to bind to the
- an antibody that competes for binding with a reference antibody may not necessarily bind to the identical epitope as the reference antibody, but may sterically block binding of the reference antibody by binding an overlapping or adjacent epitope. Two antibodies bind to the same or overlapping epitope if each competitively inhibits (blocks) binding of the other to the antigen.
- a 1-, 5-, 10-, 20- or 100-fold excess of one antibody inhibits binding of the other by at least 50%, 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et al., Cancer Res, 1990:50:1495-1502).
- two antibodies have the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Two antibodies have overlapping epitopes if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Additional routine experimentation e.g., peptide mutation and binding analyses
- peptide mutation and binding analyses can then be carried out to confirm whether the observed lack of binding of the test antibody is in fact due to binding to the same epitope as the reference antibody or if steric blocking (or another phenomenon) is responsible for the lack of observed binding.
- Antibodies can be tested for binding to Gremlin- 1 by, for example, standard ELISA or Western blotting.
- An ELISA assay can also be used to screen for hybridomas that show positive reactivity with the target protein.
- the binding selectivity of an antibody may also be determined by monitoring binding of the antibody to cells expressing the target protein, for example by flow cytometry.
- a screening method may comprise the step of identifying an antibody that is capable of binding Gremlin- 1 by carrying out an ELISA or Western blot or by flow cytometry.
- Antibodies may selectively (or specifically) recognise Gremlin- 1.
- An antibody, or other compound "selectively binds” or “selectively recognises” a protein when it binds with preferential or high affinity to the protein for which it is selective but does not substantially bind, or binds with low affinity, to other proteins.
- the selectivity of an antibody may be further studied by determining whether or not the antibody binds to other related proteins as discussed above or whether it discriminates between them.
- Antibodies of the invention typically recognise human Gremlin- 1.
- Antibodies may also have cross-reactivity for related proteins, or for human Gremlin- 1 and for Gremlin- 1 from other species.
- the antibody binds to the protein of interest with no significant cross-reactivity to any other molecule.
- Cross- reactivity may be assessed by any suitable method described herein.
- Cross-reactivity of an antibody may be considered significant if the antibody binds to the other molecule at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 100% as strongly as it binds to the protein of interest.
- An antibody that is specific (or selective) may bind to another molecule at less than about 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25% or 20% the strength that it binds to the protein of interest.
- the antibody may bind to the other molecule at less than about 20%, less than about 15%, less than about 10% or less than about 5%, less than about 2% or less than about 1% the strength that it binds to the protein of interest.
- WO2014/159010A1 (Regeneron) describes anti-gremlin antibodies that inhibit Gremlin- 1 activity, with binding affinity KD values ranging from 625pM to 270nM at 25°C.
- Ciuclan et al (2013) describe an anti-Gremlin- 1 monoclonal antibody with a binding affinity KD 5.6 x 10 10 M.
- the anti-Gremlin- 1 antibodies of the invention are allosteric inhibitors of
- Gremlin- 1 activity and bind to a novel epitope, distal from the BMP binding site.
- the antibodies bind to Gremlin- 1 with exceptionally high affinity with Kd values ⁇ 100pM.
- the antibodies of the invention therefore represent a significant improvement over currently available antibodies and are expected to be particularly useful for the treatment of Gremlin- 1 mediated diseases.
- antibodies suitable for use with the present invention may have a high affinity binding for (human) Gremlin- 1.
- the antibody may have a dissociation constant (KD) of less than ⁇ 1 nM, and preferably ⁇ 500 pM.
- the antibody has a dissociation constant (KD) of less than 200pM.
- the antibody has a dissociation constant (KD) of less than ⁇ .
- KD dissociation constant
- a variety of methods can be used to determine the binding affinity of an antibody for its target antigen such as surface plasmon resonance assays, saturation assays, or immunoassays such as ELISAor RIA, as are well known to persons of skill in the art.
- An exemplary method for determining binding affinity is by surface plasmon resonance analysis on a BIAcoreTM 2000 instrument (Biacore AB, Freiburg, Germany) using CM5 sensor chips, as described by Krinner et al., (2007) Mol. Immunol. February; 44 (5):916-25. (Epub 2006 May 11)).
- Antibodies of the invention are typically inhibitory antibodies.
- Gremlin- 1 negatively regulates BMP-2, 4 and 7, so inhibition of Gremlin- 1 results in increased signalling through BMP.
- an inhibitory antibody restores SMAD phosphorylation and/or restores signalling of BMP in the Hek Idl reporter gene assay.
- SMAD phosphorylation may be restored to at least 80 %, 90 % or 100 % when compared with a BMP control.
- an inhibitory antibody may have an ICso of less than 10 nM, preferably less than 5 nM.
- the amino acid sequence of the antibody may be identified by methods known in the art.
- the genes encoding the antibody can be cloned using degenerate primers.
- the antibody may be recombinantly produced by routine methods.
- the present invention also provides an isolated DNA sequence encoding the heavy and/or light chain variable regjons(s) (or the full length H- and L-chains) of an antibody molecule of the present invention.
- a variant polynucleotide may comprise 1, 2, 3, 4, 5, up to 10, up to 20, up to 30, up to 40, up to 50, up to 75 or more nucleic acid substitutions and/or deletions from the sequences given in the sequence listing. Generally, a variant has 1-20, 1-50, 1-75 or 1- 100 substitutions and/or deletions.
- Suitable variants may be at least about 70% homologous to a polynucleotide of any one of nucleic acid sequences disclosed herein, typically at least about 80 or 90% and more suitably at least about 95%, 97% or 99% homologous thereto. Variants may retain at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity.
- Variants typically retain about 60% - about 99% identity, about 80% - about 99% identity, about 90% - about 99% identity or about 95% - about 99% identity.
- Homology and identity at these levels is generally present at least with respect to the coding regions of the polynucleotides. Methods of measuring homology are well known in the art and it will be understood by those of skill in the art that in the present context, homology is calculated on the basis of nucleic acid identity. Such homology may exist over a region of at least about 15, at least about 30, for instance at least about 40, 60, 100, 200 or more contiguous nucleotides (depending on the length). Such homology may exist over the entire length of the unmodified polynucleotide sequence.
- the PILEUP and BLAST algorithms can also be used to calculate homology or line up sequences (typically on their default settings), for example as described in
- HSPs high scoring sequence pair
- Extensions for the word hits in each direction are halted when: the cumulative alignment score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm performs a statistical analysis of the similarity between two sequences; see e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787.
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a sequence is considered similar to another sequence if the smallest sum probability in comparison of the first sequence to the second sequence is less than about 1 , typically less than about 0.1, suitablyless than about 0.01, and most suitably less than about 0.001.
- the smallest sum probability may be in the range of about 1 - about 0.001, often about 0.01 - about 0.001.
- the homologue may differ from a sequence in the relevant polynucleotide by less than about 3, 5, 10, 15, 20 or more mutations (each of which may be a substitution, deletion or insertion).
- the homologue may differ by 3-50 mutations, often 3-20 mutations. These mutations may be measured over a region of at least 30, for instance at least about 40, 60 or 100 or more contiguous nucleotides of the homologue.
- a variant sequence may vary from the specific sequences given in the sequence listing by virtue of the redundancy in the genetic code.
- the DNA code has 4 primary nucleic acid residues (A, T, C and G) and uses these to "spell" three letter codons which represent the amino acids the proteins encoded in an organism's genes.
- the linear sequence of codons along the DNA molecule is translated into the linear sequence of amino acids in the protein(s) encoded by those genes.
- the code is highly degenerate, with 61 codons coding for the 20 natural amino acids and 3 codons representing "stop" signals. Thus, most amino acids are coded for by more than one codon - in fact several are coded for by four or more different codons.
- a variant polynucleotide of the invention may therefore encode the same polypeptide sequence as another polynucleotide of the invention, but may have a different nucleic acid sequence due to the use of different codons to encode the same amino acids.
- the DNA sequence of the present invention may comprise synthetic DNA, for instance produced by chemical processing, cDNA, genomic DNA or any combination thereof.
- DNA sequences which encode an antibody molecule of the present invention be obtained by methods well known to those skilled in the art.
- DNA sequences coding for part or all of the antibody heavy and light chains may be synthesised as desired from the determined DNA sequences or on the basis of the corresponding amino acid sequences.
- a host cell comprising one or more cloning or expression vectors comprising one or more DNA sequences encoding an antibody of the present invention.
- Any suitable host cell/vector system may be used for expression of the DNA sequences encoding the antibody molecule of the present invention.
- Bacterial, for example E. coli, and other microbial systems may be used or eukaryotic, for example mammalian, host cell expression systems may also be used.
- Suitable mammalian host cells include CHO, myeloma or hybridoma cells.
- the present invention also provides a process for the production of an antibody molecule according to the present invention comprising culturing a host cell containing a vector of the present invention under conditions suitable for leading to expression of protein from DNA encoding the antibody molecule of the present invention, and isolating the antibody molecule.
- the Ab 7326 antibody of the invention has been identified to bind the following residues of Gremlin-1: Ilel10 (131), Lysl26 (147), Lysl27 (148), Phel28 (149), Thrl29 (150), Thrl30 (151), Argl48 (169), Lysl53 (174) and Glnl54 (175), where Lysl26 (147), Lysl27 (148), Phel28 (149), Thrl29 (150), Thrl30 (151), Argl48 (169), Lysl53 (174) and Gin 154 (175) are present on one Gremlin-1 monomer and Ilel10 (131) is present on the second Gremlin-1 monomer.
- Numbering not in brackets is based on the structural file and (which matches the numbering of mouse Gremlin- 2 based on structural alignment).
- the numbers in brackets represent the residues based on the UniProt entry 060565 of SEQ ID NO: 1. As discussed in the Examples section, these epitope residues were identified using NCONT analysis at 4 A from the Gremlin- 1-Ab 7326 Fab complex.
- Antibodies of the invention may therefore bind to an epitope which comprises at least one residue selected from Ilel31, Lysl47, Lysl48, Phel49, Thrl50, Thrl51, Argl69, Lysl74 and Glnl75 (with residue numbering based on SEQ ID NO: 1).
- Antibodies of the invention may bind an epitope which comprises 2, 3, 4, 5, 6, 7, 8 or all 9 of these residues (preferably at least 5 residues).
- Antibodies of the invention may also recognise an epitope where He 131 is present on a different Gremlin- 1 monomer to the other residues.
- a routine cross-blocking assay such as that described in Antibodies, Harlow and Lane (Cold Spring Harbor Press, Cold Spring Harb., NY) can be performed.
- Other methods include alanine scanning mutants, peptide blots (Reineke (2004) Methods Mol Biol 248:443-63), or peptide cleavage analysis.
- methods such as epitope excision, epitope extraction and chemical modification of antigens can be employed (Tomer (2000) Protein Science 9: 487-496). Such methods are well known in the art.
- Antibody epitopes may also be determined by x-ray crystallography analysis. Antibodies of the present invention may therefore be assessed through x-ray crystallogray analysis of the antibody bound to Gremlin- 1. Epitopes may, in particular, be identified in this way by determining residues on Gremlin- 1 within 4 A of an antibody paratope residue.
- An antibody of the invention, or an agent which modulates Gremlin- 1 identified by the screening methods, may be provided in a pharmaceutical composition.
- the pharmaceutical composition will normally be sterile and will typically include a
- a pharmaceutical composition of the present invention may additionally comprise a pharmaceutically acceptable adjuvant and/or carrier.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier may be suitable for parenteral, e.g. intravenous, intramuscular, intradermal, intraocular, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- the carrier may be suitable for non- parenteral administration, such as a topical, epidermal or mucosal route of administration.
- the carrier may be suitable for oral administration.
- the modulator may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- compositions of the invention may include one or more pharmaceutically acceptable salts.
- a "pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicologjcal effects. Examples of such salts include acid addition salts and base addition salts.
- Pharmaceutically acceptable carriers comprise aqueous carriers or diluents.
- aqueous carriers examples include water, buffered water and saline.
- suitable aqueous carriers include water, buffered water and saline.
- suitable aqueous carriers include ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- compositions of the invention may comprise additional active ingredients.
- kits comprising antibodies or modulatory agents of the invention and instructions for use.
- the kit may further contain one or more additional reagents, such as an additional therapeutic or prophylactic agent as discussed above.
- compositions thereof may be administered for prophylactic and/or therapeutic treatments.
- compounds are administered to a subject already suffering from a disorder or condition as described above, in an amount sufficient to cure, alleviate or partially arrest the condition or one or more of its symptoms.
- Such therapeutic treatment may result in a decrease in severity of disease symptoms, or an increase in frequency or duration of symptom-free periods.
- An amount adequate to accomplish this is defined as a "therapeutically effective amount”.
- formulations are administered to a subject at risk of a disorder or condition as described above, in an amount sufficient to prevent or reduce the subsequent effects of the condition or one or more of its symptoms.
- An amount adequate to accomplish this is defined as a "prophylactically effective amount'. Effective amounts for each purpose will depend on the severity of the disease or injury as well as the weight and general state of the subject.
- a subject for administration may be a human or non-human animal.
- non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dogs, cats, horses, cows, chickens, amphibians, reptiles, etc. Administration to humans is typical.
- An antibody/modulator or pharmaceutical composition of the invention may be administered via one or more routes of administration using one or more of a variety of methods known in the art.
- routes of administration for compounds or pharmaceutical compositions of the invention include intravenous, intramuscular, intradermal, intraocular, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration as used herein means modes of administration other than enteral and topical administration, usually by injection.
- antibody/modulatory agent or pharmaceutical composition of the invention can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration.
- the antibody/modulatory agent or pharmaceutical composition of the invention may be for oral administration.
- a suitable dosage of an antibody/modulatory agent or pharmaceutical composition of the invention may be determined by a skilled medical practitioner. Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- a suitable dose may be, for example, in the range of from about 0.01 ⁇ g/kg to about 1000mg kg body weight, typically from about 0.1 ⁇ g/kg to about 100mg kg body weight, of the patient to be treated.
- a suitable dosage may be from about 1 ⁇ g kg to about 10mg kg body weight per day or from about 10 ⁇ g kg to about 5 mg kg body weight per day.
- Dosage regimens may be adjusted to provide the optimum desired response ⁇ e.g., a therapeutic response). For example, a single dose may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. Administration may be in single or multiple doses. Multiple doses may be administered via the same or different routes and to the same or different locations.
- doses can be via a sustained release formulation, in which case less frequent administration is required. Dosage and frequency may vary depending on the half-life of the antagonist in the patient and the duration of treatment desired.
- modulators/antibodies or pharmaceutical compositions of the invention may be co-administered with one or other more other therapeutic agents.
- Combined administration of two or more agents may be achieved in a number of different ways. Both may be administered together in a single composition, or they may be administered in separate compositions as part of a combined therapy. For example, the one may be administered before, after or concurrently with the other.
- Antibodies of present invention, or modulatory agents identified by the screening methods of the invention may be used in treating, preventing or ameliorating any condition that associated with Gremlin- 1 activity.
- any condition which results in whole or in part from signalling through Gremlin- 1.
- the invention relates to the treatment, prevention or amelioration of conditions mediated or influenced by Gremlin.
- Such conditions include fibrotic disease including renal fibrosis (e.g. diabetic nephropathy and chronic allograft nephropathy) and idiopathic pulmonary fibrosis, pulmonary arterial hypertension, angjongenesis and cancer (e.g. colorectal cancer).
- renal fibrosis e.g. diabetic nephropathy and chronic allograft nephropathy
- idiopathic pulmonary fibrosis pulmonary arterial hypertension
- angjongenesis e.g. colorectal cancer
- a truncated human Gremlin- 1 coding sequence (SEQ ID NO: 20), optimised for expression in E.coli, was cloned into a modified pET32a vector (Merck Millipore) using BamHI/XhoI, generating a vector encoding the Gremlin sequence with an N-terminal 6His-TEV tag (pET-hGremlinl).
- the pET-hGremlinl plasmid DNA was used to transform BL21(DE3) cells.
- a single ampicillin resistant colony was picked from a LB/Amp agar plate and used to inoculate a 100 ml starter culture of LB/Amp. After shaking (200 rpm) for 16 hr at 37 °C, 25 ml of the starter culture was used to inoculate 500 mL of 2xTY/Amp media. The culture was shaken (250 rpm) at 37 °C until an ⁇ D 600 of 3 was achieved.
- the culture was supplemented with 20 mL of a MOPS + glycerol feed mix (1M MOPS pH 7.4, 40 % glycerol, 0.5 % MgS0 4 , 0.42 % MgCI 2 ), induced with 300 ⁇ IPTG and further incubated at 17 °C, 180 rpm for 16 hours.
- Cells were harvested in a centrifuge (4,000 g for 20 minutes at 4 °C).
- Lysis Buffer PBS pH 7.4, 0.35 mg/ml lysozyme, 10 ⁇ g/ml DNase and 3 mM MgCl 2
- the insoluble fraction was harvested by centrifugation at 3,500 g for 30 minutes at 4 °C.
- Pelleted inclusion bodies were washed three times by resuspending in wash buffer (50 mM Tris, 500 mM NaCl, 0.5 % Triton X- 100, pH 8.0), followed by centrifugation at 21,000 g for 15 minutes. An additional two washes were performed using wash buffer without Triton X-100.
- Inclusion bodies were resuspended in denaturing buffer (8 M Urea, 100 mM Tris, 1 mM EDTA, 10 mM Na 2 S406 and 100 mM Na 2 SO3, pH 8.5), stirred for 16 hrs at room- temperature and clarified by centrifugation at 21,000 g for 15 minutes. Pre-refoldine purification
- the solubilized inclusion bodies were loaded onto a Sephacryl S-200 26/60 column (120 mL) equilibrated in 8 M Urea, 50 mM MES, 200 mM NaCl, 1 mM EDTA, pH 6.0.
- Fractions containing Gremlin- 1 protein were diluted with 6 M Urea, 20 mM MES, pH 6.0 and loaded onto HiTrap SP HP cation exchange columns and eluted with a 1 M NaCl gradient over 10 column volumes (10 CVs).
- Fractions containing purified, denatured hGremlin-1 protein were pooled.
- Denatured purified Gremlin- 1 protein was added drop- wise to re-folding buffer (50 mM Tris, pH 8.5, 150 mM NaCl, 5 mM GSH and 5 mM GSSG, 0.5 mM Cysteine, 5 mM EDTA, 0.5 M Argimne) to a final concentration of 0.1 mg/ml and incubated at 4 °C with constant stirring for 5 days. After 5 days the Gremlin- 1 protein was dialysed against 20 mM HEPES, 100 mM NaCl, pH 7.5.
- re-folding buffer 50 mM Tris, pH 8.5, 150 mM NaCl, 5 mM GSH and 5 mM GSSG, 0.5 mM Cysteine, 5 mM EDTA, 0.5 M Argimne
- Protein during at 1 M NaCl was concentrated and purified further on a S75 26/60 column equilibrated with 20 mM Hepes, pH 7.5, 1 M NaCl.
- Protein was characterised by SDS PAGE (shift in gel), demonstrated to have the expected molecular weight and correct arrangement of disulphide bonds using liquid chromatography mass spectrometry (LC-MS) and to be active in a cell assay (ID1 reporter assay).
- Gremlin 1 protein crystals were grown using the hanging-drop method by mixing a solution of Gremlin 1 at 6.6 mg/ml and 0.1 M citric acid at pH 4, 1 M lithium chloride and 27 % polyethylene glycol (PEG) 6000 in a 1 : 1 ratio. Before data collection, crystals were cryo -protected by adding 20 % glycerol to the crystallization buffer. Diffraction data were collected at the Diamond Light Source and were processed using XDS (Kabsch, Wolfgang (2010) Acta Crystallographica Section D 66, 125—132). Diffraction data statistics are summarized in the table below:
- Gremlin- 1 structure was solved by molecular replacement using Phaser (McCoy et al, J Appl Cryst (2007), 40, 658-674) and a Gremlin- 1 model available from proprietary Gremlin- 1 / Fab complex coordinates.
- the resultant model of Gremlin- 1 contained four copies of Gremlin 1 monomer organised as two (timers. Model corrections were made with Coot (Emsley et al Acta Crystallographica Section D: Biological Crystallography 66 (4), 486-501) and coordinates were refined using Refmac (Murshudov et al REFMAC5 for the refinement of macromolecular crystal structures.
- Gremlin- 1 belongs to the bone morphogenic protein (BMP) antagonist protein family within a sub-group known as the DAN family. Within the DAN family, Gremlin- 1 shares greatest homology with Gremlin- 2 (PRDC).
- BMP bone morphogenic protein
- NBLl DAN
- mutagenesis Nolan et al (2013), Structure, 21, 1417-1429 and Nolan et al (2014) J. Biol. Chem. 290, 4759-4771.
- the predicted BMP binding epitope encompasses a hydrophobic patch spanning across both monomers on the convex surface of the dimer ( Figures 4 and 5).
- Six residues were identified by mutagenesis; Trp72, Phe96, Tyr98, Phel04, Tyrl05 & Phel 17 and are 100 % conserved in human Gremlin- 1 (numbering based on the mouse Gremlin-2 sequence).
- the degree of homology extends to the positioning of the side chains which adopt an identical conformation in both proteins (Figure 5).
- the amino acid numbering used in the Gremlin PDB file matches the numbering in the published mouse Gremlin-2 structure based on a structural alignment. This enables like for like comparison of amino acids when describing the structures. However, for clarity the key residues identified as playing a role in BMP binding are shown below with numbering based on the PDB file and UniProt file of SEQ ID NO: 1 in brackets:
- the Hek Idl reporter gene assay uses Clone 12 Hek293-Idl reporter cells. This cell line was stably transfected with Idl transcription factor. Idl is a transcription factor in the BMP signalling pathway. Gremlin is known to bind BMPs prevent binding to their receptors reducing the luciferase signal from the reporter gene. Therefore, using this reporter assay, it is possible to screen anti-Gremlin antibodies and see if there are any that block the interaction of Gremlin with BMPs. A restoration of the luciferase signal is seen in these cells if there is a blocking of this interaction.
- Method Clone 12 cells were cultured in DMEM containing 10 % FCS, lx L-Glutamine & lx NEAA. Cells are also grown in the presence of Hygromycin B (200 ⁇ g/ml) to ensure cells do not lose Idl gene expression. Cells were assayed in DMEM containing 0.5 % FCS, lx L-Glutamine & lx NEAA. Hygromycin B is not needed for the short time that the cells are in the assay.
- the cells were washed in PBS, lifted off using cell dissociation buffer, spun and counted before being seeded at 5xl04/well in 70 ⁇ l (Density of 7.14xl0 5 /ml). Plates used were white, opaque Poly-D-Lysine coated 96-well sterile. Cells go in incubator for about 3-4 hours to settle down. BMP heterodimers were reconstituted to 200 ⁇ g/ml in 4 mM HCL. BMP was diluted to 10 ⁇ g/ml in assay media using a glass vial to give a new working stock.
- Gremlin- 1 was diluted 1 :2 for an 8 point dose response curve with a top final dose of 1 ⁇ g/ml.
- Cell Steady Glo was thawed in advance at room temperature. Assay plates were cooled to room temperature for about 10-15 mins before adding the reagent. Luciferase signal was detected by addition of cell steady glo reagent (100 ⁇ l) for 20 minutes on shaker at room temperature and measuring luminescence using cell titre glo protocol on Synergy 2. The maximum signal was generated from wells containing BMP and the minimum signal was generated from the wells containing cells only.
- Gremlin- 1 full length and truncated forms were tested in the Hek-Idl reporter gene assay to confirm the blocking activity against BMP4/7. Results for full length protein are shown in Figure 6A and results for truncated protein are shown in Figure 6B. The percentage of inhibition from dose response assays was calculated based on the maximum and minimum signals in the assay and the data fitted using 4 parameter logistical fit. The ICso was calculated based on the inflexion point of the curve.
- Table 3 Potency results for full length Gremlin- 1 and truncated Gremlin- 1 in the Hek-Idl reporter gene assay.
- Gremlin 1 was able to inhibit the BMP 4/7 signalling in the Hek-Idl reporter gene assay.
- Anti-Gremlin- 1 antibodies were derived by immunisation and library panning.
- the library was generated in-house as a naive human library with the V-regions amplified from blood donations. Immunisation yielded 26 distinct antibodies binding Gremlin- 1 from the first round of immunisation. These antibodies were scaled up and purified for testing in screening assays.
- Antibodies were screened using the Hek-Idl reporter gene assay described in Example 3 and by measuring SMAD phosphorylation. SMAD1, 5 and 8 are
- Inhibitors of Gremlin- 1 therefore increase SMAD phosphorylation.
- SMAD phosphorylation assays were conducted on A549 cells or on human lung fibroblasts. Phosphorylation levels were determined using MSD.
- Ab7326 came from a naive human library, where Abs are cloned as scFvs, in order to re-clone the 7326 variable regions as full length Abs or Fabs, it was necessary to PCR amplify the VH and VK using pools of primers/degenerate primers. The amplified PCR products were then digested and cloned simultaneously into mouse and human vectors. As the VH and VK were amplified by pools of primers/degenerate primers, two variant forms of the products were obtained, differing by a single amino acid residue derived from subtly different primers annealing during the PCR process.
- the two variant forms of heavy chain variable region differed by a single amino acid at position 6, and the two variant forms of the light chain variable region differed by a single amino acid at position 7, as shown below:
- Heavy chain variable region variant 1 has glutamic acid (E) at position 6.
- Heavy chain variable region variant 2 has glutamine (Q) at position 6.
- Light chain variable region variant 1 has serine (S) at position 7.
- Light chain variable region variant 2 has threonine (T) at position 7.
- DIVMTQSPDS LAVSLGERAT INCKSSQSVL YSSNNKNYLA WYQQKPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT INSLQAEDVA VYFCQQYYDT PTFGQGTRLE IKRTDAAPTV SIFPPSSEQL TSGGASWCF LNNFYPKDIN
- DIVMTQTPDS LAVSLGERAT INCKSSQSVL YSSNNKNYLA WYQQKPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT INSLQAEDVA VYFCQQYYDT PTFGQGTRLE IKRTDAAPTV SIFPPSSEQL TSGGASWCF LNNFYPKDIN VKWKIDGSER QNGVLNSWTD QDSKDSTYSM SSTLTLTKDE YERHNSYTCE ATHKTSTSPI VKSFNRNEC
- DIVMTQSPDS LAVSLGERAT INCKSSQSVL YSSNNKNYLA WYQQKPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT INSLQAEDVA VYFCQQYYDT PTFGQGTRLE IKRTVAAPSV FIFPPSDEQL KSGTASWCL LNNFYPREAK VQWKVDNALQ SGNSQESVTE QDSKDSTYSL SSTLTLSKAD YEKHKVYACE VTHQGLSSPV TKSFNRGEC
- DIVMTQTPDS LAVSLGERAT INCKSSQSVL YSSNNKNYLA WYQQKPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT INSLQAEDVA VYFCQQYYDT PTFGQGTRLE IKRTVAAPSV FIFPPSDEQL KSGTASWCL LNNFYPREAK VQWKVDNALQ SGNSQESVTE QDSKDSTYSL SSTLTLSKAD YEKHKVYACE VTHQGLSSPV TKSFNRGEC
- Antibody CDRs were determined using the Kabat method (highlighted in bold in the above sequences). Additional HCDR1 residues using the Chothia definition are in italics. Constant region sequences are also underlined. Restoration of p-SMAD signalling with anti-Gremlin 1 antibodies is shown in
- Results are shown as a percentage of SM AD phosphorylation by BMP alone (control BMP).
- Experiments were performed using lung fibroblasts from idiopathic pulmonary fibrosis patients. rhGremlin-1 and the anti-Gremlin- 1 antibodies were preincubated for 45 minutes at room temperature. rhGremlin-1 and the anti-Gremlin- 1 antibodies were then added with BMP to the cells for 30 minutes.
- Table 5 shows further results in the SMAD phosphorylation assay, where displacement of BMP-2 or BMP4/7 from Gremlin 1 -BMP complexes by anti-Gremlin- 1 antibodies was investigated. Experiments were again performed using lung fibroblasts from idiopathic pulmonary fibrosis patients. rhBMP-2 or rhBMP 4/7 were preincubated with rhGremlin-1 for 1 hour at room temperature. The BMP-2- or BMP4/7-Gremlin-l complexes were incubated with different concentrations of the anti-Gremlin- 1 antibodies overnight at 4 °C. Antibody concentrations represent the final concentration on the plate.
- the CCP4 software NCONT was then used to identify all contacts at 4 A between Gremlin-1 and the Fab.
- the following residues were identified: Ilel31, Lysl47, Lysl48, Phel49, Thrl50, Thrl51, Argl69, Lysl74 and Glnl75 (numbering based on the UniProt Sequence of SEQ ID NO: 1 (numbered as Ilel10, Lysl26, Lysl27, Phel28, Thrl29,
- Figure 10 shows structural models of the Gremlin-Fab complex, with the Fab epitope residues shown relative to the BMP binding regions.
- Ab 7326 is an inhibitory antibody which acts allosterically, i.e. it binds away from the BMP binding regions.
- Example 7 Affinity measurements for binding of anti-Gremlin-1 antibody Ab7326 to
- the affinity of anti-Gremlin mlgG for human Gremlin 1 was determined by biamolecular interaction analysis using surface plasmon resonance (SPR) technology on a Biacore T200 system, GE Healthcare Bio-Sciences AB.
- SPR surface plasmon resonance
- Anti-Gremlin mlgG was captured by an immobilised anti-mouse Fc surface and Gremlin 1 was titrated over the captured mlgG.
- the capture ligand (affinipure F(ab')2 fragment of goat anti-mouse IgG, Fc fragment specific, 115-006-071, Jackson ImmunoResearch Inc.) was immobilised at 50 ⁇ g/ml in 10mM NaAc, pH5.0 on flow cell 2 of a CM4 Sensor Chip via amine coupling chemistry, using 600s activation and deactivation injections, to a level of -1600 response units (RU).
- HBS-EP+ buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.05 % Surfactant P20) was used as the running buffer with a flow rate of ⁇ 0 ⁇ I/min.
- a reference surface was prepared on flow cell 1 by activating and deactivating the surface as for flow cell 2 but omitting the capture ligand.
- the assay buffer was HBS-EP+ plus an extra 150mM NaCl to give a final NaCl concentration of 300mM plus 1% CMD40.
- a 60s injection of anti-Gremlin mlgG (at 5 ⁇ g/ml in running buffer) was passed over flow cells 1 and 2 to give a capture level of approximately 100 RU on the immobilised anti-mouse IgG, Fc surface.
- Recombinant human Gremlin 1 was titrated in running buffer from 5nM (using 2-fold dilutions) and injected over flow cells 1 and 2 at a flow rate of 30 ⁇ I/min for 3min followed by a 5min dissociation phase.
- a buffer only control was also included.
- the surface was regenerated at a flow rate of ⁇ 0 ⁇ I/min by a 60s injection of 50mM HC1, a 30s injection of 5mM NaOH and a 30s injection of 50mM HC1.
- the kinetic data was determined using Biacore T200 evaluation software.
- Binding affinity taken as the average KD value for 5 determinations, was found to be below 100 pM.
- RVSP right ventricular systolic pressures
- Figure 12 and 15 Aclministration of anti-Gremlin- 1 led to a significant (P ⁇ 0.005) reduction in RVSP compared to IgGl and PBS control groups. No significant effect of anti-Gremlin- 1 was observed on RVSP in animals maintained in normoxia ( Figure 12). No effect was observed on systemic pressures (mean arterial blood pressure or MABP; Figure 13), or right heart hypertrophy ( Figure 14). Collectively this study supports the role of gremlin-1 in the
- Pulmonary hypertension is the hemodynamic state in which the pressure measured in the pulmonary artery is elevated. Clinically this is defined by a mean resting pulmonary arterial pressure (mPAP) that is >2S mmHg, pulmonary vascular resistance (PVR) > 3 Wood units and pulmonary wedge pressure ⁇ 15 mmHg (Badesch et al 2009).
- mPAP mean resting pulmonary arterial pressure
- PVR pulmonary vascular resistance
- the pathological characteristics of PH are multifaceted and include pulmonary arterial pressure, vascular remodelling of the small to medium arteries, right ventricular hypertrophy and ultimately right heart failure (Faber & Loscalzo 2004).
- PH is classified by the WHO into five major categories, including group I.
- Group I represents pulmonary arterial hypertension which includes idiopathic PAH and heritable PAH as well as associated PAH which results in conjunction with other complications such as systemic sclerosis (Simonneau et al 2009).
- a number of predisposing mutations have been linked to the development of PAH in heritable and idiopathic PAH patients the most predominant being mutations to the bone
- the purpose of the present study was to assess the in vivo effects of anti-Gremlin- 1 on development of PAH in the chronic hypoxia/SU5416 mouse model.
- Imatinib Science Warehouse 1625-1000.
- VWF antibody Dako A008202-2.
- Biotinylated Goat Anti-Rabbit IgG Antibody Vector Labs BA-1000.
- Carboxymethyl cellulose Sigma C5678 419273.
- VECTASTAIN ABC-AP Kit Vector Labs AK-5000.
- VECTASTAIN Elite ABC Kit Vector Labs PK-6100.
- mice were housed in a specific pathogen free facility, and had access to food and water ad libitum and were exposed to a 12 hour light dark cycle. This animal study was licensed under the UK Home Office Animals (Scientific Procedures) Act 1986.
- mice 8-10 week old C57B1/6 female mice were allocated to the groups (Table 6). All groups were weighed and administered subcutaneously (s.c.) with 20mg kg SU5416 in ⁇ of vehicle (0.5% carboxymethyl cellulose (CMC); 0.9% sodium chloride (NaCl); 0.4% polysorbate 80; 0.9% benzyl alcohol in deionized water), as described in Ciuclan et al AJRCCM 2013. As appropriate, a second s.c. injection was administered, as outlined in Table 6, containing either PBS, 30mg/kg IgGl, or 30mg/kg anti-Gremlin- 1.
- CMC carboxymethyl cellulose
- NaCl sodium chloride
- polysorbate 80 0.9% benzyl alcohol in deionized water
- mice in the Hypoxia + Imatinib group were given chow infused with Imatinib to deliver 10Omg kg/day.
- Hypoxia mouse groups were then placed into a normobaric hypoxia (10% 02) chamber, whilst the mice in the normoxia groups were housed in normoxic (21% 02)
- C57B1/6 mice were allocated to the treatment groups as indicated.
- mice On days 7 and 14 all mice were weighed, and received a further s.c. dose of 20mg/kg SUS416. As appropriate, mice were administered with a further s.c. injection of PBS, 30mg/kg IgGl, or 30mg/kg anti-Gremlin- 1, (as outlined in table 6).
- the anti- Gremlin- 1 antibody used in these studies was Ab7326 mouse full-length IgGl format, variant 1, as described in Example S.
- RVSP right ventricular systolic pressures
- MABP mean arterial blood pressure
- RVSP and MABP Hemodynamic measurements of RVSP and MABP were obtained from the animals after three weeks of hypoxia exposure and relevant drug treatment as outlined in table 6.
- the animals were anaesthetised with 1.5% isofluorane and placed supine onto a heating blanket that was thermostatically controlled at 37°C.
- a pressure catheter Millar mouse SPR-671NR pressure catheter with a diameter of 1.4F, Millar Instruments, UK
- MABP was measured by isolating the left common carotid artery and a pressure catheter introduced. Both RVSP and MABP were recorded onto a precalibrated PowerLab system (ADInstruments , Australia).
- Animals were euthanised by via isofluorane anaesthetic overdose and whole blood collected.
- the whole blood was centrifuged (220 x g; 2 min), and serum removed and stored at -80°C.
- the heart was removed and right and left ventricle weights recorded.
- Lungs were perfused with 2.5ml of saline via the right ventricle.
- the left lung was fixed by inflation with 10% formalin before paraffin embedding and sectioning.
- the right lung was snap frozen in liquid nitrogen and stored at -80°C.
- Slides were dewaxed and re-hydrated using xylene and a concentration gradient of ethanol. Slides were immersed in 0.3% H202 in methanol for 30 minutes to retrieve antigens, washed 3 times in PBS and blocked for 1 hour in 1:30 normal horse serum in PBS. Anti-aSMA primary antibody at a concentration of 1:100 was added to each slide and incubated at 4°C overnight, then rinsed in PBS for 5 minutes, three times. Biotinylated Horse Anti-Mouse IgG antibody, rat adsorbed secondary antibody was diluted 1:200 and pipetted onto each slide and incubated for 45 minutes; then washed in PBS 3 times for 5 minutes.
- avidin biotin complex alkaline phosphotase (ABC-AP) was prepared 30 minutes in advance and placed on each slide for 30 minutes; then washed 3 times for 5 minutes.
- AP substrate was prepared as per kit instructions and pipetted onto each slide and allowed to develop; then washed 3 times for 5 minutes.
- Anti-vWF primary antibody at a concentration of 1:100 was added to each slide and incubated at 4°C overnight, then rinsed in PBS for 5 minutes, three times.
- Biotinylated Goat Anti-Rabbit IgG secondary antibody was diluted 1:200 and left on each slide for 45 minutes; then washed in PBS 3 times for 5 minutes.
- Right heart hypertrophy (right ventricle/left ventricle + septum weights) were determined ( Figure 14).
- vWF Von Willebrand factor
- ASMA smooth muscle actin
- Ciuclan L Sheppard K, Dong L, Sutton D, Duggan N, Hussey M, Simmons J, Morrell NW, Jarai G, Edwards M, Dubois G, Thomas M, Van Heeke G, England K. Treatment with anti-gremlin 1 antibody ameliorates chronic hypoxia/SU5416-induced pulmonary arterial hypertension in mice. Am J Pathol. 2013 Nov;183(5):1461-73. doi:
- Ciuclan L Hussey MJ, Burton V, Good R, Duggan N, Beach S, Jones P, Fox R, Clay I, Bonneau O, Konstantinova I, Pearce A, Rowlands DJ, Jarai G, Westwick J, MacLean MR, Thomas M. Imatinib attenuates hypoxia-induced pulmonary arterial hypertension pathology via reduction in 5-hydroxytryptamine through inhibition of tryptophan hydroxylase 1 expression. Am J Respir Crit Care Med. 2013 Jan l;187(l):78-89. doi: 10.1164/rccm.201206-1028OC. PMJD:23087024 Farber HW, Loscalzo J. Pulmonary arterial hypertension. N Engl J Med. 2004 Oct 14;351(16):1655-65. Review. PMJD: 15483284.
- Activin- like kinase 5 mediates abnormal proliferation of vascular smooth muscle cells from patients with familial pulmonary arterial hypertension and is involved in the progression of experimental pulmonary arterial hypertension induced by monocrotaline. Am J Pathol. 2009 Feb;174(2):380-9. doi: 10.2353/ajpath.2009.080565. Epub 2008 Dec 30.
- GYTFTDYYMH SEQ ID NO: 4 (Ab 7326 HCDR1 Rabat)
- SEQ ID NO: 5 (Ab 7326 HCDR2 Rabat)
- SEQ ID NO: 6 (Ab 7326 HCDR3 Rabat)
- SEQ ID NO: 8 (Ab 7326 LCDR2 Rabat)
- SEQ ID NO: 9 (Ab 7326 LCDR3 Rabat)
- SEQ ID NO: 10 (Ab 7326 Heavy chain variable region variant 1)
- SEQ ID NO: 13 (Ab 7326 Light chain variable region variant 2)
- SEQ ID NO: 14 (Mouse full length IgGl heavy chain variant 1) QVQLVE S GAE VKKPGAT VKI S CKVS G YT FT D Y YMHWVQQAPGKGLEWMGLVDPE DGE T I Y AEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCATDARGSGSYYPNHFDYWGQGTLV TVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAV LQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSS VFIFPPKPKDVLTITLTPKVTCVWDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNST FRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMA KDKVSLTCMITDFFPEDITVEWQWNGQPA
- SEQ ID NO: 15 (Mouse full length IgGl light chain variant 1) DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR ESGVPDRFSGSGSGTDFTLTINSLQAEDVAVYFCQQYYDTPTFGQGTRLEIKRTDAAPTV SIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC SEQ ID NO: 16 (Human full length IgGl heavy chain variant 2)
- SEQ ID NO: 17 Human full length IgGl light chain variant 2
- SEQ ID NO: 18 (Fab heavy chain variant 1)
- SEQ ID NO: 21 (Mature Gremlin- 1 sequence of SEQ ID NO: 1 lacking the signal peptide of amino acids 1-21)
- SEQ ID NO: 22 (Human IgG4P heavy chain variant 1) QVQLVE S GAE VKKPGAT VKI S CKVS G YT FT D Y YMHWVQQAPGKGLEWMGLVDPE DGE T I Y AEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCATDARGSGSYYPNHFDYWGQGTLV TVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSWTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLG GPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQE EMTKNQVSLTCLVKGFYPSDIAVE
- SEQ ID NO: 24 (Human IgGl heavy chain DNA variant 1) caagtgcaactggtggaatccggggccgaagtgaaaaagcccggagccactgtgaagatc tcttgcaaagtgtccggctacaccttcaccgactattacatgcactgggtccagcaggca cctgggaagggccttgagtggatgggtctggtcgatcccgaggacggcgaactatctac gccgagaagttccagggtcgcgtcaccatcaccgccgacacttccaccgacaccgcgtac atggagctgtccagcttgaggtccgaggacacagccgtgtactactactgcgccacggatgct cggggaaagcggcagc
- SEQ ID NO: 25 (Human IgGl light chain DNA variant 1) gacattgtgatgacccagtccccgattcgcttgcggtgtccctgggagaacgggccacc attaactgcaagagctcacagtcccgtcctgtattcatcgaacaacaagaattacctcgca tggtatcagcagaagcctggacagcctcccaagctgctcatctactgggctagcacccgc gaatccggggtgccggatagattctccggatcgggttcgggcactgacttcactctgact atcaactcactgcaagccgaggatgtcgcggtgtacttctgtcagcagtactacgacacc ccgacctttggacaaggcaccagactggagattaagcgtac
- SEQ ID NO: 26 (Human IgG4P heavy chain DNA variant 1) caagtgcaactggtggaatccggggccgaagtgaaaaagcccggagccactgtgaagatc tcttgcaaagtgtccggctacaccttcaccgactattacatgcactgggtccagcaggca cctgggaagggccttgagtggatgggtctggtcgatcccgaggacggcgaactatctac gccgagaagttccagggtcgcgtcaccatcaccgccgacacttccaccgacaccgcgtac atggagctgtccagcttgaggtccgaggacacagccgtgtactactactgcgccacggatgct cggggaaagcggcag
- SEQ ID NO: 28 (Mouse full length IgGl heavy chain variant 2)
- SEQ ID NO: 29 (Mouse full length IgGl light chain variant 2)
- SEQ ID NO: 30 Human full length IgGl heavy chain variant 1
- SEQ ID NO: 31 Human full length IgGl light chain variant 1
- SEQ ID NO: 32 (Fab heavy chain variant 2)
- SEQ ID NO: 34 Human IgG4P heavy chain variant 2
- SEQ ID NO: 35 Human IgG4P light chain variant 2
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Heart & Thoracic Surgery (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Cardiology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Analytical Chemistry (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pulmonology (AREA)
- General Engineering & Computer Science (AREA)
Priority Applications (22)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201780079116.0A CN110099924B (zh) | 2016-12-19 | 2017-12-19 | Gremlin-1晶体结构和抑制性抗体 |
| CA3045742A CA3045742A1 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
| BR112019010903-0A BR112019010903A2 (pt) | 2016-12-19 | 2017-12-19 | estrutura de cristal de gremlin-1 e anticorpo inibidor |
| UAA201906847A UA126025C2 (uk) | 2016-12-19 | 2017-12-19 | Кристалічна структура гремліну-1 та інгібіторне антитіло |
| MYPI2019003411A MY202395A (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
| EA201991511A EA201991511A1 (ru) | 2016-12-19 | 2017-12-19 | Кристаллическая структура гремлин-1 и ингибирующее антитело |
| KR1020197020545A KR102557216B1 (ko) | 2016-12-19 | 2017-12-19 | 그렘린-1 결정 구조 및 억제 항체 |
| JP2019533076A JP7097364B2 (ja) | 2016-12-19 | 2017-12-19 | グレムリン-1の結晶構造及び阻害抗体 |
| TNP/2019/000188A TN2019000188A1 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
| IL267287A IL267287B1 (en) | 2016-12-19 | 2017-12-19 | Crystal structure of Gremlin-1 and inhibitory antibody |
| MX2019006630A MX2019006630A (es) | 2016-12-19 | 2017-12-19 | Estructura cristalina de gremlina 1 y anticuerpo inhibidor. |
| NZ754018A NZ754018B2 (en) | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody | |
| RU2019122648A RU2769285C2 (ru) | 2016-12-19 | 2017-12-19 | Кристаллическая структура гремлин-1 и ингибирующее антитело |
| US16/470,996 US10947304B2 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 antibody |
| AU2017384471A AU2017384471B2 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
| EP17825499.1A EP3555129B1 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
| PE2019001251A PE20191542A1 (es) | 2016-12-19 | 2017-12-19 | Estructura cristalina de gremlina 1 y anticuerpo inhibidor |
| CONC2019/0006073A CO2019006073A2 (es) | 2016-12-19 | 2019-06-11 | Estructura cristalina de gremlina 1 y anticuerpo inhibidor |
| PH12019501319A PH12019501319A1 (en) | 2016-12-19 | 2019-06-11 | Gremlin-1 crystal structure and inhibitory antibody |
| ZA2019/03810A ZA201903810B (en) | 2016-12-19 | 2019-06-12 | Gremlin-1 crystal structure and inhibitory antibody |
| US17/172,109 US11807680B2 (en) | 2016-12-19 | 2021-02-10 | Gremlin-1 crystal structure and inhibitory antibody |
| US18/502,188 US12473355B2 (en) | 2016-12-19 | 2023-11-06 | Gremlin-1 crystal structure and inhibitory antibody |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB1621635.0 | 2016-12-19 | ||
| GBGB1621635.0A GB201621635D0 (en) | 2016-12-19 | 2016-12-19 | Crystal structure |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/470,996 A-371-Of-International US10947304B2 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 antibody |
| US17/172,109 Division US11807680B2 (en) | 2016-12-19 | 2021-02-10 | Gremlin-1 crystal structure and inhibitory antibody |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018115017A2 true WO2018115017A2 (en) | 2018-06-28 |
| WO2018115017A3 WO2018115017A3 (en) | 2019-02-07 |
Family
ID=58284547
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/083650 Ceased WO2018115017A2 (en) | 2016-12-19 | 2017-12-19 | Gremlin-1 crystal structure and inhibitory antibody |
Country Status (27)
| Country | Link |
|---|---|
| US (3) | US10947304B2 (https=) |
| EP (1) | EP3555129B1 (https=) |
| JP (1) | JP7097364B2 (https=) |
| KR (1) | KR102557216B1 (https=) |
| CN (1) | CN110099924B (https=) |
| AR (1) | AR110394A1 (https=) |
| AU (1) | AU2017384471B2 (https=) |
| BR (1) | BR112019010903A2 (https=) |
| CA (1) | CA3045742A1 (https=) |
| CL (1) | CL2019001715A1 (https=) |
| CO (1) | CO2019006073A2 (https=) |
| EA (1) | EA201991511A1 (https=) |
| EC (1) | ECSP19051912A (https=) |
| GB (1) | GB201621635D0 (https=) |
| IL (1) | IL267287B1 (https=) |
| MA (1) | MA47669A (https=) |
| MX (1) | MX2019006630A (https=) |
| MY (1) | MY202395A (https=) |
| PE (1) | PE20191542A1 (https=) |
| PH (1) | PH12019501319A1 (https=) |
| RU (1) | RU2769285C2 (https=) |
| TN (1) | TN2019000188A1 (https=) |
| TW (1) | TWI787223B (https=) |
| UA (1) | UA126025C2 (https=) |
| UY (1) | UY37528A (https=) |
| WO (1) | WO2018115017A2 (https=) |
| ZA (1) | ZA201903810B (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019158658A1 (en) * | 2018-02-15 | 2019-08-22 | Ucb Biopharma Sprl | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect |
| WO2019243801A1 (en) * | 2018-06-18 | 2019-12-26 | UCB Biopharma SRL | Gremlin-1 antagonist for the prevention and treatment of cancer |
| WO2022152290A1 (en) * | 2021-01-18 | 2022-07-21 | Suzhou Transcenta Therapeutics Co., Ltd. | Novel anti-gremlin1 antibodies |
| WO2023194583A1 (en) | 2022-04-08 | 2023-10-12 | UCB Biopharma SRL | Combination of a gremlin-1 antagonist with an inhibitor of ras-raf-mek-erk signalling |
| WO2023194584A1 (en) | 2022-04-08 | 2023-10-12 | UCB Biopharma SRL | Combination of a gremlin-1 antagonist with a cytidine analogue or deoxycytidine analogue |
| WO2023203177A1 (en) * | 2022-04-20 | 2023-10-26 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments pan-specifically binding to gremlin-1 and gremlin-2 and uses thereof |
| WO2026027660A1 (en) | 2024-08-02 | 2026-02-05 | UCB Biopharma SRL | Formulations of anti-gremlin-1 antibodies |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201621635D0 (en) | 2016-12-19 | 2017-02-01 | Ucb Biopharma Sprl | Crystal structure |
| WO2022084400A1 (en) * | 2020-10-20 | 2022-04-28 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments specifically binding to gremlin-1 and uses thereof |
| EP4304646A4 (en) * | 2021-03-11 | 2025-05-28 | Shanghai Jiao Tong University | Methods for treating diseases with Gremlin1 antagonists |
| EP4724490A2 (en) | 2023-06-12 | 2026-04-15 | Amgen Inc. | Lymphotoxin beta receptor agonist binding proteins |
Citations (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| EP0438474A1 (en) | 1988-10-12 | 1991-07-31 | Medical Res Council | Production of antibodies from transgenic animals. |
| EP0463151A1 (en) | 1990-01-12 | 1992-01-02 | Cell Genesys Inc | GENERATION OF XENOGENIC ANTIBODIES. |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992022853A1 (en) | 1991-06-18 | 1992-12-23 | Kodak Limited | Photographic processing apparatus |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| EP0546073A1 (en) | 1990-08-29 | 1993-06-16 | Genpharm Int | NON-HUMAN TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGOUS ANTIBODIES. |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO2004051268A1 (en) | 2002-12-03 | 2004-06-17 | Celltech R & D Limited | Assay for identifying antibody producing cells |
| WO2004106377A1 (en) | 2003-05-30 | 2004-12-09 | Celltech R & D Limited | Methods for producing antibodies |
| WO2005003169A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fab fragments |
| WO2005003171A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fragments |
| WO2005003170A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fragments |
| WO2005113605A1 (en) | 2004-05-19 | 2005-12-01 | Celltech R & D Limited | Cross-linked antibodies |
| WO2009040562A1 (en) | 2007-09-26 | 2009-04-02 | Ucb Pharma S.A. | Dual specificity antibody fusions |
| WO2014159010A1 (en) | 2013-03-14 | 2014-10-02 | Regeneron Pharmaceuticals, Inc. | Human antibodies to grem 1 |
Family Cites Families (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB8422238D0 (en) | 1984-09-03 | 1984-10-10 | Neuberger M S | Chimeric proteins |
| DK336987D0 (da) | 1987-07-01 | 1987-07-01 | Novo Industri As | Immobiliseringsmetode |
| GB8719042D0 (en) | 1987-08-12 | 1987-09-16 | Parker D | Conjugate compounds |
| GB8720833D0 (en) | 1987-09-04 | 1987-10-14 | Celltech Ltd | Recombinant dna product |
| GB8907617D0 (en) | 1989-04-05 | 1989-05-17 | Celltech Ltd | Drug delivery system |
| US5859205A (en) * | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| GB9112536D0 (en) | 1991-06-11 | 1991-07-31 | Celltech Ltd | Chemical compounds |
| GB9120467D0 (en) | 1991-09-26 | 1991-11-06 | Celltech Ltd | Anti-hmfg antibodies and process for their production |
| FR2716640B1 (fr) | 1994-02-28 | 1996-05-03 | Procedes Machines Speciales | Dispositif de centrage et de blocage d'une pièce en vue de son rodage à l'aide d'un rodoir à expansion. |
| GB9625640D0 (en) | 1996-12-10 | 1997-01-29 | Celltech Therapeutics Ltd | Biological products |
| WO2002054940A2 (en) | 2001-01-12 | 2002-07-18 | University Of Medicine & Dentistry Of New Jersey | Bone morphogenetic protein-2 in the treatment and diagnosis of cancer |
| US6908963B2 (en) | 2001-10-09 | 2005-06-21 | Nektar Therapeutics Al, Corporation | Thioester polymer derivatives and method of modifying the N-terminus of a polypeptide therewith |
| EP2824190A1 (en) | 2003-09-09 | 2015-01-14 | Integrigen, Inc. | Methods and compositions for generation of germline human antibody genes |
| EP1571159A1 (en) | 2004-03-04 | 2005-09-07 | Bayerische Julius-Maximilians-Universität Würzburg | Mutein of a bone morphogenetic protein and use thereof |
| GB0412181D0 (en) | 2004-06-01 | 2004-06-30 | Celltech R&D Ltd | Biological products |
| US20090203041A1 (en) | 2006-04-21 | 2009-08-13 | Wei Shi | Bmp4 inhibitors |
| GB0619291D0 (en) | 2006-09-29 | 2006-11-08 | Ucb Sa | Altered antibodies |
| US8383349B2 (en) | 2007-03-16 | 2013-02-26 | The Board Of Trustees Of The Leland Stanford Junior University | Bone morphogenetic protein antagonist and uses thereof |
| EP2826790B1 (en) * | 2012-03-15 | 2019-02-13 | SNU R&DB Foundation | Anti-gremlin-1 antibody |
| GB201621635D0 (en) | 2016-12-19 | 2017-02-01 | Ucb Biopharma Sprl | Crystal structure |
| GB201802486D0 (en) | 2018-02-15 | 2018-04-04 | Ucb Biopharma Sprl | Methods |
| MX2020013808A (es) | 2018-06-18 | 2021-05-27 | UCB Biopharma SRL | Antagonista de gremlina-1 para la prevencion y el tratamiento del cancer. |
-
2016
- 2016-12-19 GB GBGB1621635.0A patent/GB201621635D0/en not_active Ceased
-
2017
- 2017-12-19 TW TW106144629A patent/TWI787223B/zh active
- 2017-12-19 CN CN201780079116.0A patent/CN110099924B/zh active Active
- 2017-12-19 TN TNP/2019/000188A patent/TN2019000188A1/en unknown
- 2017-12-19 WO PCT/EP2017/083650 patent/WO2018115017A2/en not_active Ceased
- 2017-12-19 UA UAA201906847A patent/UA126025C2/uk unknown
- 2017-12-19 BR BR112019010903-0A patent/BR112019010903A2/pt unknown
- 2017-12-19 PE PE2019001251A patent/PE20191542A1/es unknown
- 2017-12-19 MX MX2019006630A patent/MX2019006630A/es unknown
- 2017-12-19 MA MA047669A patent/MA47669A/fr unknown
- 2017-12-19 UY UY0001037528A patent/UY37528A/es unknown
- 2017-12-19 KR KR1020197020545A patent/KR102557216B1/ko active Active
- 2017-12-19 CA CA3045742A patent/CA3045742A1/en active Pending
- 2017-12-19 IL IL267287A patent/IL267287B1/en unknown
- 2017-12-19 RU RU2019122648A patent/RU2769285C2/ru active
- 2017-12-19 JP JP2019533076A patent/JP7097364B2/ja active Active
- 2017-12-19 US US16/470,996 patent/US10947304B2/en active Active
- 2017-12-19 EA EA201991511A patent/EA201991511A1/ru unknown
- 2017-12-19 AR ARP170103569A patent/AR110394A1/es unknown
- 2017-12-19 EP EP17825499.1A patent/EP3555129B1/en active Active
- 2017-12-19 MY MYPI2019003411A patent/MY202395A/en unknown
- 2017-12-19 AU AU2017384471A patent/AU2017384471B2/en active Active
-
2019
- 2019-06-11 CO CONC2019/0006073A patent/CO2019006073A2/es unknown
- 2019-06-11 PH PH12019501319A patent/PH12019501319A1/en unknown
- 2019-06-12 ZA ZA2019/03810A patent/ZA201903810B/en unknown
- 2019-06-19 CL CL2019001715A patent/CL2019001715A1/es unknown
- 2019-07-19 EC ECSENADI201951912A patent/ECSP19051912A/es unknown
-
2021
- 2021-02-10 US US17/172,109 patent/US11807680B2/en active Active
-
2023
- 2023-11-06 US US18/502,188 patent/US12473355B2/en active Active
Patent Citations (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| EP0438474A1 (en) | 1988-10-12 | 1991-07-31 | Medical Res Council | Production of antibodies from transgenic animals. |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| EP0463151A1 (en) | 1990-01-12 | 1992-01-02 | Cell Genesys Inc | GENERATION OF XENOGENIC ANTIBODIES. |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| EP0546073A1 (en) | 1990-08-29 | 1993-06-16 | Genpharm Int | NON-HUMAN TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGOUS ANTIBODIES. |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992022853A1 (en) | 1991-06-18 | 1992-12-23 | Kodak Limited | Photographic processing apparatus |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| WO2004051268A1 (en) | 2002-12-03 | 2004-06-17 | Celltech R & D Limited | Assay for identifying antibody producing cells |
| WO2004106377A1 (en) | 2003-05-30 | 2004-12-09 | Celltech R & D Limited | Methods for producing antibodies |
| WO2005003169A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fab fragments |
| WO2005003171A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fragments |
| WO2005003170A2 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fragments |
| WO2005113605A1 (en) | 2004-05-19 | 2005-12-01 | Celltech R & D Limited | Cross-linked antibodies |
| WO2009040562A1 (en) | 2007-09-26 | 2009-04-02 | Ucb Pharma S.A. | Dual specificity antibody fusions |
| WO2014159010A1 (en) | 2013-03-14 | 2014-10-02 | Regeneron Pharmaceuticals, Inc. | Human antibodies to grem 1 |
Non-Patent Citations (51)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1999, WILEY INTERSCIENCE |
| "Handbook of Experimental Immunology", vol. 4, 1986, BLACKWELL SCIENTIFIC PUBLISHERS |
| ADAIR; LAWSON, DRUG DESIGN REVIEWS - ONLINE, vol. 2, no. 3, 2005, pages 209 - 217 |
| ALTSCHUL S.F., J MOL EVOL, vol. 36, 1993, pages 290 - 300 |
| ALTSCHUL, S, F, J MOL BIOL, vol. 215, 1990, pages 403 - 10 |
| AMES ET AL., J. IMMUNOL. METHODS, vol. 184, 1995, pages 177 - 186 |
| BABCOOK, J. ET AL., PROC. NATL. ACAD. SCI., vol. 93, no. 15, 1996, pages 7843 - 78481 |
| BADESCH DB; CHAMPION HC; SANCHEZ MA; HOEPER MM; LOYD JE; MANES A; MCGOON M; NAEIJE R; OLSCHEWSKI H; OUDIZ RJ: "Diagnosis and assessment of pulmonary arterial hypertension", J AM COLL CARDIOL., vol. 54, no. 1, 30 June 2009 (2009-06-30), pages S55 - 66, XP026218349, DOI: doi:10.1016/j.jacc.2009.04.011 |
| BRINKMAN ET AL., J. IMMUNOL. METHODS, vol. 182, 1995, pages 41 - 50 |
| BUDD & HOLMES PHARM THER, 2012 |
| BUDD DC; HOLMES AM: "Targeting TGFP superfamily ligand accessory proteins as novel therapeutics for chronic lung disorders", PHARMACOL THER., vol. 135, no. 3, September 2012 (2012-09-01), pages 279 - 91 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| CAHILL E; COSTELLO CM; ROWAN SC; HARKIN S; HOWELL K; LEONARD MO; SOUTHWOOD M; CUMMINS EP; FITZPATRICK SF; TAYLOR CT: "Gremlin plays a key role in the pathogenesis of pulmonary hypertension", CIRCULATION, vol. 125, no. 7, 21 February 2012 (2012-02-21), pages 920 - 30, XP055279199, DOI: doi:10.1161/CIRCULATIONAHA.111.038125 |
| CAHILL ET AL., CIRC, 2012 |
| CHEN ET AL.: "MolProbity: all-atom structure validation for macromolecular crystallography", ACTA CRYSTALLOGRAPHICA, vol. D66, 2010, pages 12 - 21 |
| CIUCLAN ET AL., AJP, 2013 |
| CIUCLAN ET AL., AJRCCM, 2013 |
| CIUCLAN L; HUSSEY MJ; BURTON V; GOOD R; DUGGAN N; BEACH S; JONES P; FOX R; CLAY I; BONNEAU O: "Imatinib attenuates hypoxia-induced pulmonary arterial hypertension pathology via reduction in 5-hydroxytryptamine through inhibition of tryptophan hydroxylase 1 expression", AM J RESPIR CRIT CARE MED., vol. 187, no. 1, 1 January 2013 (2013-01-01), pages 78 - 89 |
| CIUCLAN L; SHEPPARD K; DONG L; SUTTON D; DUGGAN N; HUSSEY M; SIMMONS J; MORRELL NW; JARAI G; EDWARDS M: "Treatment with anti-gremlin 1 antibody ameliorates chronic hypoxia/SU5416-induced pulmonary arterial hypertension in mice", AM J PATHOL., vol. 183, no. 5, November 2013 (2013-11-01), pages 1461 - 73, XP055205055, DOI: doi:10.1016/j.ajpath.2013.07.017 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R LISS, INC., pages: 77 - 96 |
| DEVEREUX, NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387 - 395 |
| EMSLEY ET AL., ACTA CRYSTALLOGRAPHICA SECTION D: BIOLOGICAL CRYSTALLOGRAPHY, vol. 66, no. 4, pages 486 - 501 |
| FARBER HW; LOSCALZO J: "Pulmonary arterial hypertension", N ENGL J MED., vol. 351, no. 16, 14 October 2004 (2004-10-14), pages 1655 - 65 |
| GILBANE AJ; DERRETT-SMITH E; TRINDER SL; GOOD RB; PEARCE A; DENTON CP; HOLMES AM: "Impaired bone morphogenetic protein receptor II signaling in a transforming growth factor- 0-dependent mouse model of pulmonary hypertension and in systemic sclerosis", AM J RESPIR CRIT CARE MED., vol. 191, no. 6, 15 March 2015 (2015-03-15), pages 665 - 77 |
| HARLOW; LANE: "Antibodies", COLD SPRING HARBOR PRESS |
| HARRIS, RJ., JOURNAL OF CHROMATOGRAPHY, vol. 705, 1995, pages 129 - 134 |
| HENIKOFF, PROC. NATL. ACAD. SCI., vol. 89, 1992, pages 10915 - 10919 |
| HOLLIGER; HUDSON, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1126 - 1136 |
| JUNGHANS ET AL., CANCER RES, vol. 50, 1990, pages 1495 - 1502 |
| KABSCH, WOLFGANG, ACTA CRYSTALLOGRAPHICA SECTION D, vol. 66, 2010, pages 125 - 132 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 5873 - 5787 |
| KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34 |
| KETTLEBOROUGH ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 952 - 958 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KOZBOR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72 |
| KRINNER ET AL., MOL. IMMUNOL., vol. 44, no. 5, February 2007 (2007-02-01), pages 916 - 25 |
| MCCOY ET AL., J APPL CRYST, vol. 40, 2007, pages 658 - 674 |
| MURSHUDOV ET AL.: "REFMAC5 for the refinement of macromolecular crystal structures", ACTA CRYSTALLOGRAPHICA SECTION D: BIOLOGICAL CRYSTALLOGRAPHY, vol. 67, 2011, pages 355 - 367 |
| NOLAN ET AL., J. BIOL. CHEM., vol. 290, 2014, pages 4759 - 4771 |
| NOLAN ET AL., STRUCTURE, vol. 21, 2013, pages 1417 - 1429 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| REICHMANN ET AL., NATURE, vol. 332, 1998, pages 323 - 324 |
| REINEKE, METHODS MOL BIOL, vol. 248, 2004, pages 443 - 63 |
| RETTER, NUCL. ACIDS RES., vol. 33, no. 1, 2005, pages D671 - D674 |
| SIMONNEAU G; ROBBINS IM; BEGHETTI M; CHANNICK RN; DELCROIX M; DENTON CP; ELLIOTT CG; GAINE SP; GLADWIN MT; JING ZC: "Updated clinical classification of pulmonary hypertension", J AM COLL CARDIOL., vol. 54, no. 1, 30 June 2009 (2009-06-30), pages S43 - 54, XP026218348, DOI: doi:10.1016/j.jacc.2009.04.012 |
| THOMAS ET AL., AJP, 2009 |
| THOMAS M; DOCX C; HOLMES AM; BEACH S; DUGGAN N; ENGLAND K; LEBLANC C; LEBRET C; SCHINDLER F; RAZA F: "Activin-like kinase 5 (ALK5) mediates abnormal proliferation of vascular smooth muscle cells from patients with familial pulmonary arterial hypertension and is involved in the progression of experimental pulmonary arterial hypertension induced by monocrotaline", AM J PATHOL., vol. 174, no. 2, February 2009 (2009-02-01), pages 380 - 9 |
| TOMER, PROTEIN SCIENCE, vol. 9, 2000, pages 487 - 496 |
| VAUGHAN ET AL., NATURE BIOTECHNOLOGY, vol. 16, 1998, pages 535 - 539 |
| VERMA ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 216, 1998, pages 165 - 181 |
| WALKER: "The Proteomics Protocols Handbook", 2005, HUMANA PRESS, pages: 571 - 607 |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11524997B2 (en) | 2018-02-15 | 2022-12-13 | UCB Biopharma SRL | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect |
| AU2019220407B2 (en) * | 2018-02-15 | 2025-07-31 | UCB Biopharma SRL | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect |
| WO2019158658A1 (en) * | 2018-02-15 | 2019-08-22 | Ucb Biopharma Sprl | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect |
| US12240896B2 (en) | 2018-02-15 | 2025-03-04 | UCB Biopharma SRL | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect |
| US12162934B2 (en) | 2018-06-18 | 2024-12-10 | UCB Biopharma SRL | Gremlin-1 antagonist for the prevention and treatment of cancer |
| WO2019243801A1 (en) * | 2018-06-18 | 2019-12-26 | UCB Biopharma SRL | Gremlin-1 antagonist for the prevention and treatment of cancer |
| AU2019289176B2 (en) * | 2018-06-18 | 2026-02-19 | Adelaide university | Gremlin-1 antagonist for the prevention and treatment of cancer |
| EP4277927A4 (en) * | 2021-01-18 | 2025-07-23 | Suzhou Transcenta Therapeutics Co Ltd | NEW ANTI-GREMLIN-1 ANTIBODIES |
| WO2022152290A1 (en) * | 2021-01-18 | 2022-07-21 | Suzhou Transcenta Therapeutics Co., Ltd. | Novel anti-gremlin1 antibodies |
| WO2023194584A1 (en) | 2022-04-08 | 2023-10-12 | UCB Biopharma SRL | Combination of a gremlin-1 antagonist with a cytidine analogue or deoxycytidine analogue |
| WO2023194583A1 (en) | 2022-04-08 | 2023-10-12 | UCB Biopharma SRL | Combination of a gremlin-1 antagonist with an inhibitor of ras-raf-mek-erk signalling |
| WO2023203177A1 (en) * | 2022-04-20 | 2023-10-26 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments pan-specifically binding to gremlin-1 and gremlin-2 and uses thereof |
| WO2026027660A1 (en) | 2024-08-02 | 2026-02-05 | UCB Biopharma SRL | Formulations of anti-gremlin-1 antibodies |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12473355B2 (en) | Gremlin-1 crystal structure and inhibitory antibody | |
| CN102574923B (zh) | 针对人蛋白酶激活受体-2的高亲和力人抗体 | |
| US12240896B2 (en) | Gremlin-1 inhibitor for the treatment of a bone fracture or bone defect | |
| JP2019151654A (ja) | ヒト抗grem1抗体 | |
| TW202229343A (zh) | Fgfr3抗體及使用方法 | |
| US11542329B2 (en) | Antibodies targeting Glycoprotein VI | |
| CA3124356A1 (en) | Fn14 antibodies and uses thereof | |
| EA043762B1 (ru) | Кристаллическая структура гремлин-1 и ингибирующее антитело | |
| HK40010475A (en) | Gremlin-1 crystal structure and inhibitory antibody | |
| HK40010475B (zh) | Gremlin-1晶体结构和抑制性抗体 | |
| JP2022523750A (ja) | 抗-fgf19抗体 | |
| HK40037006B (zh) | 用於治疗骨折或骨缺损的gremlin-1抑制剂 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17825499 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3045742 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019010903 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2019/0006073 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2017384471 Country of ref document: AU Date of ref document: 20171219 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019533076 Country of ref document: JP Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2019/0006073 Country of ref document: CO |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2019000355 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20197020545 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017825499 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 112019010903 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190528 |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2019/0006073 Country of ref document: CO |