WO2018038539A2 - Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물 - Google Patents

Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물 Download PDF

Info

Publication number
WO2018038539A2
WO2018038539A2 PCT/KR2017/009224 KR2017009224W WO2018038539A2 WO 2018038539 A2 WO2018038539 A2 WO 2018038539A2 KR 2017009224 W KR2017009224 W KR 2017009224W WO 2018038539 A2 WO2018038539 A2 WO 2018038539A2
Authority
WO
WIPO (PCT)
Prior art keywords
eprs
composition
cells
protein
fragment
Prior art date
Application number
PCT/KR2017/009224
Other languages
English (en)
French (fr)
Other versions
WO2018038539A3 (ko
Inventor
김명희
이은영
김성훈
이철호
Original Assignee
한국생명공학연구원
재단법인 의약바이오컨버젼스연구단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국생명공학연구원, 재단법인 의약바이오컨버젼스연구단 filed Critical 한국생명공학연구원
Priority to EP17843959.2A priority Critical patent/EP3505624A4/en
Priority to JP2019532908A priority patent/JP6901564B2/ja
Priority to CN201780065721.2A priority patent/CN110234757B/zh
Publication of WO2018038539A2 publication Critical patent/WO2018038539A2/ko
Publication of WO2018038539A3 publication Critical patent/WO2018038539A3/ko
Priority to US16/283,121 priority patent/US11173192B2/en

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/53—Ligases (6)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93—Ligases (6)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52—Genes encoding for enzymes or proenzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01015—Proline--tRNA ligase (6.1.1.15)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01017—Glutamate-tRNA ligase (6.1.1.17)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01018—Glutamine--tRNA ligase (6.1.1.18)
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention provides an anti-RNA virus composition
  • an anti-RNA virus composition comprising an EPRS (glutamyl-prolyl-tRNA synthetase) protein or a fragment thereof, a composition for preventing or treating an RNA virus infection disease, and a method for preventing or treating an RNA virus infection disease using the composition. It is about.
  • EPRS glutamyl-prolyl-tRNA synthetase
  • ARS Aminoacyl-tRNA synthetases
  • MSC multi-tRNA synthetase complex
  • the MSC is assembled in most cases through additional domains and includes eight glutathyl-prolyl-tRNA syntetases (EPRS), and three ARS-interacting multifunctional proteins (AIMP1 / p43, AIMP2 / p38, and AIMP3 / p38).
  • EPRS glutathyl-prolyl-tRNA syntetases
  • AIMP1 / p43 glutathyl-prolyl-tRNA syntetases
  • AIMP2 / p38 ARS-interacting multifunctional proteins
  • AIMP3 / p38 Species tRNA synthetase (Trends Biochem. Sci, 2007, 35: 158-164).
  • MSC components including EPRS, method-methionyl-tRNA synthetase (MRS), lysyl-tRNA synthetase (KRS), AIMP1, and AIMP2, are released from the complex through post-translational modifications to prevent inflammation, It is known to exhibit activities such as cell metabolism, angiogenesis and tumor formation (Trends Biochem. Sci, 2009, 34: 324-331). Phosphorylation is a key regulatory mechanism in determining the non-translating function of ARS in cells.
  • EPRS the only bifunctional tRNA synthetase.
  • EPRS consists of ERSs and PRSs linked together via a linker containing three WHEP domains.
  • the EPRS is believed to exist outside of the MSC. Ser886 and Ser999 residues located between the ERS and PRS domains of EPRS are stimulated with IFN- ⁇ and subsequently phosphorylated, thus facilitating release from MSCs.
  • NSAP1 NS1-associated protein 1
  • phosphorylated ribosomal protein L13a phosphorylated ribosomal protein L13a
  • GPDH glyceraldehyde-3-phosphate dehydrogenase
  • the regulatory complex binds to certain 3'-UTRs (untranslated regions) of mRNA encoding inflammatory proteins such as ceruloplasmin (Cp) and inhibits their translation. This specific function is believed to contribute to alleviating chronic inflammation by regulating the expression of deleterious pro-inflammatory molecules produced in response to early infection.
  • IFN- [gamma] is produced during the post-infection immune response and is mainly secreted by natural killer (NK) cells or Th1 cells activated by IL-12.
  • the innate immune response is the first shield in the early stages of infection.
  • Antiviral signaling is a key cellular process that evolved in response to viral infections.
  • the signaling is mainly activated by the RIG-I-like receptor (RLR) pathway, which includes the key cytoplasmic sensors reigic acid-inducible gene-I (RIG-I) and melanoma differentiation-associated protein 5 (MDA5), which detect viral RNA. do.
  • RIG-I-like receptor (RLR) pathway which includes the key cytoplasmic sensors reigic acid-inducible gene-I (RIG-I) and melanoma differentiation-associated protein 5 (MDA5), which detect viral RNA. do.
  • RLR RIG-I-like receptor
  • MDA5 melanoma differentiation-associated protein 5
  • This signaling ultimately leads to the induction of type I IFN and other antiviral molecules (Cell, 2006, 124: 783-801).
  • This signaling pathway is appropriately regulated by positive and negative regulatory mechanisms that regulate antiviral responses through a complex network of proteins.
  • the RLR pathway is activated by the RNA of the virus, and thus the immune response is activated by the MAVS, thus preventing the degradation of the MAVS and having universal antiviral activity against the RNA virus.
  • the inventors have found that one of the components of the MSC, EPRS protein or fragment thereof, is a key antiviral signaling protein MAVS through infection-specific modification.
  • the present invention was completed by protecting MAVS from PCBP2 (poly (rC) -binding protein 2), a negative regulator of, and ultimately having a prophylactic and therapeutic effect on viral infection.
  • One object of the present invention is an antiRNA virus, comprising a glutamyl-prolyl-tRNA synthetase (EPRS) protein or a fragment thereof, wherein the fragment of the EPRS protein comprises the 168th to 186th amino acid sequence of SEQ ID NO: 63. It is to provide a composition for.
  • EPRS glutamyl-prolyl-tRNA synthetase
  • Another object of the present invention is to provide a protein or fragment thereof, wherein the EPRS protein or fragment thereof has anti-RNA viral activity, wherein the fragment of EPRS protein comprises the 168th to 186th amino acid sequence of SEQ ID NO: 63. .
  • Still another object of the present invention is to provide a polynucleotide encoding the protein or fragment thereof.
  • Still another object of the present invention is to provide a vector containing the polynucleotide.
  • Still another object of the present invention is to provide a transformant comprising the polynucleotide or vector.
  • Still another object of the present invention is to provide a pharmaceutical composition for preventing or treating an RNA virus infection disease, including the anti-RNA virus composition.
  • Still another object of the present invention is to provide a method for treating an RNA virus infection disease, comprising administering the anti-RNA virus composition to a subject.
  • Still another object of the present invention is to provide a quasi-drug composition for preventing or improving an RNA virus infection disease, comprising the composition for anti-RNA virus.
  • Still another object of the present invention is to provide a food composition for preventing or improving an RNA virus infection disease, including the anti-RNA virus composition.
  • Still another object of the present invention is to provide a cosmetic composition for preventing or improving an RNA virus infection disease, including the anti-RNA virus composition.
  • Still another object of the present invention is to provide a feed composition for preventing or improving an RNA virus infection disease, comprising the anti-RNA virus composition.
  • Still another object of the present invention is to provide a method for preventing or inhibiting MAVS protein degradation, comprising administering the anti-RNA virus composition.
  • composition comprising the EPRS protein or fragment thereof of the present invention has a universal anti-RNA viral effect by binding to PCBP2 protein and activating the MAVS signaling pathway, which plays an important role in all anti-RNA viral activity. It has an excellent effect as a composition for the prevention or treatment of.
  • Figure 1 shows upregulation (gray) or downregulation (black) of MSC genes (more than 1.5-fold change) in bronchial epithelial cells infected with PR8.
  • Figure 2 confirms the effect of inducing IFN- ⁇ promoter activity of EPRS.
  • plasmids encoding the N-terminal domain (N-RIG-I) and IFN- ⁇ promoter of RIG-I were transformed into 293T cells. Con is not transformed with N-RIG-I.
  • Figure 3 confirms EPRS expression in various cell lines infected with virus.
  • RAW264.7 cells were transformed with siControl (siCon) or siEPRS.
  • RAW264.7 cells were transformed with siControl (siCon) or siEPRS.
  • RAW246.7 cells were transformed with non-target control siRNA (siCon) or siEPRS.
  • RAW264.7 cells were transformed with siControl (siCon) or siEPRS.
  • RAW264.7 cells were transformed with siControl (siCon) or siEPRS.
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • FIG 17 shows fluorescence micrographs of stable EPRS-deficient cells infected with VSV-GFP (MOI).
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • VSV titers in stable EPRS-deficient cells infected with VSV-GFP MOI.
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • Figure 19 shows IFN- ⁇ or IL-6 secretion levels in stable EPRS-deficient cells infected with VSV-GFP (MOI).
  • RAW264.7 cells were introduced using non-target control shRNA (shCon) or EPRS shRNA (shEPRS) and then selected as puromycin.
  • shCon non-target control shRNA
  • shEPRS EPRS shRNA
  • RAW264.7 cells were transformed with FLAG-tagged covector (Con) or EPRS-FLAG (EPRS) plasmids and then selected with puromycin.
  • Con FLAG-tagged covector
  • EPRS EPRS-FLAG
  • FIG. 22 shows fluorescence microscopic analysis of empty vector (Con) or EPRS-knock-in RAW264.7 cells infected with PR8-GFP.
  • FIG. 23 shows fluorescence and plaque assays for empty vector (Con) or EPRS-knock-in RAW264.7 cells infected with PR8-GFP.
  • RAW264.7 cells were transformed with FLAG-tagged covector (Con) or EPRS-FLAG (EPRS) plasmids and then selected with puromycin.
  • Con FLAG-tagged covector
  • EPRS EPRS-FLAG
  • RAW264.7 cells were transformed with FLAG-tagged covector (Con) or EPRS-FLAG (EPRS) plasmids and then selected with puromycin.
  • Con FLAG-tagged covector
  • EPRS EPRS-FLAG
  • RAW264.7 cells were transformed with FLAG-tagged covector (Con) or EPRS-FLAG (EPRS) plasmids and then selected with puromycin.
  • Con FLAG-tagged covector
  • EPRS EPRS-FLAG
  • Figure 28 shows virus titers confirmed by plaque analysis.
  • FIG. 29 shows IFN- ⁇ and IL-6 levels in culture supernatants 12 or 24 hours after virus infection.
  • FIG. 30 shows IFN- ⁇ and IL-6 levels in culture supernatants 12 or 24 hours after poly (I: C) treatment.
  • BMDM of EPRS + / + and EPRS +/ ⁇ mice were treated with poly (I: C) (40 ⁇ g).
  • Figure 31 confirms the EPRS expression in BMDM by immunoblot analysis.
  • BMDM was transformed for 36 hours with non-target control siRNA (siCon) or siEPRS.
  • Figure 33 shows ELNs performed 12 and 24 hours after infection to measure IFN- ⁇ and IL-6 levels.
  • 35 shows expression of IFN- ⁇ , IL-6, and other IFN-related antiviral genes in EPRS + / + and EPRS +/ ⁇ mouse derived BMDM 12 hours after infection with VSV-GFP.
  • Figure 37 shows virus titers (confirmed by plaque assay) in cell culture supernatants after infection with HSV-GFP.
  • LV lateral ventricle
  • FIG. 49 confirms whether endogenous EPRS (red) and KRS (green) were detected in a co-position by confocal microscopy.
  • Scale bar 10 ⁇ m.
  • 50 shows the co-location index of EPRS and KRS.
  • IFN- ⁇ 1000 units / ml
  • Scale bar 10 ⁇ m (magnification is 2 ⁇ m).
  • SEQ ID NO: 66 shows the extracted ion chromatogram (XIC) for the peptide. * Indicates phosphorylated residues and N.D. indicates not detected.
  • FIG. 62 shows EPRS Ser990 phosphorylation in cells transformed with 2 ⁇ g of Poly (I: C) by immunoblot analysis.
  • FIG. 63 shows the immunoblot analysis of phosphorylation of EPRS Ser886 in U937 cells infected with PR8-GFP or treated with IFN- ⁇ .
  • 64 shows the immunoblot analysis of the phosphorylation of EPRS Ser999 in U937 cells infected with PR8-GFP or treated with IFN- ⁇ .
  • Figure 65 shows the IFN- ⁇ secretion level in U937 cells infected with PR8-GFP or VSV-GFP.
  • PR8-GFP PR8-GFP
  • VSV-GFP VSV-GFP
  • IFN- ⁇ secretion levels in RAW264.7 cells infected with PR8-GFP or VSV-GFP As a positive control, cells treated with IFN- ⁇ (1000 units / ml) for 24 hours were used.
  • Figure 67 confirmed the Cp expression by immunoblot analysis in PR8-GFP infected RAW264.7 cells.
  • Figure 68 shows the results confirming that Ser990 phosphorylation-mimic EPRS is released from MSC.
  • 293T cells were transformed into an empty vector (EV), Strep-EPRS WT, or three phosphorylation-mimetic forms, subjected to Strep sedimentation, followed by immunoblot analysis with anti-KRS, anti-AIMP3, and anti-MRS antibodies was performed.
  • EV empty vector
  • Strep-EPRS WT or three phosphorylation-mimetic forms
  • Figure 69 shows IFN- ⁇ promoter activity in 293T cells transformed with N-RIG-I, MDA5, poly (I: C) or MAVS with EPRS-FLAG plasmid (0, 50, 200, or 800 ng) will be.
  • TRAF3, TBK1, or IRF7 with EPRS-FLAG plasmid (0, 50, 200, or 800 ng).
  • FIG. 72 confirms the interaction of EPRS and PBP2 by immunoprecipitating PR8-infected RAW264.7 cells with anti-EPRS antibody followed by immunoblot analysis with anti-PCBP2 antibody.
  • EPRS 75 shows a schematic diagram of EPRS and fragments thereof used in the present invention. (+ Or-) indicates whether EPRS binds to PCBP2.
  • GST GST-like domains
  • L linker
  • CD catalytic domains
  • tRNA tRNA-binding domains
  • W WHEP domain.
  • Figure 77 shows IFN- ⁇ promoter activity by luciferase reporter assay.
  • 293T cells were transformed with an expression plasmid comprising the N-RIG-I, IFN- ⁇ promoter, and TK-Renilla with EV or the indicated EPRS plasmid.
  • IFN- ⁇ promoter activity by luciferase reporter assay 293T cells were transformed with an expression plasmid comprising the N-RIG-I, IFN- ⁇ promoter, and TK-Renilla with EV or the indicated EPRS plasmid.
  • IFN- ⁇ promoter activity by luciferase reporter assay 293T cells were transformed with an expression plasmid comprising the N-RIG-I, IFN- ⁇ promoter, and TK-Renilla with EV or the indicated EPRS plasmid.
  • FIG. 84 shows the direct binding between EPRS (aa 1-732, aa 1-196 and aa 1-168) and PCBP2 KH1 (aa 11-82) domains by in vitro sedimentation analysis.
  • Black arrows indicate protein fragments derived from EPRS during purification.
  • the N-terminal sequence of the indicated bands was found to be the MRFDD (aa 234-238) and MVTFI (aa 565-569) sequences of EPRS.
  • Red arrow head indicates PCBP2 KH1 domain.
  • FT stands for flow-through fraction.
  • Figure 88 shows the in vitro sedimentation analysis confirming the interaction of the PCBP2 KH1 domain and MAVS. Arrow heads indicate MAVS proteins.
  • 89 shows the interaction between MAVS and PCBP2.
  • Purified GST-fusion MAVS (aa 460-540) was mixed with His-tagged PCBP2 KH1 (aa 11-82). The protein mixture was loaded into Ni-NTA agarose beads and eluted with imidazole elution buffer. FT stands for flow-through fraction.
  • 91 shows the interaction of MAVS (first panel) or EPRS (second panel) with PCBP2 with anti-FLAG or anti-Strep antibodies, respectively, via GST sedimentation and immunoblot analysis.
  • 293T cells were transformed with MAVS and PCBP2 and treated with varying amounts of EPRS.
  • FIG. 92 performs GST sedimentation analysis to assess the interaction between PCBP2 and ITCH (first panel) or EPRS (second panel).
  • Endogenous PCBP2 was immunoprecipitated from lysates of PR8-infected RAW264.7 cells with anti-PCBP2 antibody and immunoblot was performed with anti-EPRS (first panel) or anti-MAVS (second panel) antibody.
  • FIG. 94 shows that 293T cells expressing EPRS, PCBP2, ITCH, and Ub in various combinations were treated with MG-132, followed by immunoblot analysis of exogenous MAVS immunoprecipitated from the lysate with anti-K48 Ub antibody. will be.
  • 96 shows the expression of exogenous MAVS after treatment with various concentrations of EPRS in 293T cells transformed with PCBP2.
  • the graph shows the MAVS band intensities normalized to actin.
  • 97 shows the expression of endogenous MAVS after treatment with various concentrations of EPRS in 293T cells transformed with PCBP2.
  • the graph shows the MAVS band intensities normalized to actin.
  • FIG. 98 shows the in vitro assay confirming MAVS ubiquitination by immunoblot with anti-Ub antibody.
  • Purified MAVS protein was incubated with a combination of ubiquitin, El, E2 and purified EPRS, PCBP2, and ITCH proteins.
  • FIG. 99 confirms that EPRS L1 (aa 168-196) domain fused with cell permeable Tat inhibits MAVS ubiquitination.
  • 293T cells were transformed with PCBP2, ITCH, or Ub plasmid and treated with various concentrations of Tat-Epep (20, 50, and 100 ⁇ M), followed by sedimentation of endogenous MAVS with anti-MAVS antibodies. The precipitate was immunoblotted with anti-K48 Ub.
  • Tat-Epep A peptide (Tat-Epep) sequence synthesized by fusion of EPRS amino acids 168-196 and Tat is shown.
  • the graph shows the intensity of the MAVS protein band normalized to actin.
  • FIG. 101 confirms that Tat-Epep promotes IFN- ⁇ and IL-6 secretion in a concentration dependent manner in VSV-infected RAW264.7 cells.
  • Con VSV-infected RAW264.7 cells treated with PBS as negative control.
  • FIG. 102 shows representative fluorescent pictures of VSV-GFP-infected RAW264.7 cells treated with 100 ⁇ M Tat or Tat-Epe.
  • FIG. 103 shows that Tat-Epep dose-dependently decreases VSV titers in VSV infected RAW264.7 cells.
  • Con VSV-infected RAW264.7 cells treated with PBS as negative control.
  • Con is HSV-GFP-infected RAW264.7 cells treated with PBS as negative control.
  • Con is HSV-GFP-infected RAW264.7 cells treated with PBS as negative control.
  • Con is HSV-GFP-infected RAW264.7 cells treated with PBS as negative control.
  • Con shows the viability of RAW264.7 cells by MTS analysis after 12 hours of treatment with various concentrations of Tat-Epep.
  • Con is a positive control, treated with 293T cells with soluble surfactant (digitonin, 30 ⁇ g / ml).
  • Con shows viability of 293T cells after treatment with Tat-Epep for 12 or 24 hours.
  • Con is a positive control, treated with 293T cells with soluble surfactant (digitonin, 30 ⁇ g / ml).
  • VSV-Indiana (2 ⁇ 10 8 pfu / mouse) and Tat-tag (1.05 ⁇ M / kg) or Tat-Epep (0.53 ⁇ M / kg or 1.05 ⁇ M / kg) for 3 days from day 4
  • 111 shows that viral proliferation is reduced when Tat-Epep is treated in VSV-GFP-infected RAW264.7 cells, and New Tat-Epep is fluorescence photographed that the ability to inhibit virus growth is stronger.
  • 112 shows IFN- ⁇ secretion following Tat-Epep or New Tat-Epep treatment.
  • 113 shows the secretion of IL-6 following Tat-Epep or New Tat-Epep treatment.
  • the inventors have confirmed that the glutamyl-prolyl-tRNA synthetase (EPRS) protein, or a fragment thereof, which is a component of the multi-tRNA synthetase complex (MSC) has anti-RNA viral activity.
  • EPRS protein or fragment thereof of the present invention inhibits degradation of MAVS by competitively binding MAVS to PCBP2, which degrades MAVS, which plays an important role in general anti-RNA viral activity, including the protein or fragment thereof.
  • the composition can be used to universally and effectively treat RNA viral infection diseases.
  • One aspect of the present invention for achieving the above object is a composition for an anti-RNA virus comprising a glutamyl-prolyl-tRNA synthetase (EPRS) protein or a fragment thereof.
  • the fragment of the EPRS protein may include the 168th to 186th amino acid sequence of SEQ ID NO: 63, and more specifically, the 1st to 196th amino acid sequence of SEQ ID NO: 63, the 1 to 269th amino acid sequence, and 1 to 457 It may include an amino acid sequence selected from the group consisting of the first amino acid sequence, 1 to 506 amino acid sequence, 1 to 682 amino acid sequence, 168 to 506 amino acid sequence, 168 to 269 amino acid sequence and 168 to 196 amino acid sequence However, it is not limited thereto.
  • the fragment of EPRS may comprise a polypeptide having at least 80%, at least 90%, at least 95%, at least 97%, or at least 99% homology with the 168-186th amino acid sequence of SEQ ID 63.
  • an amino acid sequence having such homology and exhibiting efficacy corresponding to a protein consisting of the 168th to 186th amino acid sequences of SEQ ID NO: 63 even if some sequences have a deleted, modified, substituted or added amino acid sequence It is obvious that it is included within the scope of the present invention.
  • the term “homology” means the degree of coincidence with a given amino acid sequence or nucleotide sequence and may be expressed as a percentage.
  • homologous sequences thereof having the same or similar activity as a given amino acid sequence or base sequence are designated as "% homology”.
  • % homology For example, using standard software that calculates parameters such as score, identity and similarity, in particular BLAST 2.0, or by hybridization experiments used under defined stringent conditions Appropriate hybridization conditions, which are defined within the scope of the art, are well known to those skilled in the art, and are well known to those skilled in the art (e.g. J.
  • RNA virus refers to any virus that uses RNA as a genetic material.
  • the RNA virus may be Amalgaviridae, Birnaviridae, Chrysoviridae, Cystoviridae, Endornaviridae, Hypoviridae ( Hypoviridae, Megabirnaviridae, Partitiviridae, Picobirnaviridae, Reoviridae, Totiviridae, Quadriviridae , Arteriviridae, Coronaviridae, Mesoniviridae, Roniviridae, Dicistroviridae, Iflaviridae, Marnabyri Marnaviridae, Picornaviridae, Secoviridae, Alphaflexiviridae, Betaflexiviridae, Gammaflexiviridae, Tymoiridae ), Bornaviridae (B ornaviridae, Filoviridae, Paramyxoviridae,
  • the EPRS protein or fragment thereof of the present invention has the effect of inhibiting degradation of MAVS by binding to PCBP2 and preventing binding between PCBP2 and MAVS.
  • undegraded MAVS can activate its signaling pathway to activate the innate immune response to viral infection.
  • EPRS glutamyl-prolyl-tRNA synthetase
  • MSC multi-tRNA synthetase complex
  • EPRS protein or genetic information encoding the same can be obtained from a known database such as GenBank of the National Center for Biotechnology Information (NCBI), for example, may have an amino acid sequence of SEQ ID NO: 63, but is not limited thereto. .
  • MAVS Mitochondrial antiviral-signaling protein
  • viral replication by PR8 and VSV infection is increased in EPRS knockdown cells (FIGS. 5 and 6) and for poly (I: C) treatment mimicking viral infection or viral gene morphology. Antiviral cytokine production was found to decrease (FIGS. 8 and 9).
  • viral replication by PR8 and VSV infection was significantly reduced and IFN- ⁇ and IL-6 production was increased in cells overexpressing EPRS (FIGS. 22 to 27).
  • EPRS +/- mice showed higher viral titers and lower IFN- ⁇ , IFN- ⁇ and IL-6 levels in serum compared to EPRS + / + mice during viral infection (FIGS. 40-43), EPRS Has been shown to be able to positively regulate the innate immune response to RNA viruses.
  • EPRS region involved in the regulation of immune response was identified, through which the EPRS L1 region (the 168th to 196th amino acids of SEQ ID NO: 63), more specifically As a result, it was confirmed that the 168th to 186th amino acid sequence of SEQ ID 63 is essential for the antiviral activity of EPRS (FIGS. 75 to 81).
  • EPRS protein, or a fragment of EPRS protein comprising the 168th to 186th amino acid sequence of SEQ ID NO: 63 has anti-RNA-viral activity, it can be seen that it can be useful as a composition for anti-RNA-virus .
  • the EPRS protein or fragment thereof may be used in the form of a fusion with a cell-penetrating peptide to increase cell permeability. That is, the EPRS protein or fragment thereof may further include a cell permeable peptide at the N-terminus, C-terminus, or both ends. At this time, a linker may be additionally included between the EPRS protein or fragment thereof, and the cell permeable peptide, which may be appropriately performed by those skilled in the art.
  • the term "cell permeable peptide” refers to a short peptide capable of promoting intracellular uptake / absorption of various substances such as nanoparticles, compounds, DNA, and proteins.
  • the cell permeable peptide may be Tat, Antennapedia, Transportan, VP22, Hph-1, R11 (R9), signal sequence based peptide, or amphipathic peptide, but without limitation, any cell-permeable peptide capable of promoting intracellular migration of the EPRS protein or fragment thereof may be appropriately selected by those skilled in the art.
  • those skilled in the art can appropriately modify and use the EPRS protein or fragment thereof of the present invention to apply it according to the type of cell permeable peptide used.
  • the EPRS protein or fragment thereof of the present invention is not limited to the amino acid sequence of the present invention, and the amino acid sequence may be added / substituted / removed in a form suitable for application of cell-penetrating peptide within the scope apparent to those skilled in the art. Can be.
  • Tat-Epep SEQ ID NO: 61
  • HIV-1 Tat protein transduction domain SEQ ID NO: 60
  • EPRS L1 peptide 168 to 196 of SEQ ID NO: 63
  • a fusion peptide (New Tat-Epep: sequence) fused with an HIV-1 Tat protein transduction domain (SEQ ID NO: 60) and an EPRS L1 peptide fragment (168-186 of SEQ ID NO: 63) No. 64) was found to significantly reduce viral titer and promote secretion of antiviral cytokines IFN- ⁇ and IL-6 in virus-infected mouse brains more significantly than the Tat-Epep (FIGS. 110-113). ).
  • EPRS proteins or fragments thereof of the present invention can be used with reagents known in the art that can deliver proteins to cells or enhance their delivery efficiency to enhance cell permeability.
  • the reagent may be, for example, Chariot (Active motif, Cat. 30025) and the like, but is not particularly limited as long as it can deliver the EPRS protein or fragment thereof to the cell.
  • the anti-RNA virus composition of the present invention may be used as a pharmaceutical composition, quasi-drug composition, food composition, cosmetic composition or feed composition, but is not limited thereto.
  • EPRS protein or fragment thereof having antiRNA viral activity is an EPRS protein or fragment thereof having antiRNA viral activity, wherein the fragment of EPRS protein comprises the 168th to 186th amino acid sequence of SEQ ID NO: 63, or a protein or fragment thereof.
  • Another embodiment of the present invention is a polynucleotide encoding the protein or fragment thereof.
  • Another embodiment of the present invention is a vector comprising the polynucleotide.
  • Another aspect of the invention is a transformant comprising the polynucleotide or the vector.
  • EPRS proteins or fragments thereof having antiRNA viral activity are as described above.
  • the polynucleotide has a nucleotide sequence encoding the EPRS protein or fragment thereof of the present invention, or a nucleotide sequence having at least 80%, at least 90%, at least 95%, at least 97%, or at least 99% homology therewith. If the polypeptide (i.e., the protein or fragment thereof) translated therefrom exhibits a corresponding potency with the EPRS protein or fragment thereof of the invention, the sequence meaningless at the 5'- and / or 3'- terminus of the nucleotide sequence Additions, or deletions, modifications, or substitutions of some sequences, may all fall within the scope of the present invention.
  • the polynucleotide may be used in the form of an expression cassette operably linked with a known promoter sequence, or a vector comprising the polynucleotide, and the preparation of the polynucleotide, expression cassette or vector may be appropriately performed by those skilled in the art through known methods. can do.
  • the type of promoter and vector is not particularly limited and may be appropriately selected by those skilled in the art according to the purpose.
  • the polynucleotide, the expression cassette or the vector may be transformed into a host cell to prepare a transformant, and the transformation method may also be used by those skilled in the art without limitation.
  • the transformant is a subject to express the EPRS protein or fragment thereof, and may be a microorganism, a plant, or an animal, and may be other than human, but is not limited thereto.
  • a vector comprising a polynucleotide encoding the EPRS protein or a fragment thereof, or a transformant comprising the vector in order to apply / produce the EPRS protein or fragment thereof for various purposes.
  • the polynucleotide or the vector may be directly used as a therapeutic for an RNA-virus infection disease, and the protein or fragment thereof may be used using a transformant that expresses an EPRS protein or fragment thereof. It may be produced or used for therapeutic purposes, but is not limited thereto.
  • Another aspect of the present invention is a pharmaceutical composition for preventing or treating an RNA virus infection disease, comprising the composition for anti-RNA virus.
  • composition for an antiRNA virus is as described above.
  • RNA viral infection disease refers to any disease that can occur in a host by infection of an RNA virus, and the prevention and / or treatment of the disease using the EPRS protein or fragment thereof of the present invention. You can expect the effect.
  • RNA viral infection diseases include influenza, apoliomyelitis anterior acuta, aseptic meningitis, hand-foot-mouth disease, herpetic herpangina, acute Acute hemorrhagic conjunctivitis, epidemic pleurodynia, pericarditis, myocarditis, infantile white diarrhea, rubella, congenital rubella syndrome, yellow fever ), Dengue fever, dengue hemorrhagic fever, Japanese encephalitis, herpes simplex encephalitis, epidemic parotitis, measles, rabies, rabies, Marburg disease, Ebola hemorrhagic fever, Hemorrhagic fever with renal syndrome, Hantavirus pulmonary syndrome (HPS), Congo-Cremy Congo
  • prevention refers to any action that inhibits or delays the invention of the RNA viral infection disease by administration of the composition according to the present invention
  • treatment refers to the RNA virus infection by administration of the composition according to the present invention. Any action that improves or beneficially changes the condition of the disease.
  • the prevention or treatment of the RNA viral infection disease may be achieved by binding the EPRS protein of the present invention or a fragment thereof to the PCBP2 protein, and further may be due to the activation of signaling of MAVS. Therefore, the composition comprising the EPRS protein or fragment thereof of the present invention has anti-RNA viral activity as described above, and thus can be usefully used as a composition for preventing or treating RNA infectious diseases.
  • compositions of the present invention may further comprise suitable carriers, excipients or diluents commonly used in the manufacture of pharmaceutical compositions.
  • the composition comprising a pharmaceutically acceptable carrier may be various oral or parenteral formulations, and in particular, may be a parenteral formulation, but is not limited thereto. When formulated, it may be prepared using diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, surfactants, etc. which are commonly used.
  • Solid form preparations for oral administration may include tablet pills, powders, granules, capsules, and the like, which form at least one excipient such as starch, calcium carbonate, sucrose or lactose in one or more compounds.
  • Liquid preparations for oral administration include suspensions, solutions, emulsions, and syrups, and may include various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin. have.
  • Formulations for parenteral administration may include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories.
  • non-aqueous solvent and the suspension solvent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like can be used.
  • base of the suppository witepsol, macrogol, tween 61, cacao butter, laurin butter, glycerogelatin and the like can be used.
  • the pharmaceutical composition of the present invention is not limited thereto, but tablets, pills, powders, granules, capsules, suspensions, liquid solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized formulations And it may have any one formulation selected from the group consisting of suppositories.
  • the pharmaceutical composition of the present invention is administered in a pharmaceutically effective amount.
  • the term "administration" refers to introducing a pharmaceutical composition of the present invention to a subject in any suitable manner, and the route of administration can be administered via various routes, oral or parenteral, as long as the target tissue can be reached, Specifically, it may be administered parenterally, but is not limited thereto.
  • the pharmaceutical composition may be appropriately administered to a subject according to conventional methods, routes of administration, and dosages used in the art, depending on the purpose or need.
  • routes of administration may be administered orally, parenterally, subcutaneously, intraperitoneally, pulmonary, and intranasally, and parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal or subcutaneous administration.
  • an appropriate dosage and frequency of administration may be selected according to methods known in the art, and the amount and frequency of administration of the pharmaceutical composition of the present invention to be administered may be based on the type of symptom to be treated, route of administration, sex, health condition, It may be appropriately determined by various factors such as the diet, the age and weight of the individual, and the severity of the disease.
  • the term “pharmaceutically effective amount” means an amount sufficient to inhibit or mitigate the increase in vascular permeability at a reasonable benefit / risk ratio applicable to medical use, and the effective dose level may include the type and severity, age, It may be determined according to sex, activity of the drug, sensitivity to the drug, time of administration, route of administration and rate of release, duration of treatment, factors including concurrently used drugs, and other factors well known in the medical arts.
  • the compositions of the present invention may be administered as individual therapeutic agents or in combination with other therapeutic agents and may be administered sequentially or simultaneously with conventional therapeutic agents. And single or multiple administrations. Taking all of the above factors into consideration, it is important to administer an amount that can obtain the maximum effect in a minimum amount without side effects, and can be easily determined by those skilled in the art.
  • Another aspect of the present invention is a method for preventing or treating an RNA virus infection disease, comprising administering the anti-RNA virus composition to a subject.
  • composition for anti-RNA virus and the prevention or treatment of RNA virus infection disease are as described above.
  • the term "individual” means any animal, including humans, who may or may have developed the RNA virus infection disease of the present invention. In addition, it may mean an animal except a human, but is not limited thereto.
  • administering the anti-RNA virus composition of the present invention to an individual it is possible to prevent or treat an RNA virus infection disease.
  • Another aspect of the present invention provides a quasi-drug composition for preventing or ameliorating an RNA virus infection disease, comprising the composition for an anti-RNA virus.
  • composition for anti-RNA virus, RNA virus infection disease and prevention are as described above.
  • RNA viral infection disease is improved or beneficially modified by administration of the composition of the present invention.
  • quadsi drug of the present invention refers to fibers, rubber products or the like used for the treatment, alleviation, treatment or prevention of human or animal diseases, weak action on the human body or no direct action on the human body, Non-machines and the like, and articles of manufacture which are used for the purpose of disinfection, insecticidal and similar purposes for the purpose of preventing infection, for the purpose of diagnosing, treating, reducing, treating or preventing human or animal diseases.
  • articles which are not instruments, machines or devices, and articles which are used for the purpose of pharmacologically affecting the structure and function of a person or animal, except those which are not instruments, machines or devices, and specifically, external skin preparations or individuals It may be a hygiene product, but is not limited thereto.
  • the anti-RNA virus composition of the present invention When the anti-RNA virus composition of the present invention is added to a quasi-drug composition for the purpose of preventing or improving an RNA virus infection disease, the anti-RNA virus composition may be added as it is or may be used together with other quasi-drug components. Can be used accordingly.
  • the mixing amount of the active ingredient can be suitably determined depending on the intended use.
  • the external preparation for the skin is not particularly limited thereto.
  • the skin external preparation may be used in the form of an ointment, a lotion, a spray, a patch, a cream, a powder, a suspension, a gel, or a gel.
  • the personal hygiene article is not particularly limited thereto, but may be specifically a soap, a cosmetic, a wet tissue, a tissue, a shampoo, a skin cream, a face cream, a toothpaste, a lipstick, a sunscreen lotion, or a cleaning gel.
  • Further examples of quasi-drug compositions of the present invention include disinfectant cleaners, shower foams, wipes, detergent soaps, hand washes, or ointments.
  • Another aspect of the present invention provides a food composition for preventing or ameliorating an RNA virus infection disease, comprising the composition for anti-RNA virus.
  • composition for anti-RNA virus, RNA virus infection disease, prevention and improvement are as described above.
  • the term "food” of the present invention meat, sausage, bread, chocolate, candy, snacks, confectionery, pizza, ramen, other noodles, gum, dairy products including ice cream, various soups, drinks, tea, drinks, alcoholic beverages , Vitamin complexes, nutraceuticals and health foods, and includes all foods in the usual sense.
  • the health functional food is the same term as food for special health use (FOSHU), in addition to the nutritional supply, the processed food, medical effect is high so that the bioregulatory function appears efficiently Means food.
  • 'function (sex)' means to obtain a useful effect for health purposes such as nutrient control or physiological action on the structure and function of the human body.
  • the health food (health food) means a food having an active health maintenance or promotion effect compared to the general food
  • the health supplement food means a food for health supplement purposes.
  • nutraceutical, health food, health supplement food may be used.
  • the health functional food is a food prepared by adding the anti-RNA virus composition of the present invention to food materials such as beverages, teas, spices, gums, confectionery, or the like, encapsulated, powdered, suspensions, etc. If you mean to bring a specific effect on health, unlike general medicine has the advantage that there is no side effect that can occur when taking long-term use of the drug as a raw material.
  • the food of the present invention may be prepared by a method commonly used in the art, and may be prepared by adding raw materials and ingredients commonly added in the art.
  • the food composition may be prepared in various forms of formulation as long as the formulation is recognized as a food.
  • the food composition may further include a physiologically acceptable carrier, the type of carrier is not particularly limited and may be used as long as the carrier is commonly used in the art.
  • the food composition may include additional ingredients that are commonly used in food compositions to improve the smell, taste, time and the like.
  • additional ingredients may include vitamins A, C, D, E, B1, B2, B6, B12, niacin, biotin, folate, panthotenic acid, and the like.
  • minerals such as zinc (Zn), iron (Fe), calcium (Ca), chromium (Cr), magnesium (Mg), manganese (Mn), copper (Cu) and chromium (Cr); And amino acids such as lysine, tryptophan, cysteine, valine and the like.
  • the food composition is a preservative (potassium sorbate, sodium benzoate, salicylic acid, sodium dehydroacetic acid, etc.), fungicides (bleaching powder and highly bleaching powder, sodium hypochlorite, etc.), antioxidants (butylhydroxyanisol (BHA), butylhydride) Oxytoluene (BHT), etc.), colorant (such as tar pigment), colorant (sodium nitrite, sodium nitrite, etc.), bleach (sodium sulfite), seasoning (MSG glutamate, etc.), sweetener (ducin, cyclate, saccharin Foods such as sodium, etc.), fragrances (vanillin, lactones, etc.), swelling agents (alum, potassium D-tartrate, etc.), reinforcing agents, emulsifiers, thickeners (foils), coatings, gum herbicides, foam inhibitors, solvents, modifiers, etc. It may include food additives.
  • the additive may be
  • Still another aspect of the present invention provides a cosmetic composition for preventing or improving an RNA virus infection disease, comprising the composition for anti-RNA virus.
  • composition for anti-RNA virus, RNA virus infection disease, prevention and improvement are as described above.
  • Formulation of the cosmetic composition is a solution, external ointment, cream, foam, nourishing lotion, softening lotion, perfume, pack, softening water, latex, makeup base, essence, soap, liquid cleanser, bath, sunscreen cream, sun oil, suspension , Emulsions, pastes, gels, lotions, powders, soaps, surfactant-containing cleansing, oils, powder foundations, emulsion foundations, wax foundations, patches or sprays
  • the cosmetic composition may further include one or more cosmetically acceptable carriers formulated in general skin cosmetics, and as a typical component, for example, oil, water, surfactants, moisturizers, lower alcohols, thickeners, chelating agents Inorganic salts, pigments, antioxidants, fungicides, preservatives, flavorings, etc. may be appropriately blended, but is not limited thereto.
  • one or more cosmetically acceptable carriers formulated in general skin cosmetics, and as a typical component, for example, oil, water, surfactants, moisturizers, lower alcohols, thickeners, chelating agents Inorganic salts, pigments, antioxidants, fungicides, preservatives, flavorings, etc. may be appropriately blended, but is not limited thereto.
  • the cosmetically acceptable carrier varies depending on the formulation of the cosmetic composition.
  • the formulation is an ointment, paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, trakant, cellulose derivative, polyethylene glycol, silicone, bentonite, silica, talc or zinc oxide may be used as a carrier component. It may be, but is not limited thereto. These may be used alone or in combination of two or more thereof.
  • lactose When the formulation is a powder or a spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, polyamide powder, and the like can be used, in particular, in the case of a spray, additionally chlorofluorohydrocarbons.
  • Propellant such as, but not limited to, propane / butane or dimethyl ether. These may be used alone or in combination of two or more thereof.
  • a solvent, solubilizer or emulsion may be used as the carrier component, such as water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol , 1,3-butylglycol oil and the like can be used, and in particular, cottonseed oil, peanut oil, corn seed oil, olive oil, castor oil and sesame oil, fatty acid esters of glycerol aliphatic ester, polyethylene glycol or sorbitan are used. It may be, but is not limited thereto. These may be used alone or in combination of two or more thereof.
  • liquid carrier diluents such as water, ethanol or propylene glycol
  • suspending agents such as ethoxylated isostearyl alcohol, polyoxyethylene sorbitol esters and polyoxyethylene sorbitan esters, microcrystalline Cellulose, aluminum metahydroxyde, bentonite, agar or tracant may be used, but is not limited thereto. These may be used alone or in combination of two or more thereof.
  • the formulation of the present invention is a soap
  • alkali metal salts of fatty acids fatty acid hemiester salts, fatty acid protein hydrolyzates, isethionates, lanolin derivatives, aliphatic alcohols, vegetable oils, glycerol, sugars and the like are used as carrier components. It may be, but is not limited thereto. These may be used alone or in combination of two or more thereof.
  • Another aspect of the present invention provides a feed composition for preventing or ameliorating an RNA virus infection disease, comprising the composition for anti-RNA virus.
  • composition for anti-RNA virus, RNA virus infection disease, prevention and improvement are as described above.
  • feed of the present invention is any natural or artificial diet, one meal, or the like, or any one of the ingredients for eating, ingesting, and digesting an animal, wherein the composition for an anti-RNA virus is used as an active ingredient.
  • the feed comprising may be prepared in various forms of feed known in the art, and may preferably include rich feed, forage and / or special feed.
  • Another aspect of the invention provides a method for preventing or inhibiting MAVS protein degradation, comprising administering the anti-RNA virus composition.
  • composition for anti-RNA virus is as described above.
  • HEK293T, HeLa, MDCK, Vero and RAW264.7 cells were cultured in DMEM medium containing 10% FBS (Fetal bovine serum, Gibco-BRL) and 1% penicillin-streptomycin (Gibco-BRL), with U937 cells 10 Incubation was made in RPMI 1640 medium (Gibco-BRL) containing% FBS and 1% penicillin-streptomycin. The cells were all sold from the American Type Culture Collection (ATCC).
  • BMDM Bone marrow derived macrophage
  • ACK ammonium-chloride-potassium
  • the stable EPRS knockdown RAW264.7 cell line was constructed by treating shRNA (kindly provided by Dr. Jae U. Jung, University of Southern California) and selecting with 2 ⁇ g / ml puromycin for at least 2 weeks.
  • RAW264.7 cell lines stably expressing pIRES or pIRES-EPRS-FLAG were constructed by transforming with corresponding DNA constructs and incubated in DMEM containing 1 ⁇ g / ml puromycin.
  • HEK293T cells were transformed with DNA plasmid constructs using X-tremeGENE HP DNA transfection reagent (Roche).
  • U937, RAW264.7 and BMDM cells were transformed with nucleotransfector (Lonza, Cologne AG, Germany), immediately incubated for 6 hours in Opti-MEM medium (Gibco-BRL) and then completely containing 10% FBS for 24 hours. Cultured in the medium.
  • C57BL / 6 EPRS tm1b heterozygous knockout mice were distributed from the Toronto Center for Phenogenomics (Ontario, Canada) and raised in a facility free of water and feed and free of specific pathogens with a 12-hour light / cancer cycle at 22 ⁇ 2 ° C. It was.
  • Mouse pups were genotyped by PCR using the following primers.
  • mice were sacrificed by choking with CO 2 . All animal experiments were approved by the Laboratory Animal Steering Committee of the Korea Research Institute of Bioscience and Biotechnology, and were conducted in accordance with the Guidelines for Management and Use of Laboratory Animals (published by the National Institutes of Health).
  • mice were infected by intravenous injection of VSV-Indiana (2 ⁇ 10 8 pfu / mouse) or VSV-GFP (2 ⁇ 10 8 pfu / mouse).
  • anti-EPRS anti-MRS
  • anti-KRS anti-PCBP2
  • anti-Ceruloplasmin anti-Ceruloplasmin
  • And anti-VSV-G anti-VSV-G (ab1874)
  • Anti-MAVS human-specific; 3993, rodent-specific; 4983
  • anti-L13a 2765
  • anti-IRF3 anti-phospho-IRF3
  • anti-STAT1 9172
  • anti-phospho -STAT1 anti-Actin-HRP (12620)
  • Anti-NSAP1 AV40641), anti-GAPDH (G9545), and anti-FLAG (F3165) (Sigma);
  • Anti-Ub anti-8017), anti-GFP (sc-9996), and anti-GST (sc-459) (Santa Cruz Biotechnology);
  • An affinity-purified rabbit polyclonal phosphate-specific antibody against Ser990 was produced using a 983 DGQRKDP (p) SKNQGGG 996 peptide (SEQ ID NO: 5) (AbClon, Seoul, Korea). Phosphoric acid-specific Ser886 and Ser999 antibodies are described by Dr. Paul L. Fox (Lerner Research Institute, Cleveland Clinic, CLV, USA). Goat anti-mouse (7076) or anti-rabbit (7074) IgG-HRP (Cell Signaling Technology) was used as secondary antibody in immunoblotting.
  • Alexa488-binding anti mouse IgG (A11059, Invitrogen) and Alexa594-binding anti rabbit IgG (A11037, Invitrogen) were used as secondary antibodies in immunofluorescence experiments.
  • Other reagents and materials include MG-132 (Sigma), Puromycin (Gibco-BRL), poly (I: C) (InvivoGen), IFN- ⁇ (R & D Systems), Digitonin (digitonin, Sigma), protein A / G PLUS-agarose (sc-2003, Santa Cruz Biotechnology), Glutathione Sepharose 4 Fast Flow (17-5132-01, GE Healthcare), anti-FLAG M2 affinity gel (A2220, Sigma), Strep-Tactin Sepharose (2-1201 -002, IBA), Ni-NTA agarose (30230, Qiagen), GFP-trap (gta-20, ChromoTek, Germany), and Superdex 200 10/300 GL column (GE Healthcare) were used.
  • EPRS constructs were constructed with FLAG, Strep, His or GFP tags. Specifically, EPRS fragments carrying each domain were amplified by PCR and subcloned into vectors containing GFP, Strep, His or FLAG tags.
  • the phosphomimetic variants of EPRS (S886D, S990D, S999D, S886D / S990D and S886D / S999D) were made by PCR using a QuikChange site-directed mutagenesis kit (Stratagene, Amsterdam, Netherlands). PCR primers for site specific mutations are shown in Table 1 below.
  • NHBE normal human bronchial epithelial cells
  • Total RNA was isolated from infected cells using RNeasy RNA extraction minikit (Qiagen), the quality of the isolated RNA was confirmed by agarose gel electrophoresis.
  • Sequencing libraries were prepared using TruSeq RNA sample preparation kit v2 (Illumina). Specifically, mRNA isolated from total RNA was fragmented and converted to cDNA using poly-T oligo-attached magnetic beads. An adapter was connected to the cDNA and amplified by PCR. Paired-end sequencing (101 ⁇ 2) was performed using Hiseq-2000 (Illumina). The sequence was analyzed repeatedly in each condition. Human standard genomic sequence data was obtained from the University of California Santa Cruz Genome Browser Gateway (assembly ID: hg19). Standard genome indices were established using SAMtools (v. 0.1.19) and Bowtie2-build component of Bowtie2 (v. 2.1.0).
  • RNA-seq data described in the present invention was registered with accession code GSE75699 to Gene Expression Omnibus (GEO) of NCBI.
  • HEK293T cells were transformed with a mixture containing a luciferase reporter plasmid, a renilla luciferase internal control vector (phRL-TK; Promega) and each plasmid. Reporter gene analysis was performed 24 hours after transformation using a luminometer (Promega) and a dual-luciferase reporter assay system (Promega). The data is shown by normalizing Firefly luciferase activity relative to Renilla luciferase activity. Promoter activity of cells expressing only the reporter and the Renilla plasmid was measured as a control (Con).
  • Non-target siRNA was used as a control, and cells were cultured in the condition of addition of siRNA or control for 36 to 48 hours before exposure to the virus.
  • Virus titers were confirmed in MDCK cells (PR8-GFP) or Vero cells (VSV-GFP, HSV-GFP) using standard plaque assay. Plaque counting was performed using homogenates of freeze-thaw tissue extracts when titrating virus present in mouse tissues. Replication of GFP tagged virus was measured using a fluorescence module of GloMax® Multi-Microplate Multimode Reader (Promega). The photographs were taken using a Nikon eclipse Ti microscope fitted with a 20 x 1.4 NA Plan-Apochromat objective lens.
  • Cytokine levels were measured from cell culture supernatants or mouse serum infected with ELISA.
  • the following ELISA kits were used according to the manufacturer's instructions: mouse or human IL-6 (BD Biosciences), IFN- ⁇ and IFN- ⁇ (PBL interferon source), and IFN- ⁇ (KOMA, Korea).
  • cDNA was synthesized using the Enzynomix kit (Enzynomix), and quantitative PCR was performed using a gene-specific primer set (Bioneer, Daejeon, Korea) and SYBR Green PCR Master Mix (Roche).
  • Real-time PCR was performed using a Rotor-Gene Q instrument (Qiagen) according to the manufacturer's instructions. Data is gapdh Normalized to expression and relative expression was calculated by delta-delta CT method. Primer sequences used are summarized in Table 1 above.
  • cell lysates were prepared with Phosphosafe extraction buffer (Millipore) containing a protease inhibitor cocktail at 4 ° C.
  • cell lysates were pre-washed with protein A beads for 1 hour at 4 ° C.
  • the pre-washed cell lysates were incubated with each antibody at 4 ° C. overnight and then incubated with 30 ⁇ l of protein A / G PLUS-agarose beads at 4 ° C. for 3 to 4 hours.
  • the immunoprecipitate was then recovered and washed five times with lysis buffer before immunoblotting analysis.
  • His (hexahistidine) -tagged EPRS (aa 1-732, aa 1-196, and aa 1-168), His-tagged PCBP2 (aa 11-82 and aa 168-279), GST-fused PCBP2 (aa 11-82 ), Or a plasmid expressing the GST-fused MAVS (aa 460-540) protein was transformed into E. coli BL21-CodonPlus (DE3) -RIPL cells, and expression was induced by treatment with 0.5 mM IPTG at 18 ° C. for 18 hours. . The cells were then suspended in buffer A (50 mM Tris-HCl, pH 7.5 and 150 mM NaCl) and lysed by sonication on ice.
  • buffer A 50 mM Tris-HCl, pH 7.5 and 150 mM NaCl
  • Purified EPRS (aa 1-732) was investigated by size-exclusion chromatography using a Superdex 200 10/300 GL column at 4 ° C. Alcohol dehydrogenase (150 kDa) and albumin (66 kDa) were used as the molecular weight basis. All eluted proteins were analyzed by SDS-PAGE and stained with Coomassie Brilliant Blue.
  • Purified Hig-tag EPRS domain (10 ⁇ ) and GST-fusion PCBP2 domain (20 ⁇ ) were mixed in binding buffer (50 mM Tris-HCl, pH 7.5, and 300 mM NaCl). Furthermore, purified GST-fusion MAVS (10 ⁇ M) was mixed with Hig-tagged PCBP2 domain (5 ⁇ M) in binding buffer. The protein mixture was then incubated with 50 ⁇ l Ni-NTA agarose beads at 4 ° C. for 1 hour.
  • Brain samples were fixed with 4% paraformaldehyde, encapsulated with paraffin and cut into 4 ⁇ m thick sections. Sections were deparaffinized with xylene and stained with H & E.
  • Fluorescence images were captured with a Nikon laser scanning confocal microscope (C2plus, Tokyo, Japan) and worked using NIS-Elements software (Nikon).
  • HeLa cells were seeded in 8-well plates (Labtek). After the virus was infected, the infected cells were fixed with 4% paraformaldehyde for 20 minutes at room temperature. Cells were incubated with 25 ⁇ g / ml Digitonin for 10 minutes on ice to obtain a clear image of the MSC complex. After permeation with 100% MeOH for 20 minutes at ⁇ 20 ° C., cells were blocked in PBS containing 2% BSA for 1 hour at room temperature. Cells were then washed three times with PBS-T (PBS containing 0.05% Tween-20) and incubated overnight at 4 ° C. with a suitable primary antibody.
  • PBS-T PBS containing 0.05% Tween-20
  • Example 16 a mass analysis in order to identify the phosphorylation location and interaction member (interactome) EPRS of (mass spectrometry)
  • IBA Strep-Tactin Superflow high capacity resin
  • the resin was then washed five times with lysis buffer and the bound protein was eluted with elution buffer (100 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM EDTA, and 2.5 mM desthiobiotin). . Finally, the eluted fractions were concentrated with Amicon Ultra-4 (10 K MWCO) centrifuge (Millipore). The samples were analyzed by SDS-PAGE and silver staining. The stained protein bands were then cut and digested with trypsin on gel.
  • elution buffer 100 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM EDTA, and 2.5 mM desthiobiotin.
  • the trypsin digest peptide was recovered and loaded into a reversed-phase Magic 18aq (5 ⁇ m, 200 ⁇ s, Michrom BioResourecs) column (15 cm ⁇ 75 ⁇ m, packed in-house) coupled to an Eksigent MDLC system.
  • the peptide was eluted at 300 nL / min flow rate with a linear gradient of 5-40% acetonitrile containing acidic water (0.1% formic acid) for 40 minutes.
  • the HPLC system was coupled to an LTQ XL-Orbitrap Mass Spectrometer (Thermo Scientific).
  • a Survey full-scan MS spectra (300-2,000 m / z) was obtained at 100,000 resolution.
  • Sources of ionization parameters are as follows: spray voltage, 1.9 kV; Capillary temperature, 250 ° C.
  • MS / MS spectra for the strongest ions at two or more charge states in the MS1 scan were obtained using the following options: isolation width, 2.0 m / z; normalized collision energy, 35%; and dynamic exclusion duration, 30 s.
  • Raw data was found using the SEQUEST algorithm from Proteome Discoverer 1.4 (Thermo Scientific) and the MASCOT search engine (v. 2.3.01; Matrix Science).
  • Human Uniprot database (published Jul. 2013) was found using the following parameters.
  • HEK293T cells were transformed with various combinations of MAVS-FLAG, ITCH-V5, GST-PCBP2 and Strep-EPRS plasmids. After 24 hours, cells were treated with 10 ⁇ M MG-132 for 6 hours, lysed with RIPA buffer, and immunoprecipitation was performed with anti-FLAG affinity gel at 4 ° C. for 6 hours. To see the ubiquitination of endogenous MAVS, cell lysates were incubated with anti-MAVS antibody overnight and incubated with protein A / G PLUS-agarose beads for 3 hours at 4 ° C. The immune complexes were then washed 5 times with lysis buffer and heated in SDS sample buffer for 10 minutes.
  • Ubiquitination was analyzed using anti-Ub or anti-K48 antibodies.
  • Strep-MAVS, Strep-PCBP2 and Strep-EPRS proteins were precipitated in lysates of HEK293T transformed with each plasmid.
  • ITCH-V5 protein was prepared by incubating anti-V5 antibody with lysate and incubated with protein A / G PLUS-agarose beads. Purified protein was incubated for 1 hour at 37 ° C. with ubiquitin, El and E2 (Boston Biochem) of UbcH5b in a reaction buffer containing Mg 2 + -ATP. The reaction was terminated by adding SDS sample buffer containing 1 mM DTT and heating for 10 minutes, and ubiquitination was detected with anti-Ub antibody.
  • EPRS L1 (aa 168-196) was fused with cell permeable HIV-1 TAT peptide (aa 47-57, YGRKKRRQRRR; SEQ ID NO: 60). Fusion peptides were synthesized (Tat-Epep) and purified over 93% by reversed phase HPLC (AbClon).
  • the Tat-Epep sequence is YGRKKRRQRRR-GG-DVSTTKARVAPEKKQDVGKFVELPGAEMG (SEQ ID NO: 61).
  • the TAT latency YGRKKRRQRRR sequence (SEQ ID NO: 60) was used as a control peptide, and the lyophilized peptide was stored in desiccant at -80 ° C and dissolved in PBS before use.
  • HEK293T or RAW264.7 cells were seeded in 96-well plates (10,000 per well) and then treated with Tat-Epep (20-200 ⁇ M) for 0-24 hours.
  • cytotoxicity was determined by colorimetric analysis using MTS [3- (4,5-dimethylthiazole-2-yl) -5- (carboxymethoxyphenyl) -2- (4-sulfophenyl) -2H-tetrazolium salt] (Promega). Confirmed. 20 ⁇ l of MTS was added to each well at 37 ° C. for 1 hour.
  • An automated microplate reader BioTek was used to measure the optical density at 490 nm and the background absorbance at 630 nm was subtracted from each sample reading.
  • mice C57BL / 6 mice (female, 7 weeks old) were purchased from Goatech (Pyeongtaek, Korea) and infected by intravenous administration of VSV-Indiana (2 ⁇ 10 8 pfu / mouse). After 24 hours, Tat-Epep (2.5 mg / kg [0.53 ⁇ M / kg] or 5 mg / kg [1.05 ⁇ M / kg]) was administered intraperitoneally of mice daily for 3 days. Tat PTD peptide (1.65 mg / kg [1.05 ⁇ M / kg]) was used as a control. On day 4, brain tissue was recovered from the mice. The recovered samples were immediately homogenized using a TissueLyser instrument (Qiagen) and virus titers were measured by the method described above.
  • Tat-Epep 2.5 mg / kg [0.53 ⁇ M / kg] or 5 mg / kg [1.05 ⁇ M / kg]
  • Tat PTD peptide (1.65 mg / kg [1.0
  • ARS Aminoacyl-tRNA synthetases
  • MSC Multi-tRNA synthetase complex
  • EPRS glutamyl-prolyl-tRNA synthetase
  • EPRS-knockdown cells significantly reduced antiviral cytokine (IFN- ⁇ and IL-6) production for viral infection or synthetic dsRNA poly (I: C) treatment (FIGS. 8 and 9).
  • HSV did not significantly change cytokine induction (Figs. 8 and 9).
  • Similar results were confirmed in the EPRS-knockdown HEK293T cell line (FIGS. 10-12) and RAW264.7 cell line (FIGS. 13-19) stably knocked down EPRS using shRNA.
  • the activation of the IFN-associated signaling molecules IRF3 and STAT1 in EPRS-knockdown cells was markedly reduced (FIG. 20).
  • RAW264.7 cells stably overexpressing EPRS FIG. 21
  • viral replication was greatly reduced by PR8 (FIGS. 22-24) or VSV (FIGS. 25-27) infection, and IFN- ⁇ and IL- 6 production increased.
  • VSV-GFP recombinant VSV-GFP was intravenously administered to EPRS + / + and EPRS +/ ⁇ mice, and the amount of virus and antiviral cytokines in serum samples 12 hours after infection. Cain levels were measured. As a result, it was confirmed that viremia was high (FIG. 42) and that IFN- ⁇ , IFN- ⁇ , and IL-6 levels were low in the serum (FIG. 43).
  • brain tissue specimens were collected on days 0-5 of infection and examined for histological characteristics induced by VSV.
  • H & E hematoxylin-eosin
  • significant infiltration of inflammatory cells was observed (particularly around the lateral ventricular region) compared to EPRS + / + mice (FIG. 44).
  • immunohistochemical analysis of brain tissue sections stained with anti-VSV-G antibodies confirmed the presence of the infected virus at sites around inflammation, and virus removal was slower in EPRS +/- mice compared to EPRS + / + mice. Proceeded (FIG. 45).
  • RAW264.7 macrophage lysates infected with PR8 were co-immunoprecipitated (co-IP) with anti-EPRS or anti-KRS antibodies to confirm that the release of EPRS from the MSC was caused by the virus (FIG. 47 and FIG. 48).
  • Confocal microscopic analysis also showed that EPRS was present at the same location as KRS, but it was confirmed that the signal present at the same location decreased with viral infection (FIGS. 49-51). The results indicate that there is a clear virus-specific mechanism of action associated with EPRS activity.
  • phosphate-peptide 983 DGQRKDP (p) SKNQGGG 996 as antigen (SEQ ID NO: 62) to prepare a rabbit polyclonal antibody to this position.
  • Phosphorylation of the EPRS Ser990 site gradually increased after PR8 infection of U937 cells (FIG. 58).
  • IFN- ⁇ treatment did not induce phosphorylation of Ser990 (FIG. 58).
  • Similar results could be observed in cells treated with other viruses or synthetic RNA (FIGS. 59-62).
  • the intracellular sensor RIG-I When the virus enters the cell, the intracellular sensor RIG-I is activated. RIG-I then interacts with MAVS to trigger a signaling cascade that ends in the production of type I IFN.
  • Analysis of the signaling cascade confirmed that EPRS increased RIG-I-, MDA5-, poly (I: C)-, and MAVS-mediated IFN- ⁇ promoter activity in a dose-dependent manner (FIG. 69).
  • no significant activity of the IFN- ⁇ promoter was observed in the presence of TRAF3, TBK1, or IRF7 (FIG. 70).
  • the results indicate that EPRS acts as a positive regulator of the type I IFN pathway, downstream of MAVS and upstream of the TRF3 signaling axis.
  • EPRS-interacting molecules that regulate MAVS signaling during virus infection
  • protein analysis was performed using strep-EPRS-specific complexes isolated from cells infected with PR8 (FIG. 71).
  • MSC protein was present, but GAIT protein (NSAP, GAPDH and L13a) was not present.
  • EPRS interacted with PCBP2, which is known to cause ubiquitination and degradation of MAVS upon viral infection.
  • Endogenous co-IP analysis confirmed virus-induced EPRS and PCBP2 interaction in RAW264.7 and U937 cells, and the interaction of the two proteins increased with time (FIGS. 72 and 73).
  • PCBP2 migrated from the nucleus to the cytoplasm upon viral infection, confirming that it was present at the same position as EPRS (FIG. 74).
  • EPRS regions that interact with PCBP2 plasmid constructs containing various EPRS domains were prepared (FIG. 75).
  • the full length amino acid sequence of EPRS is 1512 sequences represented by SEQ ID NO: 63.
  • Co-IP was then performed to confirm the interaction of each EPRS region and PCBP2.
  • the N-terminal region of EPRS containing the GST-like domain and linker region L1 (aa 1-196) is critical for interaction with PCBP2, which region is IFN- at a level similar to that induced by full length EPRS. It was confirmed to induce ⁇ promoter activity.
  • GST-like domain alone (aa 1-168) did not induce antiviral activity (FIGS. 75-79).
  • the inventors have found that L1-defective mutations do not interact with PCBP2 and reduce the ability to induce IFN- ⁇ , resulting in fragments comprising the L1 region (aa 168-196) and the L1 region (aa 168-269). It was confirmed that it had an antiviral effect (FIGS. 80 and 81).
  • PCBP2 has been reported to induce MAVS ubiquitination by proteasome degradation by inducing viral interactions and interacting with MAVS.
  • EPRS would protect MAVS by preventing PCBP2-mediated ubiquitination.
  • the MAVS specifically interacts with the PCBP2 KH1 domain, which is a domain that binds to EPRS (FIGS. 87 to 90).
  • Targeting the same KH1 domain by EPRS and MAVS suggests that EPRS can compete with MAVS, preventing the interaction of MAVS and PCBP2.
  • PCBP2 attracts ITCHE3 ligase to promote ubiquitin (Ub) -mediated degradation of MAVS.
  • Ub ubiquitin
  • MAVS-FLAG exogenously expressed in 293T cells is ubiquitated by ITCH, and the response is significantly increased by the addition of PCBP2 (FIG. 94).
  • EPRS inhibited PCBP2-mediated MAVS ubiquitination dose-dependently (FIG. 94).
  • endogenous MAVS ubiquitination was markedly enhanced by PCBP2, but was found to significantly decrease in the presence of EPRS (FIG. 95).
  • exogenous (FIG. 96) and endogenous (FIG. 97) MAVS were degraded by PCBP2, but confirmed to be recovered by the addition of EPRS.
  • EPRS can specifically block PCBP2-mediated negative regulation of MAVS, maintaining a strong antiviral immune response.
  • EPRS inhibits PCBP2-mediated degradation of MAVS in antiviral immune responses, in particular the EPRS L1 region (aa 168-196) is essential for PCBP2 interaction and enhances antiviral type I IFN signaling. It was confirmed that it plays a role. Accordingly, the present inventors prepared a cell-permeable peptide (hereinafter referred to as 'Tat-Epep', SEQ ID NO: 61) fused with an HIV-1 Tat protein transduction domain and an EPRS L1 peptide, wherein Viral activity was investigated. Tat-Epep inhibited PCBP2-mediated endogenous MAVS ubiquitination (FIG. 99) and restored intracellular levels of MAVS (FIG. 100).
  • 'Tat-Epep' SEQ ID NO: 61
  • Tat-Epep also increased the production of IFN- ⁇ and IL-6 in virus infected cells (FIG. 101) and reduced VSV replication dose-dependently in RAW264.7 cells (FIG. 102 and FIG. 103).
  • Tat-Epep did not show antiviral activity in RAW264.7 cells infected with HSV (FIGS. 104-106), which means that Tat-Epep is specific for RNA virus infection.
  • Tat-Epep did not affect the viability of RAW264.7 or 293T cells in the concentration range tested, meaning that the decrease in viral titer was not due to peptide-mediated cytotoxicity (FIGS. 107 and 108).
  • the results suggest that Tat-Epep has an excellent effect as an anti-RNA virus agent that increases MAVS viability and type I IFN production.
  • Tat-Epep intravenously administered VSV-Indiana strains to mice. After administration, Tat or Tat-Epep was administered daily for 3 days in mouse abdominal cavity. As a result, mice treated with Tat-Epep significantly reduced virus titers in brain tissues compared to mice treated with Tat-tag (FIG. 109). The data further demonstrate that Tat-Epep has an excellent effect as an anti-RNA viral agent.
  • the inventors further defined the EPRS L1 peptide portion of the Tat-Epep to 21 mers (aa 166-186) to prepare a new peptide (hereinafter referred to as 'New Tat-Epep').
  • New Tat-Epep has the amino acid sequence of YGRKKRRQRRR-GG-KWDVSTTKARVAPEKKQDVGK (SEQ ID NO: 64).
  • mice treated with VSV intravenously in the same manner as in Example 6-1 (TAT-control: 100 ⁇ g, 7; New Tat-Epep: 200 ⁇ g, 3) were found to be Tat-Epep.
  • TAT-control 100 ⁇ g, 7
  • New Tat-Epep 200 ⁇ g, 3
  • New Tat-Epep was treated in VS26-GAP virus-infected RAW264.7 cells, the secretion of the antiviral cytokines IFN- ⁇ and IL-6 was promoted two to three times higher than Tat-Epep. It was confirmed (FIG. 111-113). Through the above results, it was found that New Tat-Epep also has an excellent effect as an anti-RNA virus agent.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Cosmetics (AREA)

Abstract

본 발명은 EPRS (glutamyl-prolyl-tRNA synthetase) 단백질 또는 이의 단편을 포함하는 항RNA 바이러스용 조성물, RNA 바이러스 감염 질환의 예방 또는 치료용 조성물, 및 상기 조성물을 이용한 RNA 바이러스 감염 질환의 예방 또는 치료 방법에 관한 것이다. 본 발명의 EPRS 단백질 또는 이의 단편을 포함하는 조성물은 PCBP2 단백질에 결합하여 MAVS 신호전달 경로를 활성화시킴으로써 항RNA 바이러스 효과를 가지므로, RNA 감염 질환의 예방 또는 치료용 조성물로 우수한 효과가 있다.

Description

EPRS 단백질 또는 이의 단편을 포함하는 항RNA-바이러스용 조성물
본 발명은 EPRS (glutamyl-prolyl-tRNA synthetase) 단백질 또는 이의 단편을 포함하는 항RNA 바이러스용 조성물, RNA 바이러스 감염 질환의 예방 또는 치료용 조성물, 및 상기 조성물을 이용한 RNA 바이러스 감염 질환의 예방 또는 치료 방법에 관한 것이다.
ARS (Aminoacyl-tRNA synthetases)는 아미노아실화를 촉매하는데 필수적인 효소로서, 고성능 단백질 합성을 보장한다. ARS의 촉매 영역은 세 개의 계 (kingdom)에 높은 수준으로 보존되어 있다. 세포질에 존재하는 ARS는 원핵생물의 호몰로그 (homologues)에도 존재하지 않을뿐더러 효소적 코어 부분도 존재하지 않는 독특한 구조적 특성을 가지는 새로운 도메인 스위치의 추가를 포함해, 고등 동물이 진화하는 과정에서 크게 변화하였다. 특히, 상기 추가 영역은 넓은 범위의 생물학적 기능과 관련이 있다. 이에, ARS는 단백질 합성을 넘어 새로운 분류의 조절 단백질로서 알려져 있다. 고등생물에서 다 수의 ARS의 활성은 MSC (multi-tRNA synthetase complex)라 불리우는 세포질 저장 시스템 내에 존재함으로써 조절되는 것으로 나타났다. 상기 MSC는 대부분의 경우 추가 도메인을 통해 조립되며, EPRS (glutamyl-prolyl-tRNA syntetase), 및 세 개의 ARS-상호작용 다기능 단백질 (AIMP1/p43, AIMP2/p38, 및 AIMP3/p38)을 포함하는 여덟 종의 tRNA 합성효소로 이루어져 있다 (Trends Biochem. Sci, 2007, 35: 158-164).
스트레스 조건 하에서, EPRS, MRS (methionyl-tRNA synthetase), KRS (lysyl-tRNA synthetase), AIMP1, 및 AIMP2를 포함하는 여러 MSC 구성요소는 번역 후 변형 과정을 통해 복합체로부터 방출되어 비번역 과정으로 염증, 세포 대사, 혈관신생 및 종양 형성과 같은 활성을 나타내는 것으로 알려졌다 (Trends Biochem. Sci, 2009, 34: 324-331). 인산화는 세포 내에서 ARS의 비번역적 기능을 결정하는데 핵심적인 조절 작용기전이다. 대표적인 예시로, 유일한 이작용 (bifunctional) tRNA 합성효소인 EPRS가 있다. EPRS는 ERS 및 PRS가 세 개의 WHEP 도메인을 포함하는 링커를 통해 서로 연결된 형태로 구성되어 있다. MSC로부터 방출을 유도할 수 있는 특성에 비추어, EPRS는 MSC의 외부에 존재하는 것으로 여겨진다. EPRS의 ERS 및 PRS 도메인 사이에 위치하는 Ser886 및 Ser999 잔기는 IFN-γ로 자극되어 연속적으로 인산화 되고, 이에 따라 MSC로부터 방출이 촉진된다. EPRS가 MSC로부터 방출되면, NSAP1 (NS1-associated protein 1), 인산화된 리보솜 단백질 L13a, 및 GAPDH (glyceraldehyde-3-phosphate dehydrogenase)와 상호작용하여 GAIT (IFN-γ-activated inhibitor of translation) 복합체를 형성한다. 상기 조절 복합체는 세룰로플라스민 (ceruloplasmin, Cp)과 같은 염증 단백질을 코딩하는 mRNA의 특정 3'-UTR (untranslated region)에 결합하여 이들의 번역을 억제한다. 이러한 특이적 기능은 감염 초기 이에 반응하여 생성되는 해로운 전-염증성 분자의 발현을 조절함으로써 만성 염증을 완화시키는데 기여하는 것으로 생각된다. 그러나 IFN-γ는 감염 후기 후천성 면역 반응 동안에 생산되는 것이고, 주로 IL-12에 의해 활성화된 NK (natural killer) 세포 또는 Th1 세포에 의해 분비된다는 사실에 주목할 필요가 있다.
선천성 면역반응은 감염 초기에 첫 번째 방어막이 된다. 항바이러스 신호전달은 바이러스 감염에 반응하여 진화한 핵심적 세포 과정이다. 상기 신호전달은 바이러스 RNA를 검출하는 핵심 세포질 센서 RIG-I (retinoic acid-inducible gene-I) 및 MDA5 (melanoma differentiation-associated protein 5)를 포함하는 RIG-I 유사 수용체 (RLR) 경로에 의해 주로 활성화된다. 그 다음, 상기 센서는 핵심 항바이러스 신호전달 단백질 MAVS (mitochondria antiviral signaling protein)와 상호작용하고, 세포질 내 인산화 효소인 IKK 및 TBK1을 통해 각각 전사인자 NF-kB 및 IRF3를 활성화시킨다. 상기 신호전달은 궁극적으로 I 형 IFN 및 기타 항바이러스 분자의 유도를 야기한다 (Cell, 2006, 124: 783-801). 이 신호전달 경로는 단백질의 복합체 네트워크를 통해 항바이러스 반응을 조절하는 양성 및 음성 조절 작용기전에 의해 적절하게 조절된다. 따라서, 바이러스의 RNA에 의해 RLR 경로가 활성화되고, 이에 따라 MAVS에 의해 면역반응이 활성화되므로, MAVS의 분해를 막는 경우 RNA 바이러스에 대해 범용적인 항바이러스 활성을 가진다.
본 발명자들은 바이러스 감염을 예방 또는 치료할 수 있는 항바이러스용 조성물을 개발하기 위해 예의 노력한 결과, MSC의 구성요소 중 하나인 EPRS 단백질 또는 이의 단편이 감염-특이적인 변형을 통해 핵심 항바이러스 신호전달 단백질 MAVS의 음성 조절자인 PCBP2 (poly(rC)-binding protein 2)로부터 MAVS를 보호하고, 궁극적으로는 바이러스 감염에 대한 예방 및 치료 효과를 가짐을 확인함으로써 본 발명을 완성하였다.
본 발명의 하나의 목적은, EPRS (glutamyl-prolyl-tRNA synthetase) 단백질 또는 이의 단편을 포함하며, 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것인, 항RNA 바이러스용 조성물을 제공하는 것이다.
본 발명의 다른 목적은, 항RNA 바이러스 활성을 가지는 EPRS 단백질 또는 이의 단편으로서, 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것인, 단백질 또는 이의 단편을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 단백질 또는 이의 단편을 코딩하는 폴리뉴클레오티드를 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리뉴클레오티드를 포함하는 벡터를 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 폴리뉴클레오티드 또는 벡터를 포함하는, 형질전환체를 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 치료용 약학 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 개체에 투여하는 단계를 포함하는, RNA 바이러스 감염 질환의 치료방법을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 의약외품 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 식품 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 화장료 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 사료 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 항RNA 바이러스용 조성물을 투여하는 단계를 포함하는, MAVS 단백질 분해 예방 또는 억제 방법을 제공하는 것이다.
본 발명의 EPRS 단백질 또는 이의 단편을 포함하는 조성물은 PCBP2 단백질에 결합하여, 모든 항RNA 바이러스 활성에서 중요한 역할을 하는 MAVS 신호전달 경로를 활성화시킴으로써, 범용적인 항RNA 바이러스 효과를 가지므로, RNA 감염 질환의 예방 또는 치료용 조성물로 우수한 효과가 있다.
도 1은 PR8에 감염된 기관지 상피 세포에서 MSC 유전자 (1.5 배 이상 변화)의 상향조절 (회색) 혹은 하향조절 (검정색)을 나타낸 것이다.
도 2는 EPRS의 IFN-β 프로모터 활성 유도 효과를 확인한 것이다. 선별된 MSC 유전자의 루시퍼라제 분석을 위해 RIG-I의 N-터미널 도메인 (N-RIG-I) 및 IFN-β 프로모터를 암호화하는 플라스미드를 293T 세포로 형질전환시켰다. Con은 N-RIG-I으로 형질전환하지 않은 것이다.
도 3은 바이러스에 감염된 다양한 세포주에서 EPRS 발현을 확인한 것이다.
도 4는 EPRS 발현을 면역블랏 분석으로 확인한 것이다. RAW246.7 세포는 비표적 대조군 siRNA (siCon) 또는 siEPRS로 형질전환시켰다.
도 5는 형광 현미경으로 바이러스 복제 분석을 수행한 것이다 (형광 현미경, 상단 패널; 위상차 현미경, 하단 패널). RAW264.7 세포는 siControl (siCon) 또는 siEPRS로 형질전환시켰다.
도 6은 PR8-GFP (MOI = 1) 또는 VSV-GFP (MOI= 0.5)에 감염된 후 24 시간째에 형광 분석 및 플라크 분석을 나타낸 것이다. RAW264.7 세포를 siControl (siCon) 또는 siEPRS로 형질전환시켰다.
도 7은 HSV-GFP (MOI = 1)로 감염시킨 뒤 바이러스 역가를 확인한 것이다. RAW246.7 세포는 비표적 대조군 siRNA (siCon) 또는 siEPRS로 형질전환시켰다.
도 8은 PR8-GFP, VSV-GFP, 또는 HSV-GFP (MOI = 1)로 감염시키거나, 또는 poly(I:C) (80 ㎍)을 처리한 세포의 배양 상등액에서 IFN-β의 수준을 확인한 것이다. RAW264.7 세포를 siControl (siCon) 또는 siEPRS로 형질전환시켰다.
도 9는 PR8-GFP, VSV-GFP, 또는 HSV-GFP (MOI = 1)로 감염시키거나, 또는 poly(I:C) (80 ㎍)을 처리한 세포의 배양 상등액에서 IL-6의 수준을 확인한 것이다. RAW264.7 세포를 siControl (siCon) 또는 siEPRS로 형질전환시켰다.
도 10은 siCon 또는 siEPRS로 36 시간 동안 형질전환시킨 다음 VSV-GFP (MOI = 0.0001)로 감염시킨 293T 세포의 형광 현미경 사진을 나타낸 것이다.
도 11은 siCon 또는 siEPRS로 36 시간 동안 형질전환시킨 다음 VSV-GFP (MOI = 0.0001)로 감염시킨 293T 세포에서 바이러스 복제를 확인한 것이다.
도 12는 siCon 또는 siEPRS로 36 시간 동안 형질전환시킨 다음 VSV-GFP (MOI = 0.0001)로 감염시킨 293T 세포에서 IFN-β 또는 IL-6 분비 수준을 확인한 것이다.
도 13은 PR8-GFP (MOI = 1)로 감염시킨 세포에서 EPRS 발현의 면역블랏 분석을 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 14는 PR8-GFP (MOI = 1)로 감염시킨 세포의 형광 현미경 사진을 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 15는 PR8-GFP (MOI = 1)로 감염시킨 세포에서 PR8 역가를 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 16은 PR8-GFP (MOI = 1)로 감염시킨 세포에서 IFN-β 또는 IL-6 분비 수준을 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 17은 VSV-GFP (MOI)로 감염시킨 안정적 EPRS-결손 세포의 형광 현미경 사진을 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 18은 VSV-GFP (MOI)로 감염시킨 안정적 EPRS-결손 세포에서 VSV 역가를 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 19는 VSV-GFP (MOI)로 감염시킨 안정적 EPRS-결손 세포에서 IFN-β 또는 IL-6 분비 수준을 나타낸 것이다. RAW264.7 세포는 비표적 대조군 shRNA (shCon) 또는 EPRS shRNA (shEPRS)를 도입한 다음, 퓨로마이신으로 선별하여 사용하였다.
도 20은 IRF3 및 STAT1의 인산화 또는 불활성화, 및 EPRS 및 액틴 발현을 면역블랏 분석으로 확인한 것이다. EPRS에 대한 shRNA (shEPRS) 또는 대조군 shRNA (shCon)를 발현하는 RAW264.7 세포를 표시된 시간에 PR8-GFP로 감염시켰다.
도 21은 EPRS 발현의 면역블랏 분석을 나타낸 것이다. RAW264.7 세포는 FLAG-태깅 공벡터 (Con) 또는 EPRS-FLAG (EPRS) 플라스미드로 형질전환시킨 뒤, 퓨로마이신으로 선별하였다.
도 22는 PR8-GFP에 감염된 공벡터 (Con) 또는 EPRS-낙인 (knock-in) RAW264.7 세포에 대한 형광 현미경 분석을 나타낸 것이다.
도 23은 PR8-GFP에 감염된 공벡터 (Con) 또는 EPRS-낙인 (knock-in) RAW264.7 세포에 대한 형광 분석 및 플라크 분석을 나타낸 것이다.
도 24는 PR8-GFP에 감염된 공벡터 (Con) 또는 EPRS-낙인 (knock-in) RAW264.7 세포의 IFN-β 또는 IL-6 분비를 확인한 것이다.
도 25는 VSV-GFP (MOI = 0.5)로 감염시킨 EPRS-과발현 세포의 형광 현미경 사진을 나타낸 것이다. RAW264.7 세포는 FLAG-태깅 공벡터 (Con) 또는 EPRS-FLAG (EPRS) 플라스미드로 형질전환시킨 뒤, 퓨로마이신으로 선별하였다.
도 26은 VSV-GFP (MOI = 0.5)로 감염시킨 EPRS-과발현 세포에서 VSV 역가를 확인한 것이다. RAW264.7 세포는 FLAG-태깅 공벡터 (Con) 또는 EPRS-FLAG (EPRS) 플라스미드로 형질전환시킨 뒤, 퓨로마이신으로 선별하였다.
도 27은 VSV-GFP (MOI = 0.5)로 감염시킨 EPRS-과발현 세포에서 IFN-β 또는 IL-6 분비 수준을 확인한 것이다. RAW264.7 세포는 FLAG-태깅 공벡터 (Con) 또는 EPRS-FLAG (EPRS) 플라스미드로 형질전환시킨 뒤, 퓨로마이신으로 선별하였다.
도 28은 플라크 분석으로 바이러스 역가를 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스의 BMDM을 VSV-GFP (MOI = 5) 및 PR8-GFP (MOI = 3)으로 감염시켰다.
도 29는 바이러스 감염 후 12 또는 24 시간째에 배양 상등액에서 IFN-β 및 IL-6 수준을 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스의 BMDM을 VSV-GFP (MOI = 5) 및 PR8-GFP (MOI = 3)으로 감염시켰다.
도 30은 poly(I:C) 처리 후 12 또는 24 시간째에 배양 상등액에서 IFN-β 및 IL-6 수준을 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스의 BMDM을 poly(I:C) (40 ㎍)로 처리하였다.
도 31은 BMDM에서 EPRS 발현을 면역블랏 분석으로 확인한 것이다. BMDM은 비표적 대조군 siRNA (siCon) 또는 siEPRS로 36 시간 동안 형질전환시켰다.
도 32는 감염 12 및 24 시간 후 플라크 분석을 수행하여 바이러스 역가를 확인한 것이다. BMDM은 PR8-GFP (MOI = 3) 또는 VSV-GFP (MOI = 5)로 감염시켰다.
도 33은 감염 12 및 24 시간 후 ELISA를 수행하여 IFN-β 및 IL-6 수준을 측정한 것이다. BMDM은 PR8-GFP (MOI = 3) 또는 VSV-GFP (MOI = 5)로 감염시켰다.
도 34는 40 ㎍ Poly(I:C)를 처리한 BMDM 배양 상등액에서 IFN-β 및 IL-6 수준을 측정한 것이다.
도 35는 VSV-GFP로 감염시키고 12 시간 후 EPRS+/+ 및 EPRS+/- 마우스 유래 BMDM에서 IFN-β, IL-6, 및 기타 IFN-관련 항바이러스 유전자의 발현을 확인한 것이다.
도 36은 바이러스 감염 세포에서 IFN-β mRNA 또는 IFN-관련 항바이러스 유전자의 발현이 유도되는지 여부를 확인한 것이다. RAW264.7 세포는 siCon 또는 siEPRS로 36 시간 동안 형질전환시킨 다음, PR8-GFP (MOI = 1)로 12 시간 동안 감염시켰다. 그래프는 표시된 유전자를 gapdh에 대해 표준화시켜 유도 배수로 나타낸 것이다.
도 37은 HSV-GFP로 감염시킨 후 세포 배양 상등액에서 바이러스 역가 (플라크 분석으로 확인)를 나타낸 것이다. EPRS+/+ 및 EPRS+/- 마우스 유래 BMDM은 HSV-GFP (MOI = 2)로 감염시켰다.
도 38은 HSV-GFP로 감염시킨 후 세포 배양 상등액에서 IFN-β 또는 IL-6 분비 수준을 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스 유래 BMDM은 HSV-GFP (MOI = 2)로 감염시켰다.
도 39는 연령 및 성별이 동일한 EPRS+/+ (n = 15) 및 EPRS+/- (n = 14) 마우스에 VSV-인디아나를 정맥투여 (2 x 108 pfu/mouse)한 후, 10 일 동안 생존율을 확인한 것이다.
도 40은 EPRS+/+ 및 EPRS+/- 마우스 (n = 6)를 감염시키고 5 일 후, 뇌와 비장 조직으로 플라크 분석을 수행하여 바이러스 양을 확인한 것이다.
도 41은 VSV 전사체 (n = 5)에 대해 qPCR을 수행하여 바이러스 양을 확인한 것이다.
도 42는 플라크 분석으로 바이러스 양을 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스 (n = 8)를 VSV-GFP로 감염시키고 (2 x 108 pfu/mouse) 12 시간 후 회수한 혈청을 분석에 사용하였다.
도 43은 IFN-β, IFN-α 및 IL-6 수준을 ELISA로 확인한 것이다. EPRS+/+ 및 EPRS+/- 마우스 (n = 8)를 VSV-GFP로 감염시키고 (2 x 108 pfu/mouse) 12 시간 후 회수한 혈청을 분석에 사용하였다.
도 44는 EPRS+/+ 및 EPRS+/- 마우스 (n = 4)를 VSV-인디아나로 감염시키고 5 일 후 뇌 조직 절편을 H&E 염색하여 신경 유조직 (parenchyma)을 확인한 것이다 (i - iii). 뇌 유조직에서 반응성 미세아교 세포 (microglial cell) 및 단핵구 세포에 의해 형성된 교세포 결절 (glial nodule)은 검은색 화살표로 나타내었고, 위관성 침윤은 화살표 머리로 나타내었다. 단핵구 세포의 대량 침투로 측뇌실 (lateral ventricle, LV)에 뇌실막 선이 파괴된 것이 관찰되었다 (빨간색 화살표, iv). Con은 바이러스에 감염되지 않은 표본이다.
도 45는 VSV-인디아나 감염 3 및 5 일 후 항-VSV-G 항체로 뇌 절편 (n = 4)을 염색한 면역조직분석 결과를 나타낸 것이다. 핵은 DAPI로 염색하였다. VSV-양성 GFP 신호는 흰색 화살표로 나타내었다. Con은 바이러스에 감염되지 않은 표본이다.
도 46은 U937 세포를 PR8-GFP로 감염시키거나 (MOI = 3) 또는 IFN-γ로 처리 (500 units/ml)한 뒤, 항-EPRS 항체로 내인성 공동-IP를 수행하고, 항-KRS 및 항-AIMP3 (MSC 구성요소), 및 항-NSAP1 및 항-GAPDH (GAIT 복합체 구성요소) 항체로 면역플로팅을 수행한 결과를 나타낸 것이다.
도 47은 바이러스 감염이 MSC 구성요소 단백질로부터 EPRS의 방출을 유도하는 것을 확인한 것이다. PR8-GFP (MOI = 1)로 감염시킨 RAW264.7 세포의 용해물을 이용하여 항-EPRS 항체로 IP를 수행한 다음, 항-KRS, 항-MRS, 항-AIMP3, 및 항-GAPDH 항체로 면역블랏 분석을 수행하였다.
도 48은 바이러스 감염이 MSC 구성요소 단백질로부터 EPRS의 방출을 유도하는 것을 확인한 것이다. PR8-GFP (MOI = 1)로 감염시킨 RAW264.7 세포의 용해물을 이용하여 항-KRS 항체로 IP를 수행한 다음, 항-EPRS, 및 항-AIMP3 항체로 면역블랏 분석을 수행하였다.
도 49는 내인성 EPRS (빨간색) 및 KRS (녹색)를 컨포컬 현미경으로 확인하여 공동-위치에서 검출되는지 여부를 확인한 것이다. 세포는 PR8 (MOI = 5)로 6 또는 12 시간 감염시키거나, IFN-γ (1000 units/ml)로 12 시간 동안 처리하였다. 스케일바, 10 ㎛.
도 50은 EPRS 및 KRS의 공동-위치 인덱스를 나타낸 것이다.
도 51은 PR8 (MOI = 5)로 6 또는 12 시간 동안 감염시킨 HeLa 세포에서 내인성 EPRS (빨간색) 및 KRS (녹색)의 발현을 컨포컬 현미경으로 확인한 것이다. IFN-γ (1000 units/ml)를 12 시간 처리하여 비교하였다. 스케일바, 10 ㎛ (확대 사진은 2 ㎛).
도 52는 PR8-GFP (MOI = 5)로 감염되거나 또는 감염되지 않은 (-) 293T 세포에서 Strep 침강 분석으로 정제한 Strep-EPRS를 Silver 염색한 것이다. EPRS 단백질은 *로 표시하였다. EV, Strep-태깅 공벡터.
도 53은 비감염 (-, 상단 패널) 및 PR8-감염 (PR8, 하단 패널) 조건에서 수득한 2 가 이온 EPRS 펩티드 EYIPGQPPLSQSSDSpS*PTR (MH+ = 2125.93, z = 2+, 서열번호 65)의 MS/MS 스펙트럼을 나타낸 것이다. 상기 펩티드는 S886 인산화 위치 (*로 표시)를 포함한다. 절편 이온은 질량 분석에 있어서 펩티드 절편화에 대한 명명법에 따라 표시하였다.
도 54는 비감염 (-, 상단 패널) 및 감염 (PR8, 하단 패널) 조건 하에 트립신 분해를 수행하여, 비인산화 (좌측) 및 인산화 (우측) EPRS 유래 2 가 이온 EYIPGQPPLSQSSDSSPTR (MH+ = 2044.96, z = 2+, 서열번호 66) 펩티드에 대한 XIC (Extracted ion chromatogram)를 나타낸 것이다. *는 인산화된 잔기를 나타내고, N.D.는 검출되지 않음을 나타낸다.
도 55는 비감염 (-, 상단 패널) 및 감염 (PR8, 하단 패널) 조건 하에 트립신 분해를 수행하여, 비인산화 EPRS 유래 2 가 이온 NQGGGLSSSGAGEGQGPK (MH+ = 1586.72, z = 2+, 서열번호 67) 펩티드 (좌측) 및 인산화 EPRS 유래 2 가 이온 NQGGGLSS*SGAGEGQGPK (서열번호 68) 펩티드(우측)에 대한 XIC (Extracted ion chromatogram)를 나타낸 것이다. *는 인산화된 잔기를 나타내고, N.D.는 검출되지 않음을 나타낸다.
도 56은 3 가 이온 EPRS 펩티드, KDPSKNQGGGLSSSGAGEGQGPK [MH+ = 2142.02, z = 3+, 서열번호 69; 비감염 조건 (-, 좌측 패널)], 및 KDPpS*KNQGGGLSSSGAGEGQGPK [MH+ = 2222.99, z = 3+, 서열번호 70; PR8-감염 조건 (PR8, 우측패널)]에 대한 MS/MS 스펙트럼을 나타낸 것이다. 후자는 Ser990 인산화 위치를 포함한다 (* 표시).
도 57은 비감염 (-, 상단 패널) 및 감염 (PR8, 하단 패널) 조건 하에 트립신 분해를 수행하여, 비인산화 (좌측) 및 인산화 (우측) EPRS 유래 3 가 이온 KDPSKNQGGGLSSSGAGEGQGPK (MH+ = 2142.02, z = 3+, 서열번호 69) 펩티드에 대한 XIC (Extracted ion chromatogram)를 나타낸 것이다. *는 인산화된 잔기를 나타내고, N.D.는 검출되지 않음을 나타낸다.
도 58은 PR8-GFP에 감염되거나 IFN-γ를 처리한 U937 세포의 EPRS Ser990 인산화를 면역블랏 분석으로 확인한 것이다.
도 59는 PR8-GFP (MOI = 1)로 감염된 RAW264.7 세포에서 EPRS Ser990 인산화를 면역블랏 분석으로 확인한 것이다.
도 60은 PR8-GFP (MOI = 5)로 감염된 293T 세포에서 EPRS Ser990 인산화를 면역블랏 분석으로 확인한 것이다.
도 61은 VSV-GFP (MOI = 0.001)로 감염된 293T 세포에서 EPRS Ser990 인산화를 면역블랏 분석으로 확인한 것이다.
도 62는 Poly(I:C) 2 ㎍으로 형질전환시킨 세포에서 EPRS Ser990 인산화를 면역블랏 분석으로 확인한 것이다.
도 63은 PR8-GFP에 감염되거나 IFN-γ를 처리한 U937 세포에서 EPRS Ser886의 인산화를 면역블랏 분석으로 확인한 것이다.
도 64는 PR8-GFP에 감염되거나 IFN-γ를 처리한 U937 세포에서 EPRS Ser999의 인산화를 면역블랏 분석으로 확인한 것이다.
도 65는 PR8-GFP 또는 VSV-GFP에 감염된 U937 세포에서 IFN-γ 분비 수준을 확인한 것이다. 양성 대조군으로 IFN-γ (1000 units/ml)를 24 시간 처리한 세포를 사용하였다.
도 66은 PR8-GFP 또는 VSV-GFP에 감염된 RAW264.7 세포에서 IFN-γ 분비 수준을 확인한 것이다. 양성 대조군으로 IFN-γ (1000 units/ml)를 24 시간 처리한 세포를 사용하였다.
도 67은 PR8-GFP 감염 RAW264.7 세포에서 Cp 발현을 면역블랏 분석으로 확인한 것이다.
도 68은 Ser990 인산화-모방 EPRS가 MSC로부터 방출되는 것을 확인한 결과이다. 293T 세포는 공벡터 (EV), Strep-EPRS WT, 또는 세 개의 인산화-모방 형태로 형질전환시키고, Strep 침강을 수행한 다음, 항-KRS, 항-AIMP3, 및 항-MRS 항체로 면역블랏 분석을 수행하였다.
도 69는 EPRS-FLAG 플라스미드 (0, 50, 200, 또는 800 ng)와 함께 N-RIG-I, MDA5, poly(I:C) 또는 MAVS로 형질전환시킨 293T 세포에서 IFN-β 프로모터 활성을 확인한 것이다.
도 70은 EPRS-FLAG 플라스미드 (0, 50, 200, 또는 800 ng)와 함께 TRAF3, TBK1, 또는 IRF7로 형질전환시킨 293T 세포에서 IFN-β 프로모터 활성을 확인한 것이다.
도 71은 293T 세포를 Strep-EPRS 플라스미드로 형질전환시킨 뒤 PR8-GFP (MOI = 5)로 6 시간 동안 감염시키고, 24 시간 후 세포로부터 분리한 Strep-EPRS 복합체를 Silver 염색한 것이다. *로 표시된 단백질은 PCBP2 (38 kDa)를 나타낸다. 서열은 질량분석으로 규명된 펩티드를 나타낸다.
도 72는 PR8-감염 RAW264.7 세포를 항-EPRS 항체로 면역침강한 뒤 항-PCBP2 항체로 면역블랏 분석을 수행하여 EPRS 및 PBP2의 상호작용을 확인한 것이다.
도 73은 PR8-감염 U937 세포를 항-EPRS 항체로 면역침강한 뒤 항-PCBP2 항체로 면역블랏 분석을 수행하여 EPRS 및 PBP2의 상호작용을 확인한 것이다.
도 74는 PR8 바이러스 (MOI = 5)에 감염된 HeLa 세포에서 내인성 EPRS (빨간색) 및 PCBP2 (녹색) 발현을 컨포컬 분석으로 확인한 것이다. 스케일바, 10 ㎛.
도 75는 본 발명에서 사용된 EPRS 및 그 단편의 모식도를 나타낸 것이다. PCBP2에 EPRS가 결합하는지 여부 (+ 또는 -)를 표시하였다. GST, GST-유사 도메인; L, 링커; CD, 촉매 도메인; tRNA, tRNA-결합 도메인; W, WHEP 도메인.
도 76은 EPRS 및 그 단편이 PCBP2와 상호작용하는지 확인한 것이다. 293T 세포를 공벡터 (EV), PCBP2 또는 EPRS 플라스미드로 형질전환시켰다.
도 77은 루시퍼라제 리포터 분석으로 IFN-β 프로모터 활성을 확인한 것이다. 293T 세포를 EV 또는 표시된 EPRS 플라스미드와 함께 N-RIG-I, IFN-β 프로모터, 및 TK-Renilla를 포함하는 발현 플라스미드로 형질전환시켰다.
도 78은 EPRS 및 그 단편이 PCBP2와 상호작용하는지 확인한 것이다. 293T 세포를 공벡터 (EV), PCBP2 또는 EPRS 플라스미드로 형질전환시켰다.
도 79는 루시퍼라제 리포터 분석으로 IFN-β 프로모터 활성을 확인한 것이다. 293T 세포를 EV 또는 표시된 EPRS 플라스미드와 함께 N-RIG-I, IFN-β 프로모터, 및 TK-Renilla를 포함하는 발현 플라스미드로 형질전환시켰다.
도 80은 EPRS 및 그 단편이 PCBP2와 상호작용하는지 확인한 것이다. 293T 세포를 공벡터 (EV), PCBP2 또는 EPRS 플라스미드로 형질전환시켰다.
도 81은 루시퍼라제 리포터 분석으로 IFN-β 프로모터 활성을 확인한 것이다. 293T 세포를 EV 또는 표시된 EPRS 플라스미드와 함께 N-RIG-I, IFN-β 프로모터, 및 TK-Renilla를 포함하는 발현 플라스미드로 형질전환시켰다.
도 82는 PCBP2 컨스트럭트를 모식적으로 나타낸 것이다. PCBP2가 EPRS에 결합하는지 여부를 표시하였다.
도 83은 PCBP2 KH1이 EPRS와의 상호작용에 핵심적이라는 것을 확인한 것이다. Strep 침강으로 Strep-EPRS 및 다양한 형태의 GST-PCBP2를 발현하는 293T 세포의 용해물을 침강시키고, 항-GST 항체로 면역블랏을 수행하여 PCBP2와의 상호작용을 확인하였다.
도 84는 EPRS (aa 1-732, aa 1-196 및 aa 1-168) 및 PCBP2 KH1 (aa 11-82) 도메인 간의 직접 결합 여부를 인비트로 침강 분석으로 확인한 것이다. 검은색 화살표는 정제 과정 중 EPRS로부터 유래된 단백질 절편을 나타낸다. 표시된 밴드의 N-말단 서열은 EPRS의 MRFDD (aa 234-238) 및 MVTFI (aa 565-569) 서열인 것으로 확인되었다. 빨간색 화살표 머리는 PCBP2 KH1 도메인을 나타낸다.
도 85는 EPRS 및 PCBP2 사이의 상호작용을 확인한 것이다. 정제된 His-태깅 EPRS (aa 1-196)을 GST-융합 PCBP2 KH1 (aa 11-82)와 혼합하였다. His-태그 침강 후, 단백질을 이용해 SDS-PAGE를 수행한 뒤 Coomassie Brilliant Blue로 염색하였다. FT는 flow-through 분획을 의미한다.
도 86은 EPRS 및 PCBP2 사이의 상호작용을 확인한 것이다. 정제된 His-태깅 EPRS (aa 1-186)을 GST-융합 PCBP2 KH1 (aa 11-82)와 혼합하였다. Hig-태그 침강 후, 단백질을 이용해 SDS-PAGE를 수행한 뒤 Coomassie Brilliant Blue로 염색하였다. FT는 flow-through 분획을 의미한다.
도 87은 PCBP2 KH1 도메인과 MAVS의 상호작용을 확인한 것이다. MAVS 및 다양한 PCBP2 플라스미드로 혈질전환시킨 293T 세포의 용해물을 항-FLAG 항체로 공동-IP하고 항-GST 항체로 면역블랏 분석을 수행하여 PCBP2와의 상호작용을 확인하였다.
도 88은 PCBP2 KH1 도메인과 MAVS의 상호작용을 확인한 인비트로 침강 분석을 나타낸 것이다. 화살표 머리는 MAVS 단백질을 나타낸다.
도 89는 MAVS와 PCBP2 사이의 상호작용을 나타낸 것이다. 정제된 GST-융합 MAVS (aa 460-540)을 His-태깅 PCBP2 KH1 (aa 11-82)와 혼합하였다. 단백질 혼합물을 Ni-NTA 아가로스 비드에 로딩하고 이미다졸 용출 완충액으로 용출시켰다. FT는 flow-through 분획을 의미한다.
도 90은 MAVS와 PCBP2 사이의 상호작용을 나타낸 것이다. 정제된 GST-융합 MAVS (aa 460-540)을 His-태깅 PCBP2 링커 (aa 168-279)와 혼합하였다. 단백질 혼합물을 Ni-NTA 아가로스 비드에 로딩하고 이미다졸 용출 완충액으로 용출시켰다. FT는 flow-through 분획을 의미한다.
도 91은 항-FLAG 또는 항-Strep 항체로 각각 MAVS (첫 번째 패널) 또는 EPRS (두 번째 패널)와 PCBP2와의 상호작용을 GST 침강 및 면역블랏 분석을 통해 확인한 것이다. 293T 세포는 MAVS 및 PCBP2로 형질전환시키고, EPRS의 양을 다양하게 처리하였다.
도 92는 PCBP2와 ITCH (첫 번째 패널) 또는 EPRS (두 번째 패널) 사이의 상호작용을 평가하기 위해 GST 침강 분석을 수행한 것이다.
도 93은 PCBP2와 EPRS 또는 MAVS 사이의 내인성 상호작용을 확인한 것이다. 항-PCBP2 항체로 PR8-감염 RAW264.7 세포의 용해물로부터 내인성 PCBP2를 면역침강시키고, 항-EPRS (첫 번째 패널) 또는 항-MAVS (두 번째 패널) 항체로 면역블랏을 수행하였다.
도 94는 EPRS, PCBP2, ITCH, 및 Ub를 다양한 조합으로 발현하는 293T 세포를 MG-132로 처리한 후, 그 용해물로부터 면역침강시킨 외인성 MAVS를 항-K48 Ub 항체로 면역블랏 분석을 수행한 것이다.
도 95는 EPRS, PCBP2, ITCH, 및 Ub를 다양한 조합으로 발현하는 293T 세포를 MG-132로 처리한 후, 그 용해물로부터 면역침강시킨 내인성 MAVS를 항-K48 Ub 항체로 면역블랏 분석을 수행한 것이다.
도 96은 PCBP2로 형질전환시킨 293T 세포에 다양한 농도의 EPRS를 처리한 뒤, 외인성 MAVS의 발현을 확인한 것이다. 그래프는 액틴에 대해 표준화 한 MAVS 밴드 강도를 나타낸다.
도 97은 PCBP2로 형질전환시킨 293T 세포에 다양한 농도의 EPRS를 처리한 뒤, 내인성 MAVS의 발현을 확인한 것이다. 그래프는 액틴에 대해 표준화 한 MAVS 밴드 강도를 나타낸다.
도 98은 항-Ub 항체로 면역블랏을 수행하여 MAVS 유비퀴틴화를 확인한 인비트로 분석을 나타낸 것이다. 정제된 MAVS 단백질을 유비퀴틴, E1, E2 및 정제된 EPRS, PCBP2, 및 ITCH 단백질의 조합과 함께 인큐베이션하였다.
도 99는 세포 투과성 Tat와 융합한 EPRS L1 (aa 168-196) 도메인이 MAVS 유비퀴틴화를 억제하는 것을 확인한 것이다. 293T 세포를 PCBP2, ITCH, 또는 Ub 플라스미드로 293T 세포를 형질전환시키고 다양한 농도의 Tat-Epep (20, 50, 및 100 μM)를 처리한 다음, 항-MAVS 항체를 이용하여 내인성 MAVS를 침강시켰다. 침강물은 항-K48 Ub로 면역블랏하였다. EPRS 아미노산 168-196 및 Tat을 융합하여 합성한 펩티드 (Tat-Epep) 서열을 표시하였다.
도 100은 PCBP2로 형질전환시킨 293T 세포에 다양한 농도의 Tat-Epep (20, 50, 및 100 μM)를 처리하고 내인성 MAVS의 수준을 확인한 것이다. 그래프는 액틴에 대해 표준화시킨 MAVS 단백질 밴드의 강도를 나타낸다.
도 101은 VSV-감염 RAW264.7 세포에서 Tat-Epep가 IFN-β 및 IL-6 분비를 농도 의존적 방식으로 촉진시키는 것을 확인한 것이다. Con, 음성 대조군으로 PBS를 처리한 VSV-감염 RAW264.7 세포.
도 102는 VSV-GFP-감염 RAW264.7 세포를 100 μM Tat 또는 Tat-Epe로 처리한 대표적인 형광 사진을 나타낸 것이다.
도 103은 VSV 감염 RAW264.7 세포에서 Tat-Epep가 VSV 역가를 용량 의존적으로 감소시키는 것을 확인한 것이다. Con, 음성 대조군으로 PBS를 처리한 VSV-감염 RAW264.7 세포.
도 104는 HSV-GFP (MOI = 1)로 12 시간 동안 감염된 RAW264.7 세포에서 Tat-Epep가 바이러스 복제에 유의적인 효과가 없음을 확인한 것이다. Con은 음성 대조군으로 PBS를 처리한 HSV-GFP-감염 RAW264.7 세포이다.
도 105는 HSV-GFP (MOI = 1)로 12 시간 동안 감염된 RAW264.7 세포에서 Tat-Epep가 IFN-β 분비에 유의적인 효과가 없음을 확인한 것이다. Con은 음성 대조군으로 PBS를 처리한 HSV-GFP-감염 RAW264.7 세포이다.
도 106은 HSV-GFP (MOI = 1)로 12 시간 동안 감염된 RAW264.7 세포에서 Tat-Epep가 IL-6 분비에 유의적인 효과가 없음을 확인한 것이다. Con은 음성 대조군으로 PBS를 처리한 HSV-GFP-감염 RAW264.7 세포이다.
도 107은 다양한 농도의 Tat-Epep를 12 시간 동안 처리한 후 MTS 분석으로 RAW264.7 세포의 생존성을 측정한 것이다. Con은 양성 대조군으로, 용해성 계면활성제 (digitonin, 30 ㎍/ml)를 293T 세포에 처리한 것이다.
도 108은 Tat-Epep를 12 또는 24 시간 동안 처리한 후 293T 세포의 생존성을 확인한 것이다. Con은 양성 대조군으로, 용해성 계면활성제 (digitonin, 30 ㎍/ml)를 293T 세포에 처리한 것이다.
도 109는 VSV-인디아나 (2 x 108 pfu/mouse)를 정맥투여하고 4 일째부터 Tat-tag (1.05 μM/kg) 또는 Tat-Epep (0.53 μM/kg 또는 1.05 μM/kg)를 3 일 동안 매일 복강주사한 마우스 뇌 조직 (n = 7)에서 바이러스 양을 플라크 분석으로 확인한 결과이다.
도 110은 New Tat-Epep의 VSV 바이러스 양 감소 효과를 확인한 것이다.
도 111은 VSV-GFP-감염 RAW264.7 세포에 Tat-Epep을 처리시 바이러스 증식이 감소됨을 보이고, New Tat-Epep은 바이러스 증식 억제 능력이 더 강하다는 것을 형광 사진으로 나타낸 것이다.
도 112는 Tat-Epep 또는 New Tat-Epep 처리에 따른 IFN-β 분비를 확인한 것이다.
도 113은 Tat-Epep 또는 New Tat-Epep 처리에 따른 IL-6 분비를 확인한 것이다.
본 발명자들은 MSC (Multi-tRNA synthetase complex)의 구성요소인 EPRS (glutamyl-prolyl-tRNA synthetase) 단백질, 또는 이의 단편이 항RNA 바이러스 활성을 가지는 것을 확인하였다. 구체적으로, 본 발명의 EPRS 단백질 또는 이의 단편은 범용적인 항RNA 바이러스 활성에서 중요한 역할을 하는 MAVS를 분해하는 PCBP2에 MAVS와 경쟁적으로 결합함으로써 MAVS의 분해를 억제하는바, 상기 단백질 또는 그 단편을 포함하는 조성물을 이용하여 RNA 바이러스 감염 질환을 범용적 및 효과적으로 치료할 수 있다.
이를 구체적으로 설명하면 다음과 같다. 한편, 본 발명에서 개시된 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본 발명에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술된 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 볼 수 없다.
상기 목적을 달성하기 위한 본 발명의 하나의 양태는 EPRS (glutamyl-prolyl-tRNA synthetase) 단백질 또는 이의 단편을 포함하는 항RNA 바이러스용 조성물이다. 구체적으로 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것일 수 있고, 더 구체적으로는 서열번호 63의 1 내지 196 번째 아미노산 서열, 1 내지 269 번째 아미노산 서열, 1 내지 457 번째 아미노산 서열, 1 내지 506 번째 아미노산 서열, 1 내지 682 번째 아미노산 서열, 168 내지 506 번째 아미노산 서열, 168 내지 269 번째 아미노산 서열 및 168 내지 196 번째 아미노산 서열로 이루어진 군에서 선택된 아미노산 서열을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
또한, 상기 EPRS의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열과 적어도 80 % 이상, 90 % 이상, 95 % 이상, 97 % 이상, 또는 99 % 이상 상동성을 가지는 폴리펩티드를 포함할 수 있다. 예를 들어, 이러한 상동성을 가지며, 상기 서열번호 63의 168 내지 186 번째 아미노산 서열로 이루어진 단백질과 상응하는 효능을 나타내는 아미노산 서열이라면, 일부 서열이 결실, 변형, 치환 또는 부가된 아미노산 서열을 가지더라도 본 발명의 범위 내에 포함됨은 자명하다.
또한, 서열번호 63의 168 내지 186 번째의 아미노산 서열로 이루어진 폴리펩티드와 상응하는 활성을 가지는 경우라면 아미노산 서열 앞뒤의 무의미한 서열 추가 또는 자연적으로 발생할 수 있는 돌연변이, 혹은 이의 잠재성 돌연변이 (silent mutation)를 제외하는 것이 아니다.
본 발명에서 용어, "상동성"은 주어진 아미노산 서열 또는 염기 서열과 일치하는 정도를 의미하며 백분율로 표시될 수 있다. 본 명세서에서, 주어진 아미노산 서열 또는 염기 서열과 동일하거나 유사한 활성을 가지는 그의 상동성 서열이 "% 상동성"으로 표시된다. 예를 들면, 점수(score), 동일성(identity) 및 유사도(similarity) 등의 매개 변수(parameter)들을 계산하는 표준 소프트웨어, 구체적으로 BLAST 2.0을 이용하거나, 정의된 엄격한 조건하에서 써던 혼성화 실험에 의해 서열을 비교함으로써 확인할 수 있으며, 정의되는 적절한 혼성화 조건은 해당 기술 범위 내이고, 당업자에게 잘 알려진 방법(예컨대, J. Sambrook et al., Molecular Cloning, A Laboratory Manual, 2nd Edition, Cold Spring Harbor Laboratory press, Cold Spring Harbor, New York, 1989; F.M. Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York)으로 결정될 수 있다.
본 발명에서, 용어 “RNA 바이러스”는 RNA를 유전물질로 사용하는 모든 바이러스를 의미한다. 예를 들어, 상기 RNA 바이러스는 아말가비리대 (Amalgaviridae), 비르나비리대 (Birnaviridae), 크리소비리대 (Chrysoviridae), 시스토비리대 (Cystoviridae), 엔도르나비리대 (Endornaviridae), 하이포비리대 (Hypoviridae), 메가비르나비리대 (Megabirnaviridae), 파르티티비리대 (Partitiviridae), 피코비르나비리대 (Picobirnaviridae), 레오비리대 (Reoviridae), 토티비리대 (Totiviridae), 콰드리비리대 (Quadriviridae), 아르테리비리대 (Arteriviridae), 코로나비리대 (Coronaviridae), 메소니비리대 (Mesoniviridae), 로니비리대 (Roniviridae), 디시스트로비리대 (Dicistroviridae), 이플라비리대 (Iflaviridae), 마르나비리대 (Marnaviridae), 피코르나비리대 (Picornaviridae), 세코비리대 (Secoviridae), 알파플렉시비리대 (Alphaflexiviridae), 베타플렉시비리대 (Betaflexiviridae), 감마플렉시비리대 (Gammaflexiviridae), 티모비리대 (Tymoviridae), 보르나비리대 (Bornaviridae), 필로비리대 (Filoviridae), 파라믹소비리대 (Paramyxoviridae), 랍도비리대 (Rhabdoviridae), 니아미비리대 (Nyamiviridae), 칼리시비리대 (Caliciviridae), 플라비비리대 (Flaviviridae), 루테오비리대 (Luteoviridae), 토가비리대 (Togaviridae), 뉴모바라대 (Pneumoviridae), 아레나비리대 (Arenaviridae), 델타비리대 (Deltavirus), 또는 오르토믹스비리대 (Orthomyxoviridae) 바이러스일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 EPRS 단백질 또는 이의 단편은 PCBP2에 결합하여 PCBP2와 MAVS 사이의 결합을 막음으로써 MAVS의 분해를 억제하는 효과를 가진다. 따라서, 분해되지 않은 MAVS는 그 신호전달 경로가 활성화되어 바이러스 감염에 대한 선천성 면역반응을 활성화시킬 수 있다.
본 발명에서 용어, “EPRS (glutamyl-prolyl-tRNA synthetase) 단백질”은 ARS (aminoacyl-tRNA synthetase) 중 하나로, MSC (multi-tRNA synthetase complex)라 불리는 세포질 저장 시스템의 일 구성요소로 단백질 합성에 관여하는 것으로 알려져 있다. 그러나, EPRS의 항바이러스 활성에 대해서는 전혀 보고된바 없다.
EPRS 단백질 또는 이를 코딩하는 유전자 정보는 NCBI (National Center for Biotechnology Information)의 GenBank와 같은 공지의 데이터 베이스에서 얻을 수 있고, 예를 들어 서열번호 63의 아미노산 서열을 가지는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 용어, “MAVS (Mitochondrial antiviral-signaling protein)”는 RIG-I와 MDA5가 RNA 바이러스를 인식한 후 활성화되면서 다양한 종류의 항바이러스성 사이토카인을 만드는 중요 신호전달 단백질을 말한다. MAVS가 없는 경우 RNA 바이러스 감염에 매우 취약해지는 것으로 알려져 있다. 따라서, 본 발명의 EPRS 단백질 또는 이의 단편은 MAVS의 분해를 막아 이의 신호전달을 활성화 시킬 수 있으므로, EPRS 단백질 또는 이의 단편을 포함하는 조성물은 모든 RNA 바이러스에 대하여 항바이러스 활성을 유도할 수 있다.
본 발명의 구체적인 일 실시예에서는, EPRS 넉다운 세포에서 PR8 및 VSV 감염에 의한 바이러스 복제가 증가하고 (도 5 및 도 6), 바이러스 감염 또는 바이러스 유전자 형태를 모방한 poly(I:C) 처리에 대해 항바이러스성 사이토카인 생산이 감소하는 것을 확인하였다 (도 8 및 도 9). 반면에 EPRS를 과발현시킨 세포에서 PR8 및 VSV 감염에 의한 바이러스 복제가 현저하게 감소하고, IFN-β 및 IL-6 생산이 증가하는 것을 확인하였다 (도 22 내지 도 27). 또한 EPRS+/- 마우스에서는 바이러스 감염 시 EPRS+/+ 마우스에 비해 바이러스 역가가 높고, 혈청에 IFN-β, IFN-α 및 IL-6 수준이 낮은 것을 확인하여 (도 40 내지 도 43), EPRS가 RNA 바이러스에 대한 선천성 면역 반응을 양성조절할 수 있음을 확인하였다.
본 발명의 다른 구체적인 일 실시예에서는, 다양한 크기의 EPRS 단편을 이용하여, 면역반응 조절에 관여하는 EPRS 영역을 확인하였으며, 이를 통해 EPRS L1 영역 (서열번호 63의 168 내지 196 번째 아미노산), 더 구체적으로는 서열번호 63의 168 내지 186 번째 아미노산 서열이 EPRS의 항바이러스 활성에 필수적임을 확인하였다 (도 75 내지 도 81). 결론적으로, EPRS 단백질, 또는 상기 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 EPRS 단백질의 단편은 항RNA-바이러스 활성을 가지므로 항RNA-바이러스용 조성물로 유용하게 사용될 수 있음을 알 수 있었다.
상기 EPRS 단백질 또는 이의 단편은 세포 투과성을 높이기 위하여 추가적으로 세포 투과성 펩타이드 (cell-penetrating peptide)와 융합한 형태로 이용될 수 있다. 즉, 상기 EPRS 단백질 또는 이의 단편은, N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함할 수 있다. 이 때, EPRS 단백질 또는 이의 단편, 및 세포 투과성 펩타이드 사이에 링커를 추가적으로 포함할 수 있으며, 이는 당업자에 의해 적절히 수행될 수 있다.
본 발명에서, 용어 “세포 투과성 펩타이드”는 나노입자, 화합물, DNA, 단백질 등 다양한 물질들의 세포 내 섭취/흡수를 촉진시킬 수 있는 짧은 펩타이드를 말한다. 구체적으로, 상기 세포 투과성 펩타이드는 Tat, 안테나페디아 (Antennapedia), 트랜스포탄 (Transportan), VP22, Hph-1, R11(R9), 시그널 서열 기반 펩타이드, 또는 양친매성 (Amphipathic) 펩타이드일 수 있으나, 이에 제한되는 것은 아니며 본 발명의 EPRS 단백질 또는 이의 단편의 세포 내 이동을 촉진시킬 수 있는 세포 투과성 펩타이드라면 당업자에 의해 적절하게 선택될 수 있다. 나아가, 당업자는 사용되는 세포 투과성 펩타이드의 종류에 따라서 이를 적용하기 위해 본 발명의 EPRS 단백질 또는 이의 단편을 적절하게 변형하여 사용할 수 있다. 즉, 본 발명의 EPRS 단백질 또는 이의 단편은 본 발명에서 제시하는 아미노산 서열에만 한정되는 것은 아니며, 당업자에게 자명한 범위 내에서 세포 투과성 펩타이드의 적용에 적절한 형태로 아미노산 서열을 부가/치환/제거하여 사용할 수 있다.
본 발명의 구체적인 일 실시예에서는 HIV-1 Tat 단백질 변환 도메인 (transduction domain, 서열번호 60)과 EPRS L1 펩타이드 (서열번호 63의 168 내지 196)를 융합한 융합 펩타이드 (Tat-Epep: 서열번호 61)의 항바이러스 활성을 조사한 결과 (도 99 내지 도 109), 시험관 내 및 생체 내에서 상기 Tat-Epep가 MAVS 생존성 및 I 형 IFN 생산을 증가시키고, 바이러스에 감염된 마우스 뇌 조직에서 바이러스 역가를 현저히 감소시키는, 우수한 항RNA 바이러스 활성을 가지는 것을 확인하였다.
본 발명의 다른 구체적인 일 실시예에서는 HIV-1 Tat 단백질 변환 도메인 (transduction domain, 서열번호 60)과 EPRS L1 펩타이드 단편 (서열번호 63의 168 내지 186)을 융합한 융합 펩타이드 (New Tat-Epep: 서열번호 64)가 상기 Tat-Epep 보다 더 현저하게 바이러스에 감염된 마우스 뇌에서 바이러스 역가를 감소시키고, 항바이러스 사이토카인인 IFN-β 및 IL-6의 분비를 촉진시키는 것을 확인하였다 (도 110 내지 도 113).
또한, 본 발명의 EPRS 단백질 또는 이의 단편은 세포 투과성을 높이기 위해, 세포에 단백질을 전달시키거나 전달 효율을 증진시킬 수 있는 당업계에 공지된 시약과 함께 사용될 수 있다. 상기 시약은 예컨대, Chariot (Active motif, Cat. 30025) 등을 사용할 수 있으나, 본 발명의 EPRS 단백질 또는 이의 단편을 세포에 전달시킬 수 있는 한 상기 예에 특별히 제한되는 것은 아니다.
본 발명의 항RNA 바이러스용 조성물은 약학 조성물, 의약외품 조성물, 식품 조성물, 화장료 조성물 또는 사료 조성물로 이용될 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 다른 하나의 양태는, 항RNA 바이러스 활성을 가지는 EPRS 단백질 또는 이의 단편으로서, 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것인, 단백질 또는 이의 단편이다.
본 발명의 또 다른 하나의 양태는, 상기 단백질 또는 이의 단편을 코딩하는 폴리뉴클레오티드이다.
본 발명의 또 다른 하나의 양태는, 상기 폴리뉴클레오티드를 포함하는 벡터이다.
본 발명의 또 다른 하나의 양태는 상기 폴리뉴클레오티드 또는 상기 벡터를 포함하는, 형질전환체이다.
항RNA 바이러스 활성을 가지는 EPRS 단백질 또는 이의 단편은 상기 설명한 바와 같다.
상기 폴리뉴클레오티드는 본 발명의 EPRS 단백질 또는 이의 단편을 코딩하는 뉴클레오티드 서열, 또는 이와 적어도 80 % 이상, 90 % 이상, 95 % 이상, 97 % 이상, 또는 99 % 이상 상동성을 가지는 뉴클레오티드 서열을 가지는 것일 수 있으며, 이로부터 번역된 폴리펩티드 (즉, 단백질 혹은 이의 단편)가 본 발명의 EPRS 단백질 또는 이의 단편과 상응하는 효능을 나타내는 것이라면, 뉴클레오티드 서열의 5'- 및/또는 3'- 말단에 무의미한 서열의 부가, 혹은 일부 서열의 결실, 변형, 치환된 경우 모두 본 발명의 범위에 포함될 수 있다. 상기 폴리뉴클레오티드는 공지된 프로모터 서열과 작동 가능하게 연결된 발현 카세트, 또는 상기 폴리뉴클레오티드를 포함하는 벡터의 형태로 사용될 수 있으며, 폴리뉴클레오티드, 발현 카세트 또는 벡터의 제조는 당업자가 공지된 방법을 통해 적절히 수행할 수 있다. 프로모터 및 벡터의 종류는 특별히 제한되지 않고 목적에 따라 당업자가 적절히 선택할 수 있다. 또한, 상기 폴리뉴클레오티드, 발현 카세트 또는 벡터를 숙주 세포에 형질전환시켜 형질전환체를 제조하여 사용할 수 있으며, 이 때의 형질전환 방법 역시 당업자가 공지된 방법을 제한 없이 사용할 수 있다. 상기 형질전환체는 본 발명의 EPRS 단백질 또는 이의 단편을 발현시키고자 하는 대상체로서, 미생물, 식물 또는 동물일 수 있고, 인간을 제외한 것일 수 있으나, 이에 제한되는 것은 아니다.
당업자는 다양한 목적으로 상기 EPRS 단백질 또는 이의 단편을 적용/생산하기 위하여 이를 코딩하는 폴리뉴클레오티드를 포함하는 벡터, 혹은 상기 벡터를 포함하는 형질전환체를 제조하여 사용할 수 있다. 예컨대, 상기 폴리뉴클레오티드 혹은 상기 벡터를 이용하여 직접적으로 RNA-바이러스 감염 질환에 대한 치료 용도로 사용할 수 있고, 이를 포함하여 EPRS 단백질 혹은 이의 단편을 발현하는 형질전환체를 이용하여 상기 단백질 또는 이의 단편을 생산하거나 치료 목적으로 사용할 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 양태는, 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 치료용 약학 조성물이다.
항RNA 바이러스용 조성물에 대해서는 상기 설명한 바와 같다.
본 발명에서 용어, “RNA 바이러스 감염 질환”은 RNA 바이러스의 감염에 의해 숙주에서 발생할 수 있는 모든 질환을 의미하는 것으로, 본 발명의 EPRS 단백질 또는 이의 단편을 이용하여 상기 질환에 대한 예방 및/또는 치료 효과를 기대할 수 있다. 예를 들어, RNA 바이러스 감염 질환은 인플루엔자 (influenza), 급성회백수염 (poliomyelitis anterior acuta), 무균성 뇌수막염 (aseptic meningitis), 수족구병 (hand-foot-mouth disease), 헤르페스 목구멍염 (herpangina), 급성 출혈성 결막염 (acute hemorrhagic conjunctivitis), 유행성 가슴막통증 (epidemic pleurodynia), 심장막염 (pericarditis), 심근염 (myocarditis), 유아백색설사증, 풍진 (rubella), 선천성 풍진증후군 (Congenital rubella syndrome), 황열병 (yellow fever), 뎅기열 (Dengue fever), 뎅기출혈열 (Dengue hemorrhagic fever), 일본뇌염 (Japanese encephalitis), 단순 헤르페스뇌염 (Herpes simplex encephalitis), 유행성 귀밑샘염 (epidemic parotitis), 홍역 (measles), 광견병 (rabies), 마르부르크병 (Marburg disease), 에볼라출혈열 (Ebola hemorrhagic fever), 출혈열콩팥증후군 (Hemorrhagic fever with renal syndrome), 한타바이러스 폐증후군 (HPS), 콩고-크리미아 출혈열 (Congo-Crimean hemorrhagic fever), AIDS (Acquired immunodeficiency disease), 성인 T세포 백혈병 (Adult T-cell leukemia), HTLV-1 관련 척수증 (HTLV-1 associated myelopathy), HTLV-1 포도막염 (HTLV-1 uveitis) 및 라사열 (Lassa fever)로 이루어진 군에서 선택된 하나 이상일 수 있으나, 이에 제한되는 것은 아니며 RNA 바이러스에 의해 야기될 수 있는 질환 및 증상은 모두 본 발명의 범위에 포함된다.
본 발명에서 용어, “예방”은 본 발명에 따른 조성물의 투여로 상기 RNA 바이러스 감염 질환의 발명을 억제 또는 지연시키는 모든 행위를 말하며, “치료”는 본 발명에 따른 조성물의 투여로 상기 RNA 바이러스 감염 질환의 증세가 호전되거나 이롭게 변경되는 모든 행위를 말한다.
상기 RNA 바이러스 감염 질환의 예방 또는 치료는 본 발명의 EPRS 단백질 또는 이의 단편이 PCBP2 단백질에 결합함으로써 달성되는 것일 수 있고, 더 나아가 MAVS의 신호전달이 활성화됨에 의한 것일 수 있다. 따라서, 본 발명의 EPRS 단백질 또는 이의 단편을 포함하는 조성물은 상술한 바와 같이 항RNA 바이러스 활성을 가지므로, RNA 감염성 질환의 예방 또는 치료용 조성물로 유용하게 이용될 수 있다.
본 발명의 약학 조성물은 약학 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 또는 희석제를 추가로 포함할 수 있다. 약학적으로 허용 가능한 담체를 포함하는 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있고, 구체적으로 비경구 제형일 수 있으나, 이에 제한되는 것은 아니다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제될 수 있다. 경구 투여를 위한 고형제제에는 정제환제, 산제, 과립제, 캡슐제 등이 포함될 수 있으며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제, 예를 들면, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제될 수 있다. 또한, 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용될 수 있다. 경구 투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함될 수 있다. 비수성용제, 현탁용제로는 프로필렌글리콜 (propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
또한, 본 발명의 약학 조성물은 이에 제한되지는 않으나, 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
상기 본 발명의 약학 조성물은 약학적으로 유효한 양으로 투여한다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 대상에게 본 발명의 약학 조성물을 도입하는 것을 말하며, 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있고, 구체적으로 비경구로 투여될 수 있으나, 이에 제한되는 것은 아니다.
상기 약학 조성물은 목적 또는 필요에 따라 당업계에서 사용되는 통상적인 방법, 투여 경로, 투여량에 따라 적절하게 개체에 투여될 수 있다. 투여 경로의 예로는 경구, 비경구, 피하, 복강 내, 폐 내, 및 비강 내로 투여될 수 있으며, 비경구 주입에는 근육 내, 정맥 내, 동맥 내, 복강 내 또는 피하투여가 포함된다. 또한 당업계에 공지된 방법에 따라 적절한 투여량 및 투여 횟수가 선택될 수 있으며, 실제로 투여되는 본 발명의 약학 조성물의 양 및 투여 횟수는 치료하고자 하는 증상의 종류, 투여 경로, 성별, 건강 상태, 식이, 개체의 연령 및 체중, 및 질환의 중증도와 같은 다양한 인자에 의해 적절하게 결정될 수 있다.
본 발명에서의 용어 "약학적으로 유효한 양"은 의학적 용도에 적용 가능한 합리적인 수혜/위험 비율로 혈관 투과성 증가를 억제 또는 완화하기에 충분한 양을 의미하며, 유효 용량 수준은 개체 종류 및 중증도, 연령, 성별, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 그리고 단일 또는 다중 투여될 수 있다. 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 개체에 투여하는 단계를 포함하는, RNA 바이러스 감염 질환의 예방 또는 치료 방법이다.
항RNA 바이러스용 조성물 및 RNA 바이러스 감염 질환의 예방 또는 치료는 상기 설명한 바와 같다.
본 발명에서 용어, "개체"는 본 발명의 RNA 바이러스 감염 질환을 발병하였거나 발병할 수 있는, 인간을 포함한 모든 동물을 의미한다. 또한, 인간을 제외한 동물을 의미하는 것일 수 있으나, 이에 제한되는 것은 아니다. 본 발명의 항RNA 바이러스용 조성물을 개체에 투여함으로써, RNA 바이러스 감염 질환을 예방 또는 치료할 수 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 의약외품 조성물을 제공한다.
항RNA 바이러스용 조성물, RNA 바이러스 감염 질환 및 예방에 대해서는 상기 설명한 바와 같다.
본 발명의 용어 "개선"은 본 발명의 조성물의 투여로 RNA 바이러스 감염 질환이 호전 또는 이롭게 변경되는 모든 행위를 의미한다.
본 발명의 용어 "의약외품"은 사람이나 동물의 질병을 치료, 경감, 처치 또는 예방할 목적으로 사용되는 섬유, 고무제품 또는 이와 유사한 것, 인체에 대한 작용이 약하거나 인체에 직접 작용하지 아니며, 기구 또는 기계가 아닌 것과 이와 유사한 것, 감염 예방을 위하여 살균, 살충 및 이와 유사한 용도로 사용되는 제제 중 하나에 해당하는 물품으로서, 사람이나 동물의 질병을 진단, 치료, 경감, 처치 또는 예방할 목적으로 사용하는 물품 중 기구, 기계 또는 장치가 아닌 것 및 사람이나 동물의 구조와 기능에 약리학적 영향을 줄 목적으로 사용하는 물품 중 기구, 기계 또는 장치가 아닌 것을 제외한 물품을 의미하며, 구체적으로 피부 외용제 또는 개인위생용품일 수 있으나, 이에 제한되지 않는다.
본 발명의 항RNA 바이러스용 조성물을 RNA 바이러스 감염 질환의 예방 또는 개선을 목적으로 의약외품 조성물에 첨가할 경우, 상기 항RNA 바이러스용 조성물을 그대로 첨가하거나 다른 의약외품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효 성분의 혼합량은 사용 목적에 따라 적합하게 결정할 수 있다.
상기 피부 외용제는 특별히 이에 제한되지 않으나, 예를 들어 연고제, 로션제, 스프레이제, 패취제, 크림제, 산제, 현탁제, 겔제 또는 젤의 형태로 제조되어 사용될 수 있다. 상기 개인위생용품에는 특별히 이에 제한되지 않으나, 구체적으로는 비누, 화장품, 물티슈, 휴지, 샴푸, 피부 크림, 얼굴 크림, 치약, 립스틱, 선스크린 로션, 또는 세정 겔일 수 있다. 또한, 본 발명의 의약외품 조성물의 또 다른 예로 소독청결제, 샤워폼, 물티슈, 세제비누, 핸드워시, 또는 연고제가 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 식품 조성물을 제공한다.
항RNA 바이러스용 조성물, RNA 바이러스 감염 질환, 예방 및 개선에 대해서는 상기 설명한 바와 같다.
본 발명의 용어, "식품"은 육류, 소시지, 빵, 초콜릿, 캔디류, 스낵류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종 스프, 음료수, 차, 드링크제, 알코올음료, 비타민 복합제, 건강기능식품 및 건강식품 등이 있으며, 통상적인 의미에서의 식품을 모두 포함한다.
상기 건강기능(성)식품(health functional food)은 특정보건용 식품(food for special health use, FoSHU)과 동일한 용어로, 영양 공급 외에도 생체조절기능이 효율적으로 나타나도록 가공된 의학, 의료효과가 높은 식품을 의미한다. 여기서 '기능(성)'은 인체의 구조 및 기능에 대하여 영양소를 조절하거나 생리학적 작용 등과 같은 보건용도에 유용한 효과를 얻는 것을 의미한다. 상기 건강식품(health food)은 일반식품에 비해 적극적인 건강유지나 증진 효과를 가지는 식품을 의미하고, 건강보조식품(health supplement food)은 건강보조 목적의 식품을 의미한다. 경우에 따라, 건강기능식품, 건강식품, 건강보조식품의 용어는 호용될 수 있다.
구체적으로, 상기 건강기능식품은 본 발명의 항RNA 바이러스용 조성물을 음료, 차류, 향신료, 껌, 과자류 등의 식품 소재에 첨가하거나, 캡슐화, 분말화, 현탁액 등으로 제조한 식품으로, 이를 섭취할 경우 건강상 특정한 효과를 가져오는 것을 의미하나, 일반 약품과는 달리 식품을 원료로 하여 약품의 장기 복용 시 발생할 수 있는 부작용이 없는 장점이 있다.
본 발명의 식품은 당 업계에서 통상적으로 사용되는 방법에 의하여 제조 가능하며, 당업계에서 통상적으로 첨가하는 원료 및 성분을 첨가하여 제조할 수 있다. 또한, 상기 식품 조성물은 식품으로 인정되는 제형이면 다양한 형태의 제형으로 제한 없이 제조될 수 있다.
또한, 상기 식품 조성물은 생리학적으로 허용 가능한 담체를 추가로 포함할 수 있는데, 담체의 종류는 특별히 제한되지 않으며 당해 기술 분야에서 통상적으로 사용되는 담체라면 어느 것이든 사용할 수 있다.
또한, 상기 식품 조성물은 식품 조성물에 통상 사용되어 냄새, 맛, 시각 등을 향상시킬 수 있는 추가 성분을 포함할 수 있다. 예들 들어, 비타민 A, C, D, E, B1, B2, B6, B12, 니아신(niacin), 비오틴(biotin), 폴레이트(folate), 판토텐산(panthotenic acid) 등을 포함할 수 있다. 또한, 아연(Zn), 철(Fe), 칼슘(Ca), 크롬(Cr), 마그네슘(Mg), 망간(Mn), 구리(Cu), 크륨(Cr) 등의 미네랄; 및 라이신, 트립토판, 시스테인, 발린 등의 아미노산을 포함할 수 있다.
또한, 상기 식품 조성물은 방부제(소르빈산 칼륨, 벤조산나트륨, 살리실산, 데히드로초산나트륨 등), 살균제(표백분과 고도 표백분, 차아염소산나트륨 등), 산화방지제(부틸히드록시아니졸(BHA), 부틸히드록시톨류엔(BHT) 등), 착색제(타르색소 등), 발색제(아질산 나트륨, 아초산 나트륨 등), 표백제(아황산나트륨), 조미료(MSG 글루타민산나트륨 등), 감미료(둘신, 사이클레메이트, 사카린, 나트륨 등), 향료(바닐린, 락톤류 등), 팽창제(명반, D-주석산수소칼륨 등), 강화제, 유화제, 증점제(호료), 피막제, 검기초제, 거품억제제, 용제, 개량제 등의 식품 첨가물(food additives)을 포함할 수 있다. 상기 첨가물은 식품의 종류에 따라 선별하고 적절한 양으로 사용할 수 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 화장료 조성물을 제공한다.
항RNA 바이러스용 조성물, RNA 바이러스 감염 질환, 예방 및 개선에 대해서는 상기 설명한 바와 같다.
상기 화장료 조성물의 제형은 용액, 외용 연고, 크림, 폼, 영양 화장수, 유연 화장수, 향수, 팩, 유연수, 유액, 메이크업 베이스, 에센스, 비누, 액체 세정료, 입욕제, 선 스크린 크림, 선 오일, 현탁액, 유탁액, 페이스트, 겔, 로션, 파우더, 비누, 계면 활성제-함유 클렌징, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션, 패취 또는 스프레이일 수 있으나, 이에 제한되는 것은 아니다
상기 화장료 조성물은 일반 피부 화장료에 배합되는 화장품학적으로 허용 가능한 담체를 1 종 이상 추가로 포함할 수 있으며, 통상의 성분으로 예를 들면 유분, 물, 계면 활성제, 보습제, 저급 알코올, 증점제, 킬레이트제, 무기염류, 색소, 산화방지제, 살균제, 방부제, 향료 등을 적절히 배합할 수 있으나, 이에 제한되는 것은 아니다.
상기 화장품학적으로 허용 가능한 담체는 상기 화장료 조성물의 제형에 따라 다양하다.
상기 제형이 연고, 페이스트, 크림 또는 젤인 경우에는, 담체 성분으로서 동물성 유, 식물성 유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화 아연 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2 종 이상 혼합되어 사용될 수 있다.
상기 제형이 파우더 또는 스프레이인 경우에는, 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록사이드, 칼슘 실케이트, 폴리아미드 파우더 등이 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로하드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진제를 포함할 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2 종 이상 혼합되어 사용될 수 있다.
상기 제형이 용액 또는 유탁액인 경우에는, 담체 성분으로서 용매, 용해화제 또는 유탁화제 등이 이용될 수 있으며, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌 글리콜, 1,3-부틸글리콜 오일 등이 이용될 수 있고, 특히, 목화씨 오일, 땅콩 오일, 옥수수 배종 오일, 올리브 오일, 피마자 오일 및 참깨 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2 종 이상 혼합되어 사용될 수 있다.
상기 제형이 현탁액인 경우에는, 담체 성분으로서 물, 에탄올 또는 프로필렌 글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타하이드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2 종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 비누인 경우에는, 담체 성분으로서 지방산의 알칼리 금속 염, 지방산 헤미에스테르 염, 지방산 단백질 히드롤리제이트, 이세티오네이트, 라놀린 유도체, 지방족 알코올, 식물성 유, 글리세롤, 당 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2 종 이상 혼합되어 사용될 수 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 포함하는, RNA 바이러스 감염 질환의 예방 또는 개선용 사료 조성물을 제공한다.
항RNA 바이러스용 조성물, RNA 바이러스 감염 질환, 예방 및 개선에 대해서는 상기 설명한 바와 같다.
본 발명의 용어 "사료"는 동물이 먹고, 섭취하며, 소화시키기 위한 또는 이에 적당한 임의의 천연 또는 인공 규정식, 한끼식 등 또는 상기 한끼식의 성분으로, 상기 항RNA 바이러스용 조성물을 유효성분으로 포함하는 사료는 당업계의 공지된 다양한 형태의 사료로 제조가능하며, 바람직하게는 농후사료, 조사료 및/또는 특수사료가 포함될 수 있다.
본 발명의 또 다른 양태는 상기 항RNA 바이러스용 조성물을 투여하는 단계를 포함하는, MAVS 단백질 분해 예방 또는 억제 방법을 제공한다.
항RNA 바이러스용 조성물은 상기 설명한 바와 같다.
이하 본 발명을 실시예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예는 본 발명을 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 국한되는 것은 아니다.
실시예 1: 세포 배양 및 형질전환
HEK293T, HeLa, MDCK, Vero 및 RAW264.7 세포는 10 % FBS (Fetal bovine serum, Gibco-BRL) 및 1 % 페니실린-스트렙토마이신 (Gibco-BRL)을 함유하는 DMEM 배지에서 배양하였고, U937 세포는 10 % FBS 및 1 % 페니실린-스트렙토마이신을 함유하는 RPMI 1640 배지 (Gibco-BRL)에서 배양하였다. 상기 세포는 모두 ATCC (American Type Culture Collection)로부터 분양 받았다.
BMDM (Bone marrow derived macrophage)은 5 내지 6 주령의 마우스로부터 분리하였고, 적혈구는 ACK (ammonium-chloride-potassium) 용해 버퍼 (Gibco-BRL)로 용해시켰다. 그 다음 수득한 BMDM은 10 % FBS, 10 % L929 세포-CM (conditioned medium) 및 GM-CSF (R&D Systems)을 함유하는 DMEM에서 배양하였다. 배지는 이틀 마다 새로운 완전 배지로 교체하였고, 배양 7 일째의 세포를 실험에 사용하였다.
안정적인 EPRS 넉다운 RAW264.7 세포주는 shRNA (kindly provided by Dr. Jae U. Jung, University of Southern California)를 처리하고 최소 2 주 동안 2 ㎍/ml의 퓨로마이신으로 선별하여 제작하였다.
pIRES 또는 pIRES-EPRS-FLAG을 안정적으로 발현하는 RAW264.7 세포주는 대응하는 DNA 컨스트럭트로 형질전환시켜 제작하였고, 1 μg/ml의 퓨로마이신을 함유하는 DMEM에서 배양하였다.
HEK293T 세포는 X-tremeGENE HP DNA 형질전환 시약 (Roche)을 사용하여 DNA 플라스미드 컨스트럭트로 형질전환시켰다. U937, RAW264.7 및 BMDM 세포는 nucleotransfector (Lonza, Cologne AG, Germany)로 형질전환시키고, 바로 Opti-MEM 배지 (Gibco-BRL)로 6 시간 배양한 뒤, 24 시간 동안 10 % FBS를 함유하는 완전 배지에서 배양하였다.
실시예 2: 마우스 및 바이러스 감염
C57BL/6 EPRStm1b 헤테로접합 넉아웃 마우스는 Toronto Center for Phenogenomics (Ontario, Canada)로부터 분양 받았고, 물과 사료를 자유롭게 제공하고 22 ± 2 ℃에서 12 시간 명/암 사이클의 특이 병원균이 없는 시설에서 사육하였다. 마우스 새끼는 다음의 프라이머를 사용하여 PCR로 유전형을 확인하였다.
A: 5'-TACTGTGCTGAATGAAAAGTGCC-3' (서열번호 1) 및 B: 5'-GGTAGAAGTGCTAAGTAGGATGAGG-3' (서열번호 2) (218 bp WT 밴드에 특이적); 및 C: 5'-CCATTACCAGTTGGTCTGGTGTC-3' (서열번호 3) 및 D: 5'-TGCCTGTGACCACCAATAAGAAAGCC-3' (서열번호 4) (462 bp 변이 밴드에 특이적)
모든 마우스는 CO2로 질식시켜 희생시켰다. 모든 동물 실험은 한국생명공학연구원의 실험동물 운영 위원회에서 인가되었고, 실험동물의 관리와 사용에 관한 지침 (미국국립보건원에서 발간)에 따라 수행하되었다.
바이러스 감염 실험을 위해, 6 내지 7 주령 마우스의 꼬리에 VSV-Indiana (2 x 108 pfu/마우스) 또는 VSV-GFP(2 x 108 pfu/마우스)를 정맥 주사하여 감염시켰다.
실시예 3: 시약 및 항체
면역블로팅 및 면역형광 실험에 다음의 1차 항체를 사용하였다: 항-EPRS (ab31531), 항-MRS (ab50793), 항-KRS (ab186196), 항-PCBP2 (ab110200), 항-Ceruloplasmin (ab135649), 및 항-VSV-G (ab1874) (Abcam); 항-MAVS (human-specific; 3993, rodent-specific; 4983), 항-L13a (2765), 항-IRF3 (4302), 항-phospho-IRF3 (4947), 항-STAT1 (9172), 항-phospho-STAT1 (7649), 및 항-Actin-HRP (12620) (Cell Signaling Technology); 항-NSAP1 (AV40641), 항-GAPDH (G9545), 및 항-FLAG (F3165) (Sigma); 항-Ub (sc-8017), 항-GFP (sc-9996), 및 항-GST (sc-459) (Santa Cruz Biotechnology); 항-AIMP3 (NMS-01-0002, Neomics, Seoul, Korea); 항-V5-HRP (46-0708, Invitrogen); 항-K48-linked polyubiquitin chains (05-1307, Millipore); 항-Strep-HRP (2-1509-001, IBA, Germany).
Ser990에 대한 affinity-purified 래빗 폴리클로날 인산-특이적 항체는 983DGQRKDP(p)SKNQGGG996 펩타이드 (서열번호 5) (AbClon, Seoul, Korea)를 사용하여 생산하였다. 인산-특이적 Ser886 및 Ser999 항체는 Dr. Paul L. Fox (Lerner Research Institute, Cleveland Clinic, CLV, USA)로부터 제공받았다. 염소 항-마우스 (7076) 또는 항-래빗 (7074) IgG-HRP (Cell Signaling Technology)를 면역블로팅에서 2 차 항체로 사용하였다. Alexa488-결합 항 마우스 IgG (A11059, Invitrogen) 및 Alexa594-결합 항 래빗 IgG (A11037, Invitrogen)는 면역형광 실험에 2 차 항체로 사용하였다. 기타 시약 및 재료들로 MG-132 (Sigma), 퓨로마이신 (Gibco-BRL), poly(I:C) (InvivoGen), IFN-γ (R&D Systems), 디지토닌 (digitonin, Sigma), protein A/G PLUS-agarose (sc-2003, Santa Cruz Biotechnology), Glutathione Sepharose 4 Fast Flow (17-5132-01, GE Healthcare), 항-FLAG M2 affinity gel (A2220, Sigma), Strep-Tactin Sepharose (2-1201-002, IBA), Ni-NTA agarose (30230, Qiagen), GFP-trap (gta-20, ChromoTek, Germany), 및 Superdex 200 10/300 GL column (GE Healthcare)을 사용하였다.
실시예 4: 플라스미드 제작
EPRS 컨스트럭트는 FLAG, Strep, His 또는 GFP 태그를 붙여 제작하였다. 구체적으로, 각 도메인을 보유하는 EPRS 단편을 PCR로 증폭시킨 뒤 GFP, Strep, His 혹은 FLAG 태그를 포함하는 벡터로 서브클로닝하였다. EPRS의 phosphomimetic 변이체 (S886D, S990D, S999D, S886D/S990D 및 S886D/S999D)는 QuikChange site-directed mutagenesis kit (Stratagene, Amsterdam, Netherlands)를 사용하여 PCR을 통해 제작하였다. 위치 특이적 돌연변이를 위한 PCR 프라이머는 하기 표 1에 나타내었다.
qPCR 프라이머
유전자 정방향 역방향
hEPRS CTTCTCAAGGGGAAG (서열번호 6) CTGCTTTTCAGATTT (서열번호 7)
mEPRS AAGCGGAAAAGGCTCCTAAG (서열번호 8) CCCAGTCTTTTCTTTATACTCAGCTT (서열번호 9)
IFN-α CTTGAAGGACAGACATGACTTTGGA (서열번호 10) GGATGGTTTCAGCCTTTTGGA (서열번호 11)
IFN-β TCCAAGAAAGGACGAACATTCG (서열번호 12) TGCGGACATCTCCCAACGTCA (서열번호 13)
ADAR1 CCAAAGACACTTCCTCTC (서열번호 14) CAGTGTGGTGGTTGTACT (서열번호 15)
MX1 ACAAGCACAGGAAACCGTATCAG (서열번호 16) AGGCAGTTTGGACCATCTTAGTG (서열번호 17)
OAS1 GAGGCGGTTGGCTGAAGAGG (서열번호 18) GAGGAAGGCTGGCTGTGATTGG (서열번호 19)
OAS1β TTGATGTGCTGCCAGCCTAT (서열번호 20) TGAGGCGCTTCAGCTTGGTT (서열번호 21)
PKR GCCAGATGCACGGAGTAGCC (서열번호 22) GAAAACTTGGCCAAATCCACC (서열번호 23)
PML CCTGCGCTGACTGACATCTACT (서열번호 24) TGCAACACAGAGGCTGGC (서열번호 25)
P56 CCCACGCTATACCATCTACC (서열번호 26) CTGAGGCTGCTGCTATCC (서열번호 27)
ISG15 CAATGGCCTGGGACCTAAA (서열번호 28) CTTCTTCAGTTCTGACACCGTCAT (서열번호 29)
ISG20 AGAGATCACGGACTACAGAA (서열번호 30) TCTGTGGACGTGTCATAGAT (서열번호 31)
ISG56 AGAGAACAGCTACCACCTTT (서열번호 32) TGGACCTGCTCTGAGATTCT (서열번호 33)
GAPDH TGACCACAGTCCATGCCAT (서열번호 34) GACGGACACATTGGGGGTAG (서열번호 35)
VSV-G CAAGTCAAAATGCCCAAGAGTCACA (서열번호 36) TTTCCTTGCATTGTTCTACAGATGG (서열번호 37)
위치-특이적 돌연변이 PCR 프라이머
EPRS S886D CCCCCATTATCTCAAAGTTCGGATTCAGACCCAACCAGAAATT (서열번호 38) AATTTCTGGTTGGGTCTGAATCCGAACTTTGAGATAATGGGGG (서열번호 39)
EPRS S990D CACACAAAGGAAAGACCCTGATAAAAACCAAGGAGGTGGG (서열번호 40) CCCACCTCCTTGGTTTTTATCAGGGTCTTTCCTTTGTGTG (서열번호 41)
EPRS S999D TCTAAAAACCAAGGAGGTGGGCTCTCAGATAGTGGAGCAGGAGA (서열번호 42) TCTCCTGCTCCACTATCTGAGAGCCCACCTCCTTGGTTTTTAGA (서열번호 43)
EPRS S990A GCCAAAGGAAAGACCCTGCTAAAAACCAAGGAGGT (서열번호 44) ACCTCCTTGGTTTTTAGCAGGGTCTTTCCTTTGGC (서열번호 45)
EPRS R201L GAGATGGGAAAGGTTACCGTCTTATTTCCTCCAGAGGCCAGTGG (서열번호 46) CCACTGGCCTCTGGAGGAAATAAGACGGTAACCTTTCCCATCTC (서열번호 47)
EPRS R395L GAAGGTGTTACACATGCCCTGTTAACAGAATACCATGACAG (서열번호 48) CTGTCATGGTATTCTGTTGTTAACAGGGCATGTGTAACACCTTC (서열번호 49)
EPRS S434A/K435L CTCAACAACACAGTGCTAGCGCTGAGAAAACTCACATGGTTTG (서열번호 50) CAAACCATGTGAGTTTTCTCAGCGCTAGCACTGTGTTGTTGAG (서열번호 51)
EPRS R1152L GTGGTGCAATGTGGTGCTTTGGGAATTCAAGCATC (서열번호 52) GATGCTTGAATTCCCAAAGCACCACATTGCACCAC (서열번호 53)
siRNA 서열
hEPRS CUAAUUCCUCAGCAAGUAU (서열번호 54)
mEPRS CAAAGUCAUCAUCAAACAC (서열번호 55)
mMAVS 1 UUGCUGAGGACAAGACCUAUA (서열번호 56)
mMAVS 2 CAGAGGAGAAUGAGUAUUC (서열번호 57)
sgRNA 서열
sgEPRS 1 GAATTCTATACTTCGCTACTTGG (서열번호 58)
sgEPRS 2 GCTAGAGTTGCAACTACAGCTGG (서열번호 59)
FLAG, Strep, His 또는 GST가 태깅된 전장 및 단편 PCBP2도 제작하였다. MAVS는 FLAG, GST 혹은 Strep-태그를 포함하는 벡터에 클로닝하였다. 루시퍼라제 리포터 분석에 사용된 이 벡터는 Dr. Jae U. Jung (University of Southern California)로부터 제공받았다.
실시예 5: RNA-Seq 분석
초대 NHBE (normal human bronchial epithelial) 세포는 ScienCell Research Laboratories에서 구입하였고, 기존에 알려진 방법으로 분화시켰다. 단층의 NHBE 세포를 A/PR/8/34 인플루엔자 바이러스 (MOI = 1)로 8 시간 혹은 24 시간 동안 감염시켰다. 총 RNA는 RNeasy RNA 추출 미니키트 (Qiagen)를 사용하여 감염된 세포로부터 분리하였고, 분리된 RNA의 질 (quality)은 아가로스 겔 전기영동으로 확인하였다.
시퀀싱 라이브러리는 TruSeq RNA sample preparation kit v2 (Illumina)를 사용하여 제조하였다. 구체적으로, poly-T oligo-attached 자석 비드를 사용하여 총 RNA로 분리한 mRNA를 절편화하고 cDNA로 전환시켰다. 상기 cDNA에 어댑터를 연결하고, 이를 PCR로 증폭하였다. Paired-end 시퀀싱 (101 x 2)은 Hiseq-2000 (Illumina)을 사용하여 실시하였다. 각 조건에서 반복하여 서열을 분석하였다. 인간의 표준 유전체 서열 데이터는 University of California Santa Cruz Genome Browser Gateway (assembly ID: hg19)로부터 얻었다. 표준 유전체 인덱스는 SAMtools (v. 0.1.19) 및 Bowtie2-build component of Bowtie2 (v. 2.1.0)를 사용하여 수립했다. Tophat2 (v. 2.0)를 사용하여 표준 유전체를 맵핑하여 판독하였다. 46,895 개의 RefSeq (UCSC hg19) 유전자 모델의 각 유전자에 대한 rpkm (reads per kilobase per million mapped reads) 수는 Cufflinks (v. 2.2.1)를 사용하여 계산하였고, 히트 맵 (heat map)은 Mev (v. 4.9.0)를 사용하여 구축하였다. 통계 분석 및 그래프 구축은 R (v. 3.1.0)과 PYTHON (v. 2.7.6)을 사용하여 수행하였다. 본 발명에서 기술한 RNA-seq 데이터는 NCBI의 GEO (Gene Expression Omnibus)에 accession code GSE75699로 등록되었다.
실시예 6: 루시퍼라제 분석
루시퍼라제 리포터 플라스미드, 레닐라 (renilla) 루시퍼라제 내부 대조군 벡터 (phRL-TK; Promega) 및 각 플라스미드를 함유하는 혼합물로 HEK293T 세포를 형질전환시켰다. 루미노미터 (luminometer, Promega)와 이중-루시퍼라제 리포터 분석 시스템 (Promega)을 사용하여 형질전환 24 시간 후에 리포터 유전자 분석을 실시하였다. 데이터는 레닐라 루시퍼라제 활성에 대한 상대적인 파이어플라이 루시퍼라제 활성을 표준화하여 나타냈다. 리포터 및 레닐라 플라스미드만 발현하는 세포의 프로모터 활성을 대조군 (Con)으로서 측정하였다.
실시예 7: RNA 간섭 (interference)
TransIT-TKO transfection reagent (Mirus)를 사용하여 제조사 프로토콜에 따라 duplex siRNA로 세포를 형질전환시켰다. EPRS-특이적 siRNA 서열은 상기 표 1에 나타내었다. 비표적 siRNA를 대조군으로 사용하였고, 세포는 바이러스에 노출시키기 전 36 시간 내지 48 시간 동안 siRNA 혹은 대조군을 첨가한 조건에서 배양하였다.
실시예 8: 바이러스 복제 분석
1 % FBS를 함유하는 배지에서 세포를 2 시간 동안 바이러스로 감염시켰다. 그 다음 완전 배지로 배지를 교체하여 초과되는 바이러스를 제거하였다. 바이러스 역가는 표준 플라크 분석 (standard plaque assay)을 사용하여 MDCK 세포 (PR8-GFP) 혹은 Vero 세포 (VSV-GFP, HSV-GFP)에서 확인하였다. 마우스 조직에 존재하는 바이러스를 적정 할 때 동결-해동 조직 추출물의 균질물을 사용하여 플라크 카운팅을 수행하였다. GloMax® Multi-Microplate Multimode Reader (Promega)의 형광 모듈을 사용하여 GFP가 태깅된 바이러스의 복제를 측정하였다. Nikon eclipse Ti microscope fitted with a 20 x 1.4 NA Plan-Apochromat objective lens를 사용하여 사진을 찍었다.
실시예 9: ELISA
ELISA로 감염된 세포 배양 상층액 혹은 마우스 혈청으로부터 사이토카인 수준을 측정하였다. 다음의 ELISA 키트를 제조사의 지침에 따라 사용하였다: 마우스 또는 인간 IL-6 (BD Biosciences), IFN-α 및 IFN-β (PBL interferon source), 및 IFN-γ (KOMA, Korea).
실시예 10: 정량적 리얼타임 (real-time) PCR
총 RNA는 RNeasy RNA extraction Mini-Kit (Qiagen)를 사용하여 세포 및 마우스 조직으로부터 추출하였다. cDNA는 Enzynomix kit (Enzynomix)를 사용하여 합성하였고, 정량적 PCR은 유전자-특이적 프라이머 세트 (Bioneer, Daejeon, Korea) 및 SYBR Green PCR Master Mix (Roche)를 사용하여 수행하였다. 리얼타임 PCR은 제조사 지시에 따라 Rotor-Gene Q instrument (Qiagen)를 사용하여 실시하였다. 데이터는 gapdh 발현에 대해 표준화하고, 상대적 발현은 delta-delta CT 방법으로 계산하였다. 사용된 프라이머 서열은 상기 표 1에 정리하였다.
실시예 11: 면역블로팅 분석 및 면역침강 분석
면역블로팅 분석을 위해, 세포를 protease inhibitor cocktail 및 phosphatase inhibitor cocktail (Roche)을 함유하는 RIPA 버퍼 (20 mM Tris-HCl, pH 7.4, 150 mM NaCl, 1 % NP-40, 및 1 mM EDTA)에 용해시켰다. 총 세포 용해물 (50 - 100 μg)을 이용하여 SDS-PAGE를 수행한 다음, 각각의 항체로 면역블로팅을 실시하였다.
인산화된 단백질을 검출하기 위해, 4 ℃에서 protease inhibitor cocktail를 포함하는 Phosphosafe 추출 버퍼 (Millipore)로 세포 용해물을 제조하였다.
면역침강반응을 위해, 세포 용해물을 protein A 비드와 함께 4 ℃에서 1 시간 동안 인큐베이션하여 전세척하였다. 상기 전세척된 세포 용해물을 각각의 항체와 함께 4 ℃에서 밤새 인큐베이션한 뒤, 30 ㎕의 protein A/G PLUS-아가로스 비드와 함께 4 ℃에서 3 내지 4 시간 동안 인큐베이션하였다. 그 다음 면역침강물을 회수하고, 면역블로팅 분석 전에 용해 버퍼로 5 회 세척하였다.
실시예 12: 단백질 정제 및 크기-배제 크로마토그래피
His (hexahistidine)-tagged EPRS (aa 1-732, aa 1-196, 및 aa 1-168), His-tagged PCBP2 (aa 11-82 및 aa 168-279), GST-fused PCBP2 (aa 11-82), 또는 GST-fused MAVS (aa 460-540) 단백질을 발현하는 플라스미드를 대장균 BL21-CodonPlus (DE3)-RIPL 세포에 형질전환시키고, 18 ℃에서 18 시간 동안 0.5 mM의 IPTG 처리하여 발현을 유도하였다. 그 다음, 상기 세포를 버퍼 A (50 mM Tris-HCl, pH 7.5 및 150 mM NaCl)에 현탁시키고, 얼음 위에서 소니케이션 (sonication)으로 용해시켰다. 그 다음, 세포 용해물을 4 ℃에서 1 시간 동안 25,000 g로 원심분리하였다. Hig-태그 EPRS 도메인 또는 PCBP2 도메인이 포함된 상층액을 Ni-NTA 아가로스 컬럼에 로딩하고, 버퍼 A로 세척한 다음, 250 mM의 이미다졸로 용출시켰다. GST가 융합된 PCBP2 또는 MAVS 도메인을 포함하는 상층액은 Glutathione Sepharose 4B 컬럼에 로딩하고, 버퍼 A로 세척한 다음, 10 mM의 환원된 글루타티온으로 용출시켰다. 그 다음, 정제된 단백질을 버퍼 A에 대해 투석하고, 사용 전까지 -80 ℃에 보관하였다. 4 ℃에서 Superdex 200 10/300 GL 컬럼을 사용하여 크기-배제 크로마토그래피를 수행하여 정제된 EPRS (aa 1-732)를 조사하였다. 분자량 기준으로 알코올 탈수소효소 (150 kDa) 및 알부민 (66 kDa)을 사용하였다. 용출된 모든 단백질은 SDS-PAGE로 분석한 다음, Coomassie Brilliant Blue로 염색하였다.
실시예 13: 시험관 내 풀-다운 (pull-down) 분석
정제된 Hig-태그 EPRS 도메인 (10 μM) 및 GST-융합 PCBP2 도메인 (20 μM)을 결합 버퍼 (50 mM Tris-HCl, pH 7.5, and 300 mM NaCl)에서 혼합시켰다. 나아가, 정제된 GST-융합 MAVS (10 μM)는 Hig-태그 PCBP2 도메인 (5 μM)과 결합 버퍼에서 혼합시켰다. 그 다음 상기 단백질 혼합물을 4 ℃에서 1 시간 동안 50 ㎕의 Ni-NTA 아가로스 비드와 함께 인큐베이션하였다. 세척 버퍼 (50 mM Tris-HCl, pH 7.5, 300 mM NaCl, 및 10 mM 이미다졸)로 세척한 후, 결합된 단백질들을 용출 버퍼 (50 mM Tris-HCl, pH 7.5, 300 mM NaCl, 및 250 mM 이미다졸)로 용출시켰다. 표본은 4 - 12 % SDS-PAGE 겔에 로딩하였고, 단백질 밴드는 쿠마시 블루 (Coomassie Blue) 염색으로 확인하였다.
실시예 14: 조직 분석
뇌 시료는 4 % 파라포름알데히드로 고정하고, 파라핀으로 봉입하여 4 ㎛ 두께의 절편으로 절단하였다. 절편들은 자일렌으로 탈파라핀화시킨 뒤, H&E로 염색하였다.
VSV를 검출하기 위해, 뇌 절편들을 자일렌으로 탈파라핀화시키고 시트레이트 버퍼 (pH 6.5)에서 마이크로파를 가하여 항원을 회수하였다. VSV-G 항체 (래빗, 1:200)로 염색한 이후, 절편을 Alexa488-결합 항-래빗 IgG (1:250)와 인큐베이션한 뒤 DAPI 염색을 수행하였다.
형광 이미지는 Nikon laser scanning confocal microscope (C2plus, Tokyo, Japan)로 캡쳐하고 NIS-Elements software (Nikon)을 사용하여 작업하였다.
실시예 15: 컨포컬 현미경
HeLa 세포는 8-웰 플레이트 (Labtek)에 접종하였다. 바이러스를 감염시킨 후, 감염된 세포를 상온에서 20 분간 4 % 파라포름알데히드로 고정시켰다. MSC 복합체의 선명한 이미지를 얻기 위해 얼음 위에서 10 분간 25 μg/ml 디지토닌과 함께 세포를 인큐베이션하였다. -20 ℃에서 20 분간 100 % MeOH로 투과 처리한 후, 실온에서 1 시간 동안 2 % BSA를 함유한 PBS에서 세포를 블락킹시켰다. 그 다음, 세포를 PBS-T (0.05 % Tween-20 함유 PBS)로 3 번 세척하고, 4 ℃에서 적합한 1 차 항체와 함께 밤새 인큐베이션하였다. 그 다음, 3 번 더 세척하고, 적합한 2 차 항체와 실온에서 1 시간 동안 인큐베이션하였다. 그 다음, 세포를 실온에서 10 분간 DAPI로 염색하고, PBS-T로 세 번 세척한 뒤, 마운팅 용액으로 봉입하였다. 이미지는 Nikon laser scanning confocal microscope (C2plus)에 NIS-Elements 소프트웨어를 사용하여 분석하였다. 피어슨 상관 계수에 근거한 Co-localization 지수는 소프트웨어 툴로 계산하였다.
실시예 16: EPRS의 인산화 위치 및 상호작용체 ( interactome )를 규명하기 위한 질량 분석 (mass spectrometry)
HEK293T 세포를 24 시간 동안 Strep-EPRS 플라스미드로 형질전환시키고, 6 시간 동안 PR8-GFP (MOI = 5)로 감염시켰다. 감염된 세포는 단백질 분해효소 억제제 및 포스파타제 억제제 칵테일 (Roche)을 포함하는 용해 버퍼 (20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 0.5 % NP-40, 및 1 mM EDTA)로 회수하고, 4 ℃에서 Strep-Tactin Superflow high capacity resin (IBA)에서 밤새 인큐베이션했다. 그 다음, 레진을 용해 버퍼로 5 번 세척하고, 결합된 단백질을 용출 버퍼 (100 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM EDTA, 및 2.5 mM 데스티오바이오틴 (desthiobiotin))으로 용출시켰다. 마지막으로 용출된 분획을 Amicon Ultra-4 (10 K MWCO) 원심분리 장치 (Millipore)로 농축하였다. 상기 시료는 SDS-PAGE 및 silver 염색으로 분석하였다. 그 다음, 염색된 단백질 밴드를 잘라 겔 상에서 트립신으로 분해하였다. 상기 트립신 분해 펩타이드를 회수하여 Eksigent MDLC 시스템에 결합된 reversed-phase Magic 18aq (5 ㎛, 200 Å, Michrom BioResourecs) 컬럼 (15 cm × 75 μm, packed in-house)에 로딩했다. 상기 펩타이드를 40 분 동안 5-40 % 아세토니트릴 함유 산성수 (0.1 % 포름산)로 직선 구배하며 300 nL/분 유속으로 용출시켰다. HPLC 시스템은 LTQ XL-Orbitrap 질량분석기 (Thermo Scientific)에 결합시켰다.
전구체 선별 및 펩타이드 하전량 확인을 위해, 100,000 해상도로 Survey full-scan MS spectra (300-2,000 m/z)를 획득했다. 이온화 파라미터의 소스는 다음과 같다: 분무 전압 (spray voltage), 1.9 kV; 모세관 온도 (capillary temperature), 250 ℃.
MS1 스캔에서 2 이상의 전하상태에서 가장 강한 이온에 대한 MS/MS spectra는 다음의 옵션을 사용하여 얻었다: isolation width, 2.0 m/z; normalized collision energy, 35%; and dynamic exclusion duration, 30 s. 로우 데이터는 Proteome Discoverer 1.4 (Thermo Scientific)의 SEQUEST 알고리즘 및 MASCOT 서치 엔진 (v. 2.3.01; Matrix Science)을 사용하여 찾았다. 인간 Uniprot 데이터베이스 (2013. 07 공개)는 다음의 파라미터를 사용하여 찾았다. 전체 트립신 분해 펩타이드 절단 특이성 (full tryptic peptide cleavage specificity), 두 개의 잘못된 절단 (two missed cleavages), carbamidomethyl 시스테인의 고정된 변형 (+57.021 Da), 산화된 메티오닌의 다양한 변형 (+15.995 Da), 및 인산화된 세린, 트레오닌 및 티로신 (+79.9799 Da).
실시예 17: 생체 내 및 시험관 내 유비퀴틴화 분석
HEK293T 세포를 MAVS-FLAG, ITCH-V5, GST-PCBP2 및 Strep-EPRS 플라스미드의 다양한 조합으로 형질전환하였다. 24 시간 후, 세포를 10 μM MG-132로 6 시간 동안 처리하고 RIPA 버퍼로 용해한 뒤, 4 ℃에서 6 시간 동안 anti-FLAG 친화성 겔로 면역침강반응을 실시하였다. 내인적 MAVS의 유비퀴틴화를 보기 위해, 세포 용해물을 anti-MAVS 항체와 함께 밤새 인큐베이션하고, 4 ℃에서 3 시간 동안 protein A/G PLUS-아가로스 비드와 인큐베이션시켰다. 그 다음, 면역 복합체를 용해 버퍼로 5 번 세척하고, 10 분간 SDS 샘플 버퍼에서 가열하였다. 유비퀴틴화는 anti-Ub 혹은 anti-K48 항체를 사용하여 분석하였다. 시험관 내 유비퀴틴 분석을 위해, Strep-MAVS, Strep-PCBP2 및 Strep-EPRS 단백질을 각 플라스미드로 형질전환된 HEK293T의 용해물에서 침전시켰다. ITCH-V5 단백질은 anti-V5 항체와 용해물을 인큐베이션하여 준비하고, protein A/G PLUS-아가로스 비드와 함께 인큐베이션시켰다. 정제된 단백질은 Mg2 +-ATP를 함유하는 반응 버퍼에서 ubiquitin, E1 및 UbcH5b의 E2 (Boston Biochem)와 함께 37 ℃에서 1 시간 동안 인큐베이션하였다. 이 반응은 1 mM DTT를 함유하는 SDS 샘플 버퍼를 첨가하여 10 분간 가열함으로써 종결하고, 유비퀴틴화는 anti-Ub 항체로 감지하였다.
실시예 18: 펩타이드 설계 및 합성
EPRS L1 (aa 168-196)을 세포 투과성 HIV-1 TAT 펩타이드(aa 47-57, YGRKKRRQRRR; 서열번호 60)와 융합시켰다. 융합 펩타이드는 (Tat-Epep)를 합성한 뒤 역상 HPLC (AbClon)로 93 % 이상 정제하였다. Tat-Epep 서열은 YGRKKRRQRRR-GG-DVSTTKARVAPEKKQDVGKFVELPGAEMG (서열번호 61)이다. TAT 잠복 YGRKKRRQRRR 서열 (서열번호 60)은 컨트롤 펩타이드로 사용하였고, 동결건조된 펩타이드는 -80 ℃에서 건조제와 보관하여 사용 전에 PBS로 용해시켰다.
실시예 19: 세포독성 분석
HEK293T 혹은 RAW264.7 세포를 96-웰 플레이트 (10,000 per well)에 접종한 다음, 0 - 24시간 동안 Tat-Epep (20-200 μM)를 처리하였다. 그 다음, MTS [3-(4,5-dimethylthiazole-2-yl)-5-(carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium salt] (Promega)를 사용하여 비색분석법으로 세포독성을 확인하였다. MTS 20 μl을 37 ℃에서 1 시간 동안 각 웰에 첨가하였다. Automated microplate reader (BioTek)를 사용하여 광학 밀도 490 nm에서 측정하였고, 630 nm의 백그라운드 흡광도를 각 샘플 reading에서 차감하였다.
실시예 20: 설계된 펩타이드를 이용한 동물 실험
C57BL/6 마우스 (암컷, 7 주령)를 고아테크 (평택, 한국)로부터 구매하고 VSV-인디아나 (2 x 108 pfu/마우스)를 정맥 투여하여 감염시켰다. 24 시간 후, Tat-Epep (2.5 mg/kg [0.53 μM/kg] 또는 5 mg/kg [1.05 μM/kg])를 3 일 동안 매일 마우스의 복강 내 투여하였다. Tat PTD 펩타이드 (1.65 mg/kg [1.05 μM/kg])를 대조군으로 사용하였다. 4 일째에 마우스로부터 뇌 조직을 회수하였다. 회수한 표본을 TissueLyser 장비 (Qiagen)를 이용해 즉시 균질화시키고 상술한 방법으로 바이러스 역가를 측정하였다.
실시예 21: 통계 분석
통계 분석은 Prism (Version 6.0, GraphPad Software)을 사용하여 수행하였다. 데이터는 Student's unpaired t-test, the log-rank test, 또는 the non-parametric Mann-Whitney test를 적절히 이용하여 분석하였다. 데이터의 표준화는 Kolmogorov-Smirnov test를 사용하여 평가하였다. 데이터는 언급하지 않은 한, 평균값 ± SD로 나타내었고, 모든 실험은 최소 3 번 반복하였다. 분석에 따라 * < 0.05, ** < 0.01, 또는 *** < 0.001의 P-값을 유의한 것으로 하였다.
실험예 1: EPRS (glutamyl-prolyl-tRNA synthetase)의 항바이러스능 확인
ARS (Aminoacyl-tRNA synthetases)는 여러 비번역 세포 프로세스에서 중요 역할을 하지만, 바이러스에 감염에서 이들의 역할은 거의 보고된바 없었다. 따라서, 본 발명자들은 인플루엔자 A 바이러스에 감염된 인간 기관지 상피세포에서 MSC (Multi-tRNA synthetase complex) 구성요소를 코딩하는 유전자의 발현 패턴을 조사하기 위해, RNA-시퀀싱을 이용하여 글로벌 전사체 분석을 실시하였다. 이를 통해, 상기 유전자들의 비균일적 발현 및 일시적 변동을 관찰하였고, 이는 바이러스 감염에 반응할 때 상기 유전자들이 어떠한 역할을 한다는 것을 시사하는 것이다 (도 1).
다음으로, 본 발명자들은 항바이러스 반응을 유발할 가능성이 있는 MSC 단백질을 조사하였고, EPRS (glutamyl-prolyl-tRNA synthetase)가 상당한 수준으로 IFN-β 프로모터 활성을 유도하는 것을 확인하였다 (도 2). 나아가, 바이러스가 감염된 다양한 세포주에서 EPRS mRNA 발현이 점진적으로 유도되는 것을 확인하였다 (도 3). 또한, RAW264.7 세포주에서 siRNA를 이용하여 EPRS를 넉다운시킨 경우 (도 4), RNA 바이러스 (PR8 인플루엔자 A 바이러스 및 베시큘라 소마티티스 바이러스 (vesicular stomatitis virus, VSV))의 복제가 증가되었으나 (도 5 및 도 6), 헤르페스 심플렉스 바이러스 (herpes simplex virus, HSV)(DNA 바이러스)는 복제에 영향을 받지 않는 것을 확인하였다 (도 7). EPRS-넉다운 세포는 바이러스 감염 또는 합성 dsRNA poly(I:C) 처리에 대해 항바이러스성 사이토카인 (IFN-β 및 IL-6) 생산이 상당히 감소하였다 (도 8 및 도 9). 다만, HSV는 사이토카인 유도를 크게 변화시키지 못했다 (도 8 및 도 9). EPRS-넉다운 HEK293T 세포주 (도 10 내지 도 12) 및 shRNA를 이용해 안정적으로 EPRS를 넉다운 시킨 RAW264.7 세포주 (도 13 내지 도 19)에서도 이와 유사한 결과를 확인하였다. 나아가, EPRS-넉다운 세포에서 IFN-관련 신호전달 분자인 IRF3 및 STAT1의 활성화가 현저하게 감소하였다(도 20). 반면에, EPRS를 안정적으로 과발현시킨 RAW264.7 세포 (도 21)에서는 PR8 (도 22 내지 도 24) 또는 VSV (도 25 내지 도 27) 감염으로 바이러스 복제가 크게 감소하였고, IFN-β 및 IL-6 생산은 증가하였다.
종합하면, 상기 데이터들은 EPRS가 특히 RNA 바이러스에 대한 항바이러스 선천성 면역 반응을 양성 조절한다는 것을 입증하는 것이다.
실험예 2: 바이러스 감염에 대한 EPRS의 생체 내 방어 반응 확인
본 발명자들은, EPRS의 동형 결손 (homozygous deletion) 마우스는 이유 전 단계 (pre-weaning stage)에서 죽기 때문에, 이형 EPRS+/- 마우스를 이용하여 항바이러스 면역 반응에서의 EPRS의 생리학적 역할을 조사하였다. PR8 또는 VSV에 감염된 야생형 (WT, EPRS+/+) 및 EPRS+/- 마우스로부터 분리된 BMDM (bone marrow-derived macrophage)를 조사하였을 때, EPRS+/- BMDM에서의 바이러스 역가는 WT BMDM에서 보다 훨씬 높게 나타났다 (도 28). 이와 함께, 바이러스 감염 (도 29) 및 poly(I:C) 처리 (도 30)에 대하여, EPRS+/- BMDM에서 IFN-β 및 IL-6 생산 수준은 EPRS+/+ 세포에 비해 현저히 낮은 것을 확인하였다. siRNA로 형질전환한 EPRS-결핍 BMDM을 이용한 경우에도 유사한 결과를 확인하였다 (도 31 내지 도 34). 나아가, IFN-β 수준, 항바이러스성 IFN-관련 유전자 발현, 및 염증-관련 유전자 발현 또한 VSV에 감염된 EPRS+/+ 세포에서 보다 VSV에 감염된 EPRS+/- BMDM에서 현저히 감소하였다 (도 35). EPRS-넉다운 RAW264.7 세포의 PR8 감염에 대한 항바이러스성 유전자의 유도 역시 대조군 세포에 비해 상당히 감소하였다 (도 36). 대조적으로, HSV로 감염된 EPRS+/+ 및 EPRS+/- BMDM 사이에서는 바이러스 복제 또는 사이토카인 분비에 유의적인 차이가 없었다 (도 37 및 도 38).
다음으로, EPRS+/+ 및 EPRS+/- 마우스에 VSV-인디아나 균주를 정맥투여하고, 이들의 생존을 매일 관찰하였다. EPRS+/- 마우스는 43 % (6/14)가 감염 6 일 내에 죽었으나, EPRS+/+ 마우스는 단 7 % (1/15)만 죽는 것을 확인하였다 (도 39). 마우스 조직에서 바이러스 양을 확인하기 위해, 바이러스 감염 5 일째에 마우스의 뇌와 비장을 회수하여 분석하였다. EPRS+/- 마우스의 뇌 및 비장에서 바이러스 역가는 EPRS+/+ 마우스에 비해 현저히 높았는데 (도 40 및 도 41), 이는 EPRS+/- 마우스가 VSV 감염에 더욱 감수성을 가진다는 것을 의미한다.
다음으로, 면역 반응에서 EPRS의 기능적 중요성을 더 확인하기 위해, 재조합 VSV-GFP를 EPRS+/+ 및 EPRS+/- 마우스에 정맥 투여하고, 감염 12 시간 뒤 혈청 표본에서 바이러스 양 및 항바이러스성 사이토카인 수준을 측정하였다. 그 결과, 바이러스 혈증 (viremia)은 높았고 (도 42), 혈청에서 IFN-β, IFN-α, 및 IL-6 수준은 낮은 것을 확인하였다 (도 43).
마지막으로, 감염 0 내지 5일째에 뇌 조직 표본을 수집하고, VSV에 의해 유도된 조직학적 특징을 조사하였다. H&E (hematoxylin-eosin)로 염색된 EPRS+/- 마우스의 뇌 절편에서는 EPRS+/+ 마우스에 비해 염증성 세포의 침투가 현저히 많이 관찰 (특히, 측뇌실 영역 주변)되었다 (도 44). 나아가, 뇌 조직 절편을 항-VSV-G 항체로 염색한 면역조직화학 분석으로, 염증 주변 위치에서 감염된 바이러스의 존재를 확인하였고, EPRS+/+ 마우스에 비해 EPRS+/- 마우스에서 바이러스 제거는 느리게 진행되었다 (도 45).
종합하면, 상기 결과는 EPRS가 바이러스 감염에 대하여 마우스 세포 내 선천성 면역반응에 관련되어 있다는 것을 증명하는 것이다.
실험예 3: 항바이러스 활성에 대한 EPRS의 감염-특이적 변형
종래 연구 결과에서는 인산화와 같은 번역 후 변형 과정이 MSC로부터 ARS를 방출시키고, 이후의 하류 유효 분자와의 상호작용 및 비정규 (non-canonical) 기능의 활성에 핵심적인 역할을 하는 것으로 보고된바 있다. 예를 들어, EPRS의 Ser886 및 Ser999의 IFN-γ-의존적 순차적 인산화는 MSC로부터 EPRS를 방출시켜 GAIT 복합체의 형성을 유도한다. 바이러스 감염에 대한 EPRS의 기능을 평가하기 위해, 본 발명자들은 IFN-γ 활성과 관련하여 EPRS의 연구에 주로 사용되는 세포주인, 인간 대식세포-유사 U937세포를 PR8 바이러스로 감염시켰다. 그 결과, 바이러스 감염에 의해 KRS 및 AIMP3와 EPRS의 상호작용이 현저히 감소한 것을 확인하였는데, 이는 MSC로부터 EPRS가 분리되었음을 의미하는 것이다 (도 46). EPRS의 Ser886의 인산화를 통해 EPRS에 직접 결합하는 전구-GAIT 복합체 구성요소인 NSAP1에 대한 항체를 이용한 면역블랏 분석에서, 24 시간째에 EPRS가 NSAP1에 약하게 결합하는 것을 확인하였다. 그러나, EPRS는 기능적 복합체 형성을 위해 EPRS Ser999 위치의 인산화에 필요한 GAIT 복합체 구성성분인 GAPDH에는 결합하지 않았다 (도 46).
다음으로, PR8으로 감염된 RAW264.7 대식세포 용해물을 항-EPRS 또는 항-KRS 항체와 공동-면역침강 (co-IP)시켜, 바이러스에 의해 MSC로부터 EPRS의 방출이 유발되는지를 확인하였다 (도 47 및 도 48). 컨포컬 현미경 분석 또한 EPRS가 KRS와 같은 위치에 존재하는 것을 보여주었으나, 바이러스 감염에 따라 같은 위치에 존재하는 신호가 감소하는 것을 확인하였다 (도 49 내지 도 51). 상기 결과들은 EPRS 활성과 관련된 분명한 바이러스-특이적 작용기전이 존재함을 의미하는 것이다.
EPRS 활성의 작용기전 및 이의 항바이러스 반응에서의 역할을 규명하기 위해, 본 발명자들은 다음으로 질량분석-기반의 단백질 분석 접근방식을 이용하여, 스트렙-태깅 EPRS를 이소성으로 발현하는 HEK293T 세포에서 특이적인 변역 후 변이를 확인하고자 하였다 (도 52). 비감염 및 감염 세포에서 모두 Ser886의 인산화가 검출된 반면, Ser999 (IFN-γ 자극에 대해 인산화됨)에서는 모든 조건에서 변형되지 않는 것을 확인하였다 (도 53 내지 도 55). 예상과는 달리, 바이러스 감염은 EPRS의 Ser990의 인산화를 유도하였다 (도 56 및 도 57). 상기 결과를 확인하기 위해, 항원으로서 인산-펩타이드 983DGQRKDP(p)SKNQGGG996 (서열번호 62)를 이용하여 이 위치에 대한 래빗 다클론항체를 제조하였다. EPRS Ser990 위치의 인산화는 U937 세포에 PR8이 감염된 후 점차적으로 증가하였다 (도 58). 반면에, IFN-γ 처리는 Ser990의 인산화를 유도하지 않았다 (도 58). 다른 바이러스 또는 합성 RNA를 처리한 세포에서도 유사한 결과를 관찰할 수 있었다 (도 59 내지 도 62).
또한, 본 발명자들은 비감염 세포에서, IFN-γ로 자극한 뒤 관찰되는 것 보다는 약하게 증가하기는 하지만 PR8 감염에 의해 증가하는 Ser886 인산화가 낮은 수준으로 검출되는 것을 확인하였다 (도 63). 바이러스 감염은 Ser999 인산화를 유도하지 않지만, IFN-γ 자극은 명백하게 Ser999 인산화를 유도하였다 (도 64). 나아가, 바이러스 감염은 IFN-γ의 분비 또는 GAIT 복합체의 표적인 Cp의 발현 억제에 영향을 미치지 않았다 (도 65 내지 도 67). 이소성으로 발현된 EPRS의 인산화모방 (phosphomimetics)을 활용한 종래 연구 결과에서는, Ser886 및 Ser999의 인산화가 MSC로부터 EPRS의 방출을 유도한다고 보고된 바 있다. 특히, 스트렙-태깅 EPRS 모노-인산화모방, S990D는 MSC 구성요소인 KRS, AIMP3 및 MRS와의 상호작용이 결여되어, MSC로부터 유도성으로 방출되었다 (도 68).
종합하면, 상기 결과들은 바이러스에 의해 유도되는 EPRS Ser990의 인산화가 MSC로부터 EPRS의 방출을 유도하여, IFN-γ에 의해 활성화되는 GAIT 번역 침묵 경로에서의 역할과는 구별되는 기능을 수행하게 한다는 것을 의미한다.
실험예 4: EPRS 및 PCBP2의 상호작용 확인
바이러스가 세포 내로 들어가면, 세포 내 센서 RIG-I이 활성화된다. 그 다음, RIG-I은 MAVS와 상호작용하여 I 형 IFN의 생산으로 끝나는 신호전달 캐스케이드를 유발하게 된다. 상기 신호전달 캐스케이드를 분석한 결과, EPRS는 용량-의존적 방식으로 RIG-I-, MDA5-, poly(I:C)-, 및 MAVS-매개 IFN-β 프로모터 활성을 증가시키는 것을 확인하였다 (도 69). 그러나, TRAF3, TBK1, 또는 IRF7의 존재 하에서는 IFN-β 프로모터의 유의적인 활성은 관찰되지 않았다 (도 70). 상기 결과들은, EPRS가 I 형 IFN 경로의 양성 조절자로서, MAVS의 하류 및 TRF3 신호전달 축의 상류로 작용한다는 것을 의미한다.
바이러스에 감염된 동안 MAVS 신호전달을 조절하는, EPRS-상호작용 분자를 규명하기 위해, PR8에 감염된 세포로부터 분리된 스트렙-EPRS-특이적 복합체를 이용하여 단백질 분석을 수행하였다 (도 71). 그 결과, MSC 단백질은 존재하였으나, GAIT 단백질 (NSAP, GAPDH 및 L13a)은 존재하지 않았다. 특히, EPRS는 바이러스 감염 시 MAVS의 유비퀴틴화 및 분해를 유발하는 것으로 알려져 있는 PCBP2와 상호작용하였다. 내인적 공동-IP 분석을 통해, RAW264.7 및 U937 세포에서 바이러스로 유도된 EPRS 및 PCBP2의 상호작용을 확인하였고, 상기 두 단백질의 상호작용은 시간에 따라 증가하였다 (도 72 및 도 73). 나아가, 기존 연구 결과에서도 보고된 바와 같이, PCBP2는 바이러스 감염 시 핵으로부터 세포질로 이동하여, EPRS와 같은 위치에 존재하는 것을 확인하였다 (도 74).
다음으로, PCBP2와 상호작용하는 EPRS 영역을 규명하기 위해, 다양한 EPRS 도메인을 포함하는 플라스미드 컨스트럭트를 제조하였다 (도 75). EPRS의 전장 아미노산 서열은 서열번호 63으로 표시되는 1512 개의 서열이다. 그 다음 공동-IP를 수행하여 각 EPRS 영역 및 PCBP2의 상호작용을 확인하였다. 그 결과, GST-유사 도메인 및 링커 영역 L1 (aa 1-196)을 함유하는 EPRS의 N-말단 영역이 PCBP2와의 상호작용에 결정적이며, 상기 영역은 전장 EPRS에 의해 유도되는 것과 유사한 수준으로 IFN-β 프로모터 활성을 유도하는 것을 확인하였다. 그러나, GST-유사 도메인 단독 (aa 1-168)으로는 항바이러스 활성을 유도하지 못했다 (도 75 내지 도 79). 상기 결과들은 GST-유사 도메인 및 ERS 사이의 L1 영역 (aa 168-196)이 PCBP2와의 상호작용 및 항바이러스 반응에 필수적이라는 것을 의미한다. 본 발명자들은 L1-결손 변이가 PCBP2와 상호작용하지 않고 IFN-β를 유도하는 능력이 감소함을 확인하여, L1 영역 (aa 168-196) 및 L1 영역을 포함하는 단편 (aa 168-269)이 항바이러스 효과를 가짐을 확인하였다 (도 80 및 도 81).
한편, 본 발명자들은 PCBP2의 링커 영역이 아닌 N-말단의 KH1 도메인 (aa 1-81)이 EPRS 결합에 충분하다는 것을 확인하였다 (도 82 및 도 83). 시험관 내 침강 분석을 통해, PCBP2 KH1은 EPRS의 GST 및 L1 영역과 특이적으로 상호작용하며, GST-유사 영역 단독 (aa 1-168)으로는 상호작용하지 못한다는 것을 확인하였다 (도 84 내지 도 86). 종합하면, 상기 데이터는 Ser990 인산화로 유도된 MSC로부터의 EPRS의 방출은 이의 PCBP2와의 상호작용을 촉진하며, 이에 따라 MAVS 신호전달을 조절할 수 있음을 시사하는 것이다.
실험예 5: MAVS의 PCBP2-매개 유비퀴틴화에 대한 EPRS의 보호 효과 확인
PCBP2는 바이러스 감염에 따라 유도되어 MAVS와 상호작용함으로써 프로테아솜 분해로 MAVS 유비퀴틴화를 야기하는 것으로 보고된바 있다. 따라서, 본 발명자들은 EPRS가 PCBP2-매개 유비퀴틴화를 막아 MAVS를 보호할 것이라고 가설을 세웠다. 이에, PCBP2와 MAVS의 상호작용을 재평가하여, MAVS가 EPRS에 결합하는 도메인인 PCBP2 KH1 도메인과 특이적으로 상호작용하는 것을 확인하였다 (도 87 내지 도 90). EPRS와 MAVS가 동일한 KH1 도메인을 표적으로 하는 것은 EPRS가 MAVS와 경쟁적으로 작용하여, MAVS와 PCBP2와의 상호작용을 막을 수 있다는 것을 시사한다.
실제로, PCBP2와 MAVS의 상호작용은 EPRS 존재 하에 현저히 감소하였다 (도 91). 그러나, EPRS는 PCBP2가 ITCH E3 리가제 (ligase)에 결합하는 것을 방해하지는 못했는데 (도 92), 이는 EPRS가 MAVS가 PCBP2 KH1에 결합하는 것에 특이적으로 경쟁적으로 작용한다는 것을 의미하는 것이다. 상기 결과들은 PR8 감염 후에 MAVS에 결합하는 PCBP2가 점차적으로 감소하나, MAVS와 EPRS의 상호작용은 현저히 증가한다는 것을 보여주는 내인성 상호작용 분석을 통해 확인된 것이다. 이러한 결과는 바이러스에 감염된 세포에서 EPRS가 PCBP2가 MAVS에 내인적으로 결합하는데 방해하는 역할을 한다는 것을 의미하는 것이다 (도 93).
PCBP2는 ITCHE3 리가제를 끌어들여 MAVS의 유비퀴틴 (Ub)-매개 분해를 촉진시킨다. 따라서, 본 발명자들은 293T 세포에서 외인적으로 발현되는 MAVS-FLAG가 ITCH에 의해 유비퀴틴화되며, PCBP2의 첨가에 의해 상기 반응이 현저하게 증가되는 것을 확인하였다 (도 94). 그러나, EPRS는 용량-의존적으로 PCBP2-매개 MAVS 유비퀴틴화를 억제하였다 (도 94). 유사하게, PCBP2에 의해 내인적 MAVS 유비퀴틴화는 현저하게 향상되었으나, EPRS의 존재 하에서는 상당히 감소하는 것을 확인하였다 (도 95). 상기 유비퀴틴화 분석 결과와 같이, 외인성 (도 96) 및 내인성 (도 97) MAVS는 PCBP2에 의해 분해되었으나, EPRS의 첨가에 의해 회복되는 것을 확인하였다.
마지막으로, 정제된 EPRS를 재구성된 무세포 (cell-free) 시스템에 첨가한 결과, PCBP2-유도 MAVS 유비퀴틴화가 현저히 검소하는 것을 확인하였다 (도 98). 따라서, EPRS는 MAVS의 PCBP2-매개 음성 조절을 특이적으로 막아, 강력한 항바이러스 면역 반응을 유지시킬 수 있다.
실험예 6: EPRS 유래 펩타이드의 항바이러스 활성
실험예 6-1: Tat- Epep의 시험관 내 및 생체 내 항바이러스 활성
지금까지, 본 발명자들은 항바이러스 면역 반응에서 EPRS가 MAVS의 PCBP2-매개 분해를 억제하며, 특히 EPRS L1 영역 (aa 168-196)이 PCBP2 상호작용에 필수적이고 항바이러스 I 형 IFN 신호전달을 향상시키는 역할을 한다는 것을 확인하였다. 이에, 다음으로 본 발명자들은 HIV-1 Tat 단백질 변환 도메인 (transduction domain)과 EPRS L1 펩타이드를 융합한 세포-투과성 펩타이드 (이하, 'Tat-Epep'로 명명, 서열번호 61)를 제조하였고, 이의 항바이러스 활성을 조사하였다. Tat-Epep는 PCBP2-매개 내인성 MAVS 유비퀴틴화를 억제시켰고 (도 99), MAVS의 세포 내 수준을 회복시켰다 (도 100). Tat-Epep는 또한 바이러스 감염 세포에서 IFN-β 및 IL-6의 생산을 증가시켰고 (도 101), RAW264.7 세포에서 용량-의존적으로 VSV 복제를 감소시켰다 (도 102 및 도 103). 그러나, Tat-Epep는 HSV에 감염된 RAW264.7 세포에서 항바이러스 활성을 나타내지 않았는데 (도 104 내지 도 106), 이는 Tat-Epep가 RNA 바이러스 감염에 특이적이라는 것을 의미하는 것이다. Tat-Epep는 시험한 농도 범위에서 RAW264.7 또는 293T 세포의 생존성에 영향을 미치지 않았는데, 이는 바이러스 역가 감소가 펩타이드-매개 세포독성에 의한 것은 아니라는 것을 의미한다 (도 107 및 도 108). 상기 결과는 Tat-Epep가 MAVS 생존성 및 I 형 IFN 생산을 증가시키는 항-RNA 바이러스 제제로서 우수한 효과가 있음을 시사하는 것이다.
생체 내에서 Tat-Epep의 항바이러스 효과를 더 조사하기 위해, 본 발명자들은 마우스에 VSV-인디아나 균주를 정맥 투여하였다. 투여 후, Tat 또는 Tat-Epep를 마우스 복강 내에 3 일 동안 매일 투여하였다. 그 결과, Tat-Epep를 처리한 마우스는 Tat-tag를 처리한 마우스에 비해 뇌 조직에서 바이러스 역가가 눈에 띄게 감소되었다 (도 109). 상기 데이터는 Tat-Epep가 항-RNA 바이러스 제제로 우수한 효과가 있음을 추가적으로 입증하는 것이다.
실험예 6-2: New Tat- Epep의 시험관 내 및 생체 내 항바이러스 활성
본 발명자들은 상기 Tat-Epep의 EPRS L1 펩타이드 부분을 21 머 (aa 166-186)로 더 한정하여 신규 펩타이드 (이하, 'New Tat-Epep'로 명명)를 제조하였다. New Tat-Epep는 YGRKKRRQRRR-GG-KWDVSTTKARVAPEKKQDVGK (서열번호 64)의 아미노산 서열을 갖는다. 이에 대하여, 실시예 6-1과 동일한 방법으로 VSV를 정맥 투여한 마우스에 처리 (TAT-대조군: 100 ㎍, 7 마리; New Tat-Epep: 200 ㎍, 3 마리)한 결과, Tat-Epep의 경우와 마찬가지로 마우스의 뇌에서 VSV 바이러스의 역가를 감소시키는 것을 확인하였다 (도 110). 나아가, New Tat-Epep를 VSV-GAP 바이러스에 감염된 RAW264.7 세포에 처리하였을 때, 항바이러스 사이토카인인 IFN-β 및 IL-6의 분비를 Tat-Epep에 비해 2 내지 3 배 이상 촉진시키는 것을 확인하였다 (도 111 내지 도 113). 상기 결과를 통해, New Tat-Epep 역시 항-RNA 바이러스 제제로 우수한 효과가 있음을 알 수 있었다.
이를 통해, EPRS L1 (aa 168-196)에서 aa 187-196 부분이 없는, aa 168-186의 단편만으로도 우수한 항-RNA 바이러스 활성을 가짐을 알 수 있었다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (12)

  1. EPRS (glutamyl-prolyl-tRNA synthetase) 단백질 또는 이의 단편을 포함하며, 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것인, 항RNA 바이러스용 조성물.
  2. 제1항에 있어서, 상기 EPRS 단백질의 단편은 서열번호 63의 1 내지 196 번째 아미노산 서열, 1 내지 269 번째 아미노산 서열, 1 내지 457 번째 아미노산 서열, 1 내지 506 번째 아미노산 서열, 1 내지 682 번째 아미노산 서열, 168 내지 506 번째 아미노산 서열, 168 내지 269 번째 아미노산 서열, 및 168 내지 196 번째 아미노산 서열로 이루어진 군에서 선택된 아미노산 서열을 포함하는 것인, 항RNA 바이러스용 조성물.
  3. 제1항에 있어서, 상기 RNA 바이러스는 아말가비리대 (Amalgaviridae), 비르나비리대 (Birnaviridae), 크리소비리대 (Chrysoviridae), 시스토비리대 (Cystoviridae), 엔도르나비리대 (Endornaviridae), 하이포비리대 (Hypoviridae), 메가비르나비리대 (Megabirnaviridae), 파르티티비리대 (Partitiviridae), 피코비르나비리대 (Picobirnaviridae), 레오비리대 (Reoviridae), 토티비리대 (Totiviridae), 콰드리비리대 (Quadriviridae), 아르테리비리대 (Arteriviridae), 코로나비리대 (Coronaviridae), 메소니비리대 (Mesoniviridae), 로니비리대 (Roniviridae), 디시스트로비리대 (Dicistroviridae), 이플라비리대 (Iflaviridae), 마르나비리대 (Marnaviridae), 피코르나비리대 (Picornaviridae), 세코비리대 (Secoviridae), 알파플렉시비리대 (Alphaflexiviridae), 베타플렉시비리대 (Betaflexiviridae), 감마플렉시비리대 (Gammaflexiviridae), 티모비리대 (Tymoviridae), 보르나비리대 (Bornaviridae), 필로비리대 (Filoviridae), 파라믹소비리대 (Paramyxoviridae), 랍도비리대 (Rhabdoviridae), 니아미비리대 (Nyamiviridae), 칼리시비리대 (Caliciviridae), 플라비비리대 (Flaviviridae), 루테오비리대 (Luteoviridae), 토가비리대 (Togaviridae), 뉴모바라대 (Pneumoviridae), 아레나비리대 (Arenaviridae), 델타비리대 (Deltavirus), 및 오르토믹스비리대 (Orthomyxoviridae) 바이러스로 이루어진 군에서 선택되는 하나 이상인 것인, 항RNA 바이러스용 조성물.
  4. 제1항에 있어서, 상기 EPRS 단백질 또는 이의 단편은, N-말단, C-말단, 또는 양 말단에 세포 투과성 펩타이드를 추가로 포함하는 것인, 항RNA 바이러스용 조성물.
  5. 제4항에 있어서, 상기 세포 투과성 펩타이드는 Tat, 안테나페디아 (Antennapedia), 트랜스포탄 (Transportan), VP22, Hph-1, R11(R9), 시그널 서열 기반 펩타이드, 및 양친매성 (Amphipathic) 펩타이드로 이루어진 군에서 선택되는 하나 이상인 것인, 항RNA 바이러스용 조성물.
  6. 제1항에 있어서, 상기 EPRS 단백질 또는 이의 단편은 PCBP2에 결합하여 MAVS와 PCBP2의 결합을 억제하는 것인, 항RNA 바이러스용 조성물.
  7. 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 항RNA 바이러스용 조성물은 약학 조성물, 의약외품 조성물, 식품 조성물, 화장료 조성물 또는 사료 조성물로 이용되는 것인, 항RNA 바이러스용 조성물.
  8. 항RNA 바이러스 활성을 가지는 EPRS 단백질 또는 이의 단편으로서, 상기 EPRS 단백질의 단편은 서열번호 63의 168 내지 186 번째 아미노산 서열을 포함하는 것인, 단백질 또는 이의 단편.
  9. 제8항의 단백질 또는 이의 단편을 코딩하는 폴리뉴클레오티드.
  10. 제9항의 폴리뉴클레오티드를 포함하는 벡터.
  11. 제9항의 폴리뉴클레오티드 또는 제10항의 벡터를 포함하는, 형질전환체.
  12. 제1항 내지 제6항 중 어느 한 항의 항RNA 바이러스용 조성물을 개체에 투여하는 단계를 포함하는, RNA 바이러스 감염 질환의 예방 또는 치료 방법.
PCT/KR2017/009224 2016-08-23 2017-08-23 Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물 WO2018038539A2 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP17843959.2A EP3505624A4 (en) 2016-08-23 2017-08-23 COMPOSITION FOR ANTI-RNA VIRUS WITH EPRS PROTEIN OR FRAGMENT THEREOF
JP2019532908A JP6901564B2 (ja) 2016-08-23 2017-08-23 Ｅｐｒｓタンパク質またはその断片を含む抗ｒｎａウイルス用組成物
CN201780065721.2A CN110234757B (zh) 2016-08-23 2017-08-23 包含eprs蛋白或其片段的抗rna病毒组合物
US16/283,121 US11173192B2 (en) 2016-08-23 2019-02-22 Anti-RNA virus composition comprising EPRS protein or fragment thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2016-0107037 2016-08-23
KR20160107037 2016-08-23

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/283,121 Continuation-In-Part US11173192B2 (en) 2016-08-23 2019-02-22 Anti-RNA virus composition comprising EPRS protein or fragment thereof

Publications (2)

Publication Number Publication Date
WO2018038539A2 true WO2018038539A2 (ko) 2018-03-01
WO2018038539A3 WO2018038539A3 (ko) 2018-04-12

Family

ID=61246186

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2017/009224 WO2018038539A2 (ko) 2016-08-23 2017-08-23 Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물

Country Status (6)

Country Link
US (1) US11173192B2 (ko)
EP (1) EP3505624A4 (ko)
JP (1) JP6901564B2 (ko)
KR (1) KR101853403B1 (ko)
CN (1) CN110234757B (ko)
WO (1) WO2018038539A2 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112322589A (zh) * 2020-11-24 2021-02-05 吉林省农业科学院 一种提高球孢白僵菌菌丝生长速度的产黄青霉科双链rna真菌病毒

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7248971B1 (en) * 2000-11-14 2007-07-24 International Business Machines Corporation Method and apparatus for discovering patterns in a set of sequences
WO2003106479A2 (en) 2002-06-17 2003-12-24 Parker Hughes Institute Pokeweed antiviral protein polypeptides with antiviral activity
ES2552773T3 (es) * 2009-02-27 2015-12-02 Atyr Pharma, Inc. Motivos estructurales de polipéptidos asociados con la actividad de señalización celular
CN102858985A (zh) * 2009-07-24 2013-01-02 西格马-奥尔德里奇有限责任公司 基因组编辑方法
AU2011248100B2 (en) * 2010-05-04 2017-01-19 Pangu Biopharma Limited Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of glutamyl-prolyl-tRNA synthetases

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
CELL, vol. 124, 2006, pages 783 - 801
F.M. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", JOHN WILEY & SONS, INC.
J. SAMBROOK ET AL.: "A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS, article "Molecular Cloning"
See also references of EP3505624A4
TRENDS BIOCHEM. SCI, vol. 34, 2009, pages 324 - 331
TRENDS BIOCHEM. SCI, vol. 35, 2007, pages 158 - 164

Also Published As

Publication number Publication date
KR101853403B1 (ko) 2018-06-14
EP3505624A2 (en) 2019-07-03
CN110234757A (zh) 2019-09-13
JP6901564B2 (ja) 2021-07-14
KR20180022613A (ko) 2018-03-06
WO2018038539A3 (ko) 2018-04-12
US11173192B2 (en) 2021-11-16
CN110234757B (zh) 2023-05-16
EP3505624A4 (en) 2020-07-08
JP2019535803A (ja) 2019-12-12
US20190321455A1 (en) 2019-10-24

Similar Documents

Publication Publication Date Title
WO2017078440A1 (ko) 신경세포 손실 예방 및 재생 효능을 가지는 펩티드 및 이를 포함하는 조성물
WO2017030292A1 (ko) P62 zz 도메인에 결합하는 리간드 또는 아르기닌화된 bip에 의해 매개되는 오토파지 활성을 통한 신경변성 질환 예방 및 치료
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
WO2017034335A1 (en) Improved cell-permeable (icp)-socs3 recombinant protein and uses thereof
WO2014035179A1 (ko) 미토콘드리아 타겟팅 펩타이드
WO2018208011A2 (ko) β-아밀로이드 단백질의 응집을 억제하는 생체친화적 펩타이드
WO2017003267A1 (ko) 항바이러스 활성 효능을 가지는 펩티드 및 이를 포함하는 조성물
WO2017007162A1 (ko) 지방조직 중성지질 분해 효능을 가지는 아젤라산 조성물
WO2011052883A2 (ko) Ｓｏｃｓ２ 유전자의 발현을 조절하여 자연 살해 세포를 활성화시키는 방법
WO2015037778A1 (ko) 리그난 화합물을 유효 성분으로 포함하는 암의 예방 또는 치료용 조성물
WO2019045477A1 (ko) 비멘틴 유래 펩타이드에 특이적으로 결합하는 물질을 포함하는 피부질환 예방 및 치료용 조성물
WO2018038539A2 (ko) Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물
WO2017043920A1 (ko) 피부 투과성 펩티드 및 그 이용방법
WO2021034101A1 (ko) 신규 인터페론 람다 변이체 및 이의 제조방법
WO2018080146A2 (ko) 단백질 탈 인산화 효소 1 억제 펩타이드를 포함하는 혈관 질환 치료용 조성물
WO2016003158A2 (ko) DX2 단백질과 p14/ARF 단백질 간의 결합을 억제하는 신규 화합물 및 상기 화합물을 유효성분으로 함유하는 암질환 치료 또는 예방용 약학조성물
WO2015147369A1 (ko) Sirt2 억제제를 포함하는 약학적 조성물
WO2017213435A1 (ko) Slit-robo 시스템을 이용한 근감소증 예방 또는 치료용 조성물
WO2020122391A1 (ko) 호모해링토닌을 유효성분으로 함유하는 세포노화 관련 질환 예방 또는 치료용 조성물
WO2022260367A1 (ko) 급성 염증성 질환 예방 또는 치료용 비바이러스성 유전자/전달체 복합체
WO2014157965A1 (ko) P34의 발현 억제제 또는 활성 억제제를 유효성분으로 포함하는 암의 치료 또는 전이 억제용 조성물
WO2014182078A1 (ko) 장 면역활성 조절용 조성물 및 이의 용도
WO2022014975A1 (ko) Bi-1 길항제 및 그의 용도
WO2021015419A1 (ko) 인산화된 베타-카테닌에 특이적으로 결합하는 항체 및 이의 용도
WO2011155643A1 (ko) 포그 ２ 다섯 번째 징크 핑거 도메인을 포함하는 포스파티딜이노시톨３키나아제 활성 조절제

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17843959

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2019532908

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017843959

Country of ref document: EP

Effective date: 20190325