WO2018010789A1 - Novel antibodies specifically binding to zika virus epitopes and uses thereof - Google Patents
Novel antibodies specifically binding to zika virus epitopes and uses thereof Download PDFInfo
- Publication number
- WO2018010789A1 WO2018010789A1 PCT/EP2016/066684 EP2016066684W WO2018010789A1 WO 2018010789 A1 WO2018010789 A1 WO 2018010789A1 EP 2016066684 W EP2016066684 W EP 2016066684W WO 2018010789 A1 WO2018010789 A1 WO 2018010789A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- antigen binding
- binding fragment
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/116—Togaviridae (F); Matonaviridae (F); Flaviviridae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/183—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus) or border disease virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to antibodies, and antigen binding fragments thereof, that bind specifically to Zika virus (ZIKV) epitopes.
- ZIKV Zika virus
- Such antibodies (i) potently neutralize infection of Zika virus (ZIKV) or (ii) are directed against NS1 ZIKV and can be used as diagnostics.
- the invention also relates to antigenic sites to which the antibodies and antigen binding fragments bind to, as well as to nucleic acids that encode the antibodies and immortalized B cells that produce such antibodies and antibody fragments.
- the invention relates to the use of the antibodies and antibody fragments of the invention in screening methods as wel l as in the diagnosis, prevention and treatment of ZIKV infection.
- Zika virus a mosquito-borne flavivirus
- ZIKV Zika virus
- Trans. R. Soc. Trop. Med. Hyg. 46, 509-520 (1 952) and the first human infection was reported in Nigeria in 1 954 F. N. Macnamara, Zika virus: a report on three cases of human infection during an epidemic of jaundice in Nigeria. Trans. R. Soc. Trop. Med. Hyg. 48, 1 39-145 (1 954)).
- ZIKV belongs to the genus flavivirus, which also includes the West Nile virus, dengue virus, tick-borne encephalitis virus, yellow fever virus, and several other viruses which may cause encephalitis. Flaviviruses are enveloped, with icosahedral and spherical geometries. The diameter is around 50 nm. Genomes are l inear positive-sense RNA and non-segmented, around 1 0-1 1 kb in length.
- flaviviruses encodes 3 structural proteins (Capsid, prM, and Envelope) and 8 non-structural proteins (NS1 , NS2A, NS2 B, NS3, NS4A, NS4B, NS5 and NS5B).
- flavivirus envelope (E) proteins mediate fusion and are the main target of neutralizing antibodies
- the non-structural protein 1 (NS1 ) is secreted by infected cells and is involved in immune evasion and pathogenesis (D. A. Mulier, P. R. Young, The flavivirus NS1 protein: molecular and structural biology, immunology, role in pathogenesis and application as a diagnostic biomarker. Antiviral Res. 98, 1 92-208 (201 3)).
- ZIKV NS1 revealed conserved features with NS1 of other flaviviruses although with different electrostatic characteristics ( J. Kim et a!, Zika virus NS1 structure reveals diversity of electrostatic surfaces among flaviviruses, 1 -6 (201 6)).
- a phenomenon that is characteristic of certain flaviviruses is the disease-enhancing activity of cross-reactive antibodies elicited by previous infection by heterologous viruses.
- DEV Dengue virus
- 4 serotypes there is epidemiological evidence that a primary infection protects from reinfection with the same serotype, but represents a risk factor for the development of severe disease upon reinfection with a different serotype (S. B. Haistead, Dengue Antibody-Dependent Enhancement: Knowns and Unknowns. Microbiol Spectr. 2, 249-271 (2014)).
- the exacerbated disease is triggered by E and prM-specific antibodies that fail to neutralize the incoming virus but instead enhance its capture by Fc receptor-expressing (FcR + ) cells, leading to enhanced viral replication and activation of cross- reactive memory T cells.
- FcR + Fc receptor-expressing
- the resulting cytokine storm is thought to be the basis of the most severe form of disease known as dengue hemorragic fever/dengue shock syndrome (S. B. Haistead, Neutralization and antibody-dependent enhancement of dengue viruses. Adv Virus Res. 60, 421 -467 (2003); G. Screaton, J. Mongkolsapaya, S. Yacoub, C. Roberts, New insights into the immunopathology and control of dengue virus infection. Nat Rev Immunol.
- an object of the present invention to provide novel antibodies, which specifically bind to ZIKV epitopes. It is also an object of the present invention to provide potently neutralizing anti-ZIKV antibodies. Such antibodies do preferably not contribute to antibody-dependent enhancement (ADE) of Zika virus infection. It is also an object of the present invention to provide highly specific anti-ZIKV antibodies useful in diagnosis and testing of ZIKV infection and diagnosis methods using such antibodies.
- ADE antibody-dependent enhancement
- disease as used herein is intended to be general ly synonymous, and is used interchangeably with, the terms “disorder” and “condition” (as in medical condition), in that all reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the human or animal to have a reduced duration or quality of life.
- treatment of a subject or patient is intended to include prevention, prophylaxis, attenuation, amelioration and therapy.
- subject or patient are used interchangeably herein to mean all mammals including humans. Examples of subjects include humans, cows, dogs, cats, horses, goats, sheep, pigs, and rabbits. In one embodiment, the patient is a human.
- antibody fragment As used herein, the terms “antigen binding fragment,” “fragment,” and “antibody fragment” are used interchangeably to refer to any fragment of an antibody of the invention that retains the antigen-binding activity of the antibody. Examples of antibody fragments include, but are not limited to, a single chain antibody, Fab, Fab', F(ab') 2 , Fv or scFv. Further, the term “antibody” as used herein includes both antibodies and antigen binding fragments thereof.
- antibody encompasses various forms of antibodies including, without being limited to, whole antibodies, antibody fragments, in particular antigen binding fragments, human antibodies, chimeric antibodies, humanized antibodies, recombinant antibodies and genetically engineered antibodies (variant or mutant antibodies) as long as the characteristic properties according to the invention are retained.
- Human antibodies and monoclonal antibodies are preferred and especially preferred are human monoclonal antibodies, in particular as recombinant human monoclonal antibodies.
- Human antibodies are well-known in the state of the art (van Dijk, M. A., and van de Winkel, J. G., Curr. Opin. Chem. Biol. 5 (2001 ) 368-374). Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-l ine mutant mice wi ll result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al., Proc. Natl. Acad. Sci.
- human monoclonal antibodies are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1 985); and Boerner, P., et al., /. Immunol. 1 47 (1 991 ) 86-95).
- human monoclonal antibodies are prepared by using improved EBV-B cel l immortalization as described in Traggiai E, Becker S, Subbarao K, Kolesnikova L, Uematsu Y, Gismondo MR, Murphy BR, Rappuoli R, Lanzavecchia A. (2004): An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus.
- variable region denotes each of the pair of l ight and heavy chains which is involved directly in binding the antibody to the antigen.
- Antibodies of the invention can be of any isotype ⁇ e.g., IgA, IgG, IgM i.e. an ⁇ , ⁇ or ⁇ heavy chain), but will preferably be IgG. Within the IgG isotype, antibodies may be IgGI , lgG2, lgG3 or lgG4 subclass, whereby lgG1 is preferred. Antibodies of the invention may have a ⁇ or a ⁇ light chain. Preferably, the antibody according to the present invention, or the antigen binding fragment thereof, is a purified antibody, a single chain antibody, Fab, Fab', F(ab')2, Fv or scFv.
- the antibodies of the invention may thus preferably be human antibodies, monoclonal antibodies, human monoclonal antibodies, recombinant antibodies or purified antibodies.
- the invention also provides fragments of the antibodies of the invention, particularly fragments that retain the antigen-binding activity of the antibodies. Such fragments include, but are not limited to, single chain antibodies, Fab, Fab', F(ab')2, Fv or scFv.
- antibody or “antibody of the invention” includes all categories of antibodies, namely, antigen binding fragment(s), antibody fragment(s), variant(s) and derivative(s) of antibodies.
- Fragments of the antibodies of the invention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- Antibody "fragments” include Fab, Fab', F(ab')2 and Fv fragments.
- the invention also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody of the invention.
- the invention includes a scFv comprising the CDRs from an antibody of the invention.
- heavy or light chain monomers and dimers single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, e.g., single chain Fv in which the heavy and light chain variable domains are joined by a peptide linker.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody.”
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- the sequences of the invention may be a component of multispecific molecules in which the sequences of the invention target the epitopes of the invention and other regions of the molecule bind to other targets.
- Exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1 126-1 1 36).
- Antibodies according to the present invention may be provided in purified form. Typically, the antibody will be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies according to the present invention may be immunogenic in human and/or in non-human (or heterologous) hosts e.g., in mice.
- the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- Antibodies of the invention for human use include those that cannot be easi ly isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
- neutralizing antibody is one that can neutralize, i.e., prevent, inhibit, reduce, impede or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host.
- neutralizing antibody and “an antibody that neutralizes” or “antibodies that neutralize” are used interchangeably herein. These antibodies can be used alone, or in combination, as prophylactic or therapeutic agents upon appropriate formulation, in association with active vaccination, as a diagnostic tool, or as a production tool as described herein.
- a dose which is expressed as [g, mg, or other unit]/kg (or g, mg etc.) usually refers to [g, mg, or other unit] "per kg (or g, mg etc.) bodyweight", even if the term “bodyweight” is not explicitly mentioned.
- the term “specifically binding” and similar reference does not encompass non-specific sticking.
- the term "vaccine” as used herein is typically understood to be a prophylactic or therapeutic material providing at least one antigen, preferably an immunogen.
- the antigen or immunogen may be derived from any material that is suitable for vaccination.
- the antigen or immunogen may be derived from a pathogen, such as from bacteria or virus particles etc., or from a tumor or cancerous tissue.
- the antigen or immunogen stimulates the body's adaptive immune system to provide an adaptive immune response.
- an "antigen” or an “immunogen” refers typically to a substance which may be recognized by the immune system, preferably by the adaptive immune system, and which is capable of triggering an antigen-specific immune response, e.g. by formation of antibodies and/or antigen-specific T cells as part of an adaptive immune response.
- an antigen may be or may comprise a peptide or protein which may be presented by the MHC to T-cells.
- sequence variant refers to any alteration in a reference sequence, whereby a reference sequence is any of the sequences listed in the "Tables of Sequences and SEQ ID Numbers" (sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 402.
- sequence variant includes nucleotide sequence variants and amino acid sequence variants.
- sequence variants referred to herein are in particular functional sequence variants, i.e. sequence variants maintaining the biological function of, for example, the antibody.
- such a maintained biological function is preferably the neutralization of ZIKV infection, the binding of the antibody to the ZIKV E protein and/or the binding of the antibody to the ZIKV NS1 protein.
- Preferred sequence variants are thus functional sequence variants having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to a reference sequence.
- sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity
- sequence variant means (i) that the sequence variant is functional as described herein and (ii) the higher the % sequence identity, the more preferred the sequence variant.
- the phrase "functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity” means in particular that the functional sequence variant has at least 70% sequence identity, preferably at least 75% sequence identity, preferably at least 80% sequence identity, more preferably at least 85% sequence identity, more preferably at least 88% sequence identity, even more preferably at least 90 % sequence identity, even more preferably at least 92% sequence identity, still more preferably at least 95% sequence identity, still more preferably at least 96% sequence identity, particularly preferably at least 97% sequence identity, particularly preferably at least 98% sequence identity and most preferably at least 99% sequence identity to the respective reference sequence.
- sequence variant includes in particular such variants that comprise mutations and/or substitutions in comparison to the reference sequence.
- exemplary variants of an Fc moiety sequence include, but are not limited to, those that have an L to A substitution at position CH2 4, CH2 5, or both.
- nucleotide sequence variant has an altered sequence in which one or more of the nucleotides in the reference sequence is deleted, or substituted, or one or more nucleotides are inserted into the sequence of the reference nucleotide sequence. Nucleotides are referred to herein by the standard one-letter designation (A, C, G, or T). Due to the degeneracy of the genetic code, a "nucleotide sequence variant" can either result in a change in the respective reference amino acid sequence, i.e. in an "amino acid sequence variant" or not.
- Preferred sequence variants are such nucleotide sequence variants, which do not result in amino acid sequence variants (si lent mutations), but other non-silent mutations are within the scope as well, in particular mutant nucleotide sequences, which result in an amino acid sequence, which is at least 80%, preferably at least 90 %, more preferably at least 95% sequence identical to the reference sequence.
- An "amino acid sequence variant” has an altered sequence in which one or more of the amino acids in the reference sequence is deleted or substituted, or one or more amino acids are inserted into the sequence of the reference amino acid sequence.
- the amino acid sequence variant has an amino acid sequence which is at least 80% identical to the reference sequence, preferably, at least 90% identical, more preferably at least 95% identical, most preferably at least 99% identical to the reference sequence.
- Variant sequences which are at least 90% identical have no more than 1 0 alterations, i.e. any combination of deletions, insertions or substitutions, per 1 00 amino acids of the reference sequence.
- conservative amino acid substitutions involve substitution of one aliphatic or hydrophobic amino acids, e.g. alanine, valine, leucine and isoleucine, with another; substitution of one hydoxyl-containing amino acid, e.g. serine and threonine, with another; substitution of one acidic residue, e.g. glutamic acid or aspartic acid, with another; replacement of one amide-containing residue, e.g.
- asparagine and glutamine with another; replacement of one aromatic residue, e.g. phenylalanine and tyrosine, with another; replacement of one basic residue, e.g. lysine, arginine and histidine, with another; and replacement of one small amino acid, e.g., alanine, serine, threonine, methionine, and glycine, with another.
- one aromatic residue e.g. phenylalanine and tyrosine
- basic residue e.g. lysine, arginine and histidine
- replacement of one small amino acid e.g., alanine, serine, threonine, methionine, and glycine
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions rangi ng in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include the fusion to the N- or C-terminus of an amino acid sequence to a reporter molecule or an enzyme.
- the alterations in the sequence variants do not abolish the functionality of the respective reference sequence, in the present case, e.g., the functionality of a sequence of an antibody, or antigen binding fragment thereof, to bind to the same epitope and/or to sufficiently neutralize infection of ZIKV.
- nucleic acid sequence or an amino acid sequence "derived from” a designated nucleic acid, peptide, polypeptide or protein refers to the origin of the nucleic acid, peptide, polypeptide or protein.
- nucleic acid sequence or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, from which it is derived, whereby "essentially identical" includes sequence variants as defined above.
- the nucleic acid sequence or amino acid sequence which is derived from a particular peptide or protein is derived from the corresponding domain in the particular peptide or protein.
- corresponding refers in particular to the same functionality.
- an "extracellular domain” corresponds to another "extracellular domain” (of another protein), or a “transmembrane domain” corresponds to another "transmembrane domain” (of another protein).
- sequences "derived from” other sequence are usually easily identifiable to one of ordinary skill in the art as having its origin in the sequence.
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be identical to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may also have one or more mutations relative to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived), in particular a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be a functional sequence variant as described above of the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- mutation relates to a change in the nucleic acid sequence and/or in the amino acid sequence in comparison to a reference sequence, e.g. a corresponding genomic sequence.
- a mutation e.g. in comparison to a genomic sequence, may be, for example, a (naturally occurring) somatic mutation, a spontaneous mutation, an induced mutation, e.g.
- mutation or “mutating” shall be understood to also include physically making a mutation, e.g. in a nucleic acid sequence or in an amino acid sequence.
- a mutation includes substitution, deletion and insertion of one or more nucleotides or amino acids as well as inversion of several successive nucleotides or amino acids.
- a mutation may be introduced into the nucleotide sequence encoding said amino acid sequence in order to express a (recombinant) mutated polypeptide.
- a mutation may be achieved e.g., by altering, e.g., by site-directed mutagenesis, a codon of a nucleic acid molecule encoding one amino acid to result in a codon encoding a different amino acid, or by synthesizing a sequence variant, e.g., by knowing the nucleotide sequence of a nucleic acid molecule encoding a polypeptide and by designing the synthesis of a nucleic acid molecule comprising a nucleotide sequence encoding a variant of the polypeptide without the need for mutating one or more nucleotides of a nucleic acid molecule.
- Antibodies potently neutralizing Zika virus infection
- the present invention is based, amongst other findings, on the discovery and isolation of antibodies that bind specifically to Zika virus epitopes.
- Such antibodies are either (i) highly potent in neutralizing Zika virus, if directed to an antigenic site of Zika virus envelope (E) protein or to a ZIKV quaternary epitope or (ii) useful in diagnosis of Zika virus infection, if directed to Zika virus NS1 protein.
- Such antibodies are desirable, as only small quantities of the antibodies are required in order to neutralize Zika virus. In particular, there is currently no prevention/treatment available for Zika virus infection.
- the antibodies according to the present invention are highly effective in preventing as well as treating or attenuating Zika virus infection.
- the present invention provides an isolated antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus epitope and neutralizes Zika virus infection.
- the antibody, or the antigen binding fragment thereof reduces viral infectivity of Zika virus.
- a neutralization assay animal viruses are typically propagated in cells and/or cell lines.
- a neutralization assay is preferred, wherein cultured cells are incubated with a fixed amount of Zika virus (ZIKV) in the presence (or absence) of the antibody to be tested.
- ZIKV Zika virus
- flow cytometry may be used.
- other readouts are conceivable, such as determining the amount of ZIKV non-structural proteins (such as ZIKV NS1 ) secreted into culture supernatant.
- a ZIKV nonstructural protein 1 (NS1 ) antigen capture enzyme-linked immunosorbent assay (ELISA)-based tissue culture infectious dose-50 (TCID50) test may be used as an alternative to the standard plaque assay for titrating Zika virus - in a similar manner as described for dengue virus (DENV) by Li J, Hu D-M, Ding X-X, Chen Y, Pan Y-X, Qiu L-W, Che X-Y: Enzyme-linked immunosorbent assay-format tissue culture infectious dose-50 test for titrating dengue virus.
- DEV dengue virus
- PLoS ONE 201 1 , 6:e22553 In such an assay for example the ZIKV NS1 -binding antibodies as described in the present application may be advantageously used.
- cultured cells for example Vero cells
- a fixed amount of ZIKV in the presence or absence of the antibody to be tested, for example for about four days.
- cells may be washed and further cultivated.
- flow cytometry may be used.
- cells may be fixed, e.g. with 2% formaldehyde, permeabilizes, e.g. in PBS (phosphate buffered saline) 1 % FCS (fetal calf serum) 0.5% saponin, and stained, e.g. with mouse antibody 4G2.
- PBS phosphate buffered saline
- FCS fetal calf serum
- Cells may then be incubated with a goat anti-mouse IgG conjugated to a dye, such as Alexa Fluor488 and analyzed by flow cytometry.
- viable cells may be detected by flow cytometry using for example the WST-1 reagent (Roche).
- a preferred ZIKV strain to be used in such a neutralization assay is ZIKV H/PF/201 3.
- the antibody and antigen binding fragment of the invention have high neutralizing potency.
- the concentration of the antibody required for 50% neutralization of Zika virus (ICso) as compared to no-antibody controls, is, for example, up to about 3 pg/ml or up to about 1 pg/ml.
- the concentration of the antibody of the invention required for 50% neutralization of ZIKV (ICso) is up to about 500 ng/ml, more preferably the concentration of the antibody of the invention required for 50% neutralization of ZIKV (ICso) is up to about 250 ng/ml, even more preferably the concentration of the antibody of the invention required for 50% neutralization of ZIKV (ICso) is up to about 150 ng/ml. Most preferably, the concentration of the antibody of the invention required for 50% neutralization of ZIKV (ICso) is about 1 00 ng/ml or less, e.g.
- the concentration of the antibody of the invention required for 50% neutralization of ZIKV is preferably about 50 ng/ml or less. This means that only low concentrations of the antibody are required for 50% neutralization of ZIKV.
- concentration of the antibody of the invention required for 50% neutralization of ZIKV can be measured using standard neutralization assays as known to one of ski ll in the art or, in particular, as described above.
- binding of an antibody may be assessed by use of a standard ELISA (enzyme-linked immunosorbent assay), which is well-known to the ski lled person.
- An exemplary standard ELISA may be performed as follows: ELISA plates may be coated (e.g., overnight at 4°C) with a sufficient amount (e.g., 1 ⁇ g/ml) of the protein/complex/particle to which binding of the antibody is to be tested (for example, for DENV binding as outlined below, DENV E proteins and/or DENV VLPs are used), e.g. in PBS. Plates may then be blocked, e.g.
- Bovine Serum Albumin BSA
- BSA Bovine Serum Albumin
- Plates may then be washed, the required substrate (e.g., p-NPP) may be added and plates may be read, e.g. at 405 nm.
- the relative affinities of antibody binding may be determined by measuring the concentration of mAb (EC50) required to achieve 50% maximal binding at saturation.
- the EC50 values may be calculated by interpolation of binding curves fitted with a four-parameter nonlinear regression with a variable slope.
- the antibody, or an antigen binding fragment thereof, according to the present invention does essentially not bind to Dengue virus-like particles and/or to Dengue envelope protein. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention does essentially not bind to Dengue virus-like particles and/or to Dengue envelope protein of any of the four DENV serotypes DENV1 , DENV2, DENV3 and DENV4.
- essentially not binding means that for the antibody, or an antigen binding fragment thereof, no ECso-value up to 10 2 ng/ml, preferably up to 1 0 3 ng/ml, more preferably up to 5*1 0 3 ng/ml, even more preferably up to 8*10 3 ng/ml, and most preferably up to 10 4 ng/ml can be determined in a standard ELISA to Dengue virus-like particles (DENV VLP) and/or to Dengue envelope protein (DENV E protein).
- DEV VLP Dengue virus-like particles
- DE protein Dengue envelope protein
- the concentration of the antibody, or an antigen binding fragment thereof, required to achieve 50% maximal binding at saturation (EC 5 o) to Dengue virus-like particles (DENV VLP) and/or to Dengue envelope protein (DENV E protein) in a standard ELISA is typically more than 1 0 2 ng/ml, preferably more than 1 0 3 ng/ml, more preferably more than 5*1 0 3 ng/ml, even more preferably more than 8*10 3 ng/ml, and most preferably more than 10 4 ng/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention does not contribute to antibody-dependent enhancement (ADE) of Zika virus infection. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention blocks antibody-dependent enhancement (ADE) of Zika virus infection.
- AD antibody-dependent enhancement
- ADE may be assessed by a flow-cytometry based assay using, for example cultured cells or cell lines, such as K562 cells.
- the antibodies to be tested and ZIKV may be mixed for 1 hour at 37°C and added to 5000 K562 cells/well. After four days, cells may be fixed, permeabilized, and stained with m4G2, e.g. as described above for neutralization assays. The number of infected cells was determined by flow cytometry, as described above for neutralization assays.
- the antibody, or an antigen binding fragment thereof, according to the present invention is a human antibody. It is also preferred that the antibody, or an antigen binding fragment thereof, according to the present invention is a monoclonal antibody, preferably a human monoclonal antibody. Furthermore, it is also preferred that the antibody, or an antigen binding fragment thereof, according to the present invention is a recombi nant antibody.
- the antibody according to the present invention, or an antigen binding fragment thereof comprises an Fc moiety. More preferably, the Fc moiety is derived from human origin, e.g. from human !gG1 , lgC2, lgG3, and/or lgG4, whereby human lgG1 is particularly preferred.
- an Fc moiety refers to a sequence derived from the portion of an immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (e.g., residue 21 6 in native IgG, taking the first residue of heavy chain constant region to be 1 14) and ending at the C-terminus of the immunoglobulin heavy chain. Accordingly, an Fc moiety may be a complete Fc moiety or a portion (e.g., a domain) thereof. A complete Fc moiety comprises at least a hinge domain, a CH2 domain, and a CH3 domain (e.g., EU amino acid positions 21 6-446).
- an Fc moiety comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant, portion, or fragment thereof.
- a hinge e.g., upper, middle, and/or lower hinge region
- an Fc moiety comprises at least a hinge domain, a CH2 domain or a CH3 domain. More preferably, the Fc moiety is a complete Fc moiety.
- the Fc moiety may also comprises one or more amino acid insertions, deletions, or substitutions relative to a naturally-occurring Fc moiety. For example, at least one of a hinge domain, CH2 domain or CH3 domain (or portion thereof) may be deleted.
- an Fc moiety may comprise or consist of: (i) hinge domain (or portion thereof) fused to a CH2 domain (or portion thereof), (ii) a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iii) a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iv) a hinge domain (or portion thereof), (v) a CH2 domain (or portion thereof), or (vi) a CH3 domain or portion thereof.
- the Fc moiety may be modified such that it varies in amino acid sequence from the complete Fc moiety of a naturally occurring immunoglobulin molecule, while retaining at least one desirable function conferred by the naturally-occurring Fc moiety.
- Such functions include Fc receptor (FcR) binding, antibody half-life modulation, ADCC function, protein A binding, protein G binding, and complement binding.
- FcR Fc receptor
- ADCC ADCC function
- protein A binding protein G binding
- complement binding complement binding.
- C1 q binds to at least two molecules of lgG1 or one molecule of IgM, attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1 995) 77-94).
- Burton, D. R. described (/Wo/. Immunol. 22 (1 985) 1 61 -206) that the heavy chain region comprising amino acid residues 31 8 to 337 is involved in complement fixation.
- Duncan, A. R., and Winter, G. (Nature 332 (1 988) 738-740), using site directed mutagenesis, reported that Glu31 8, Lys320 and Lys322 form the binding site to CI q.
- the role of Glu31 8, Lys320 and Lys 322 residues in the binding of C1 q was confirmed by the abi lity of a short synthetic peptide containing these residues to inhibit complement mediated lysis.
- FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on hematopoietic cells.
- Fc receptors belong to the immunoglobulin superfamily, and were shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L, / Leukoc. Biol. 49 (1 991 ) 51 1 -524).
- ADCC antibody dependent cell mediated cytotoxicity
- FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FcsR, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn.
- Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1 991 ) 457-492; Capel, P. J., et al., Immunomethods 4 (1 994) 25-34; de Haas, M., et al.JLab. Clin. Med 126 (1 995) 330-341 ; and Gessner, J. E., et al., Ann. Hematol. 76 (1 998) 231 -248.
- FcyR cross-linking of receptors by the Fc domain of native IgG antibodies
- FcyR In humans, three classes of FcyR have been characterized, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophi ls and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is known to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRlll (CD1 6), which binds IgG with medium to low affinity and exists as two types: FcyRIIIA found on NK cells, macrophages, eosin
- FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
- FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988).
- FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et al., 201 2: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988).
- such antibodies, and antigen binding fragments thereof are preferred, which are able to bind to FcyRIIb, for example antibodies comprising an Fc moiety for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
- FcyRIIb for example antibodies comprising an Fc moiety for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
- FcyRIIB binding for example antibodies comprising an Fc moiety for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
- it is possible to engineer the Fc moiety to enhance FcyRIIB binding by introducing the mutations S267E and L328F as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD1 9 and FcgammaRllb with Fc-engineered antibodies
- such antibodies, or antigen binding fragments thereof are preferred, which comprise an engineered Fc moiety with the mutations S267E and L328F, in particular as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD1 9 and FcgammaRllb with Fc-engineered antibodies.
- FcyRIIB acts to inhibit phagocytosis as mediated through FcyRIIA.
- eosinophils and mast cells the b form may help to suppress activation of these cells through IgE binding to its separate receptor.
- FcyRI binding modification in native IgG of at least one of E233-G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI.
- FcyRII binding reduced binding for FcyRIIA is found e.g.
- FcyRIII binding reduced binding to FcyRIIIA is found e.g. for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376.
- two regions of native IgG Fc appear to be critical for interactions of FcyRlls and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al., J. Immunol. 2000; 1 64: 5313 - 531 8).
- FcyRI appears to bind to the same site on IgG Fc
- FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface
- the Fc moiety may comprise or consist of at least the portion of an Fc moiety that is known in the art to be required for FcRn binding or extended half-life.
- the Fc moiety of the antibody of the invention comprises at least the portion of known in the art to be required for Protein A binding and/or the Fc moiety of the antibody of the invention comprises at least the portion of an Fc molecule known in the art to be required for protein G binding.
- the retained function is the neutralization of Zika virus infection, which is assumed to be mediated by FcyR binding.
- a preferred Fc moiety comprises at least the portion known in the art to be required for FcyR binding.
- a preferred Fc moiety may thus at least comprise (i) the lower hinge site of native IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of native IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 , for example a region of at least 3, 4, 5, 6, 7, 8, 9, or 1 0 consecutive amino acids in the upper CH2 domain of native IgG Fc around P331 , e.g. between amino acids 320 and 340 (EU numbering) of native IgG Fc.
- the antibody, or antigen binding fragment thereof, according to the present invention comprises an Fc region.
- Fc region refers to the portion of an immunoglobulin formed by two or more Fc moieties of antibody heavy chains.
- the Fc region may be monomeric or "single-chain" Fc region (i.e., a scFc region).
- Single chain Fc regions are comprised of Fc moieties linked within a single polypeptide chain (e.g., encoded in a single contiguous nucleic acid sequence).
- Exemplary scFc regions are disclosed in WO 2008/143954 A2.
- the Fc region is a dimeric Fc region.
- a “dimeric Fc region” or “dcFc” refers to the dimer formed by the Fc moieties of two separate immunoglobulin heavy chains.
- the dimeric Fc region may be a homodimer of two identical Fc moieties (e.g., an Fc region of a naturally occurring immunoglobulin) or a heterodimer of two non-identical Fc moieties.
- the Fc moieties of the Fc region may be of the same or different class and/or subclass.
- the Fc moieties may be derived from an immunoglobulin (e.g., a human immunoglobulin) of an lgG1 , lgG2, lgG3 or lgG4 subclass.
- the Fc moieties of Fc region are of the same class and subclass.
- the Fc region (or one or more Fc moieties of an Fc region) may also be chimeric, whereby a chimeric Fc region may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses.
- the Fc moieties of a dimeric or single-chain Fc region may be from different immunoglobulin classes and/or subclasses.
- the chimeric Fc regions may comprise one or more chimeric Fc moieties.
- the chimeric Fc region or moiety may comprise one or more portions derived from an immunoglobulin of a first subclass (e.g., an lgG1 , lgG2, or lgG3 subclass) while the remainder of the Fc region or moiety is of a different subclass.
- an Fc region or moiety of an Fc polypeptide may comprise a CH2 and/or CH3 domain derived from an immunoglobulin of a first subclass (e.g., an IgGI , lgG2 or lgG4 subclass) and a hinge region from an immunoglobulin of a second subclass (e.g., an lgG3 subclass).
- a first subclass e.g., an IgGI , lgG2 or lgG4 subclass
- a hinge region from an immunoglobulin of a second subclass e.g., an lgG3 subclass
- the Fc region or moiety may comprise a hinge and/or CH2 domain derived from an immunoglobulin of a first subclass (e.g., an lgG4 subclass) and a CH3 domain from an immunoglobulin of a second subclass (e.g., an IgGI , lgG2, or lgG3 subclass).
- a first subclass e.g., an lgG4 subclass
- CH3 domain from an immunoglobulin of a second subclass
- the chimeric Fc region may comprise an Fc moiety (e.g., a complete Fc moiety) from an immunoglobulin for a first subclass (e.g., an lgG4 subclass) and an Fc moiety from an immunoglobulin of a second subclass (e.g., an IgGI , lgG2 or lgG3 subclass).
- the Fc region or moiety may comprise a CH2 domain from an lgG4 immunoglobulin and a CH3 domain from an IgGI immunoglobulin.
- the Fc region or moiety may comprise a CHI domain and a CH2 domain from an lgG4 molecule and a CH3 domain from an IgGI molecule.
- the Fc region or moiety may comprise a portion of a CH2 domain from a particular subclass of antibody, e.g., EU positions 292-340 of a CH2 domain.
- an Fc region or moiety may comprise amino acids a positions 292-340 of CH2 derived from an IgG4 moiety and the remainder of CH2 derived from an IgGI moiety (alternatively, 292-340 of CH2 may be derived from an IgGI moiety and the remainder of CH2 derived from an lgG4 moiety).
- an Fc region or moiety may (additionally or alternatively) for example comprise a chimeric hinge region.
- the chimeric hinge may be derived, e.g.
- an Fc region or moiety may comprise a chimeric hinge derived, in part, from an IgGI molecule and, in part, from an lgG4 molecule.
- the chimeric hinge may comprise upper and lower hinge domains from an lgG4 molecule and a middle hinge domain from an IgGI molecule.
- Such a chimeric hinge may be made, for example, by introducing a proline substitution (Ser228Pro) at EU position 228 in the middle hinge domain of an lgG4 hinge region.
- the chimeric hinge can comprise amino acids at EU positions 233-236 are from an lgG2 antibody and/or the Ser228Pro mutation, wherein the remaining amino acids of the hinge are from an lgG4 antibody (e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP).
- Further chimeric hinges, which may be used in the Fc moiety of the antibody according to the present invention are described in US 2005/01 63783 A1 .
- the Fc moiety comprises or consists of an amino acid sequence derived from a human immunoglobulin sequence (e.g., from an Fc region or Fc moiety from a human IgG molecule).
- polypeptides may comprise one or more amino acids from another mammalian species.
- a primate Fc moiety or a primate binding site may be included in the subject polypeptides.
- one or more murine amino acids may be present in the Fc moiety or in the Fc region.
- the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, other parts derived from a constant region, in particular from a constant region of IgG, preferably from a constant region of IgGI , more preferably from a constant region of human IgGI . More preferably, the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, al l other parts of the constant regions, in particular al l other parts of the constant regions of IgG, preferably all other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- amino acid sequences of constant regions are the amino acid sequences according to SEQ ID NOs: 145 - 148 (nucleic acid sequences according to SEQ ID NOs: 149 - 152).
- amino acid sequence of IgGI CH1 -CH2-CH3 is according to SEQ ID NO: 145 or a functional sequence variant thereof, as described herein.
- amino acid sequence of IgGI CH1 -CH2-CH3 is according to SEQ ID NO: 146 or a functional sequence variant thereof, as described herein, wherein the "LALA" mutation is maintained.
- a particularly preferred antibody according to the present invention comprises a (complete) Fc region derived from human IgGI . More preferably, the antibody according to the present invention comprises, in particular in addition to a (complete) Fc region derived from human IgGI also al l other parts of the constant regions of IgG, preferably al l other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- antibody-dependent enhancement (ADE) of Zika virus infection is brought about by the binding of the Fc moiety of the antibody, in particular, the Fc moiety of the heavy chain of an IgG molecule, to an Fc receptor, e.g., an Fey receptor on a host cel l.
- an Fc receptor e.g., an Fey receptor on a host cel l.
- the antibody according to the present invention, or an antigen binding fragment thereof comprises one or more mutations in the Fc moiety.
- the mutation(s) may be any mutation that reduces binding of the antibody to an Fc receptor (FcR), in particular reduces binding of the antibody to an Fey receptor (FcyR).
- the antibody according to the present invention comprises a (complete) Fc moiety/Fc region, wherein the interaction/binding with FcRn is not compromised. Accordingly, it is particularly preferred that the antibody according to the present invention, or an antigen binding fragment thereof, comprises one or more mutations in the Fc moiety, which (i) reduce(s) binding of the antibody to an Fey receptor, but do(es) not compromise interaction with FcRn.
- a mutations in the Fc moiety which (i) reduce(s) binding of the antibody to an Fey receptor, but do(es) not compromise interaction with FcRn.
- One example of such a mutation is the "LALA" mutation described below.
- binding of the antibody to an Fc receptor may be assessed by various methods known to the skilled person, such as ELISA (Hessell AJ, Hangartner L, Hunter M, Havenith CEG, Beurskens FJ, Bakker JM, Lanigan CMS, Landucci G, Forthal DN, Parren PWHI, et al.: Fc receptor but not complement binding is important in antibody protection against HIV.
- ELISA Hessell AJ, Hangartner L, Hunter M, Havenith CEG, Beurskens FJ, Bakker JM, Lanigan CMS, Landucci G, Forthal DN, Parren PWHI, et al.: Fc receptor but not complement binding is important in antibody protection against HIV.
- the antibody according to the present invention may be glycosylated.
- N-linked glycans attached to the CH2 domain of a heavy chain can influence C1 q and FcR binding, with aglycosylated antibodies having lower affinity for these receptors.
- the CH2 domain of the Fc moiety of the antibody according to the present invention may comprise one or more mutations, in which a glycosylated residue is substituted by a non-glycosylated residue.
- the glycan structure can also affect activity e.g. differences in complement-mediated cell death may be seen depending on the number of galactose sugars (0, 1 or 2) at the terminus of a glycan' s biantennary chain.
- the antibody's glycans do not lead to a human immunogenic response after administration.
- the antibody according to the present invention can be modified by introducing random amino acid mutations into particular region of the CH2 or CH3 domain of the heavy chain in order to alter their binding affinity for FcR and/or their serum half-life in comparison to unmodified antibodies.
- modifications include, but are not limited to, substitutions of at least one amino acid from the heavy chain constant region selected from the group consisting of amino acid residues 250, 314, and 428.
- the Fc moiety of an antibody of the invention comprises a substitution at positions CH2 4, CH2 5, or both.
- the amino acid at positions 4 and 5 of CH2 of the wild-type IgGl and lgG3 is a leucine ("L").
- the antibody according to the present invention comprises an amino acid at position CH2 4, CH2 5, or both, that is not an L.
- antibody according to the present invention comprises an alanine ("A") at position CH2 4, or CH2 5, or both.
- the antibody according to the present invention comprises both, a CH2 L4A and a CH2 L5A substitution.
- Such antibodies are referred to herein as a "LALA" variant.
- an exemplary amino acid sequence of IgGl CH 1 -CH2-CH3 comprising the "LALA” mutation is according to SEQ ID NO: 146. Accordingly, the amino acid sequence of lgG1 CH 1 -CH2-CH3 is preferably according to SEQ ID NO: 146 or a functional sequence variant thereof, as described herein, wherein the "LALA” mutation is maintained.
- the antibody, or antigen binding fragment thereof binds to domain III of Zika virus envelope protein (EDIII).
- ZIKV includes a nucleocapsid core, which comprising single- stranded RNA wrapped by core proteins.
- the nucleocapsid core is encapsulated by a lipid bi layer membrane with "membrane proteins" and "envelope proteins".
- ZIKV envelope protein (E protein) is the dominant antigen.
- the ectodomain of the envelope protein comprises three distinct domains: E protein domain I (EDI), E protein domain II (EDII), and E protein domain III (EDIII).
- EDIII is highly conserved among different ZIKV strains (see Figure 12 for an alignment of amino acid sequences of EDIII of different ZIKV strains. Accordingly, the antibody, or antigen binding fragment thereof, more preferably binds to domain III of Zika virus envelope protein (EDIII) with EDIII having the following amino acid sequence (SEQ ID NO: 401 ):
- X may be any (naturally occurring) amino acid.
- EDIII stretches from amino acid 309 to amino acid 403 of ZIKV E protein of the ZIKV H/PF/201 3 strain (Genbank accession number KJ776791 ). Accordingly, the antibody, or antigen binding fragment thereof, most preferably binds to domain III of Zika virus envelope protein (EDIII) with EDIII having the following amino acid sequence (SEQ ID NO: 402): TAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENS KMMLELDPPFGDSYIVIGVGEKKITHHWHRS.
- EDIII Zika virus envelope protein
- EDI/II Zika virus envelope protein
- the antibody, or antigen binding fragment thereof binds to a quaternary epitope displayed on a ZIKV infectious virion.
- such antibodies show typically no detectable binding to recombinant ZIKV E protein or to ZIKV EDM in a standard ELISA (as described above), i.e.
- no detectable binding typically means that no EC 50 up to 1 0000 ng/ml was detected in a standard ELISA.
- no detectable binding typically means that no EC 50 up to 1 0000 ng/ml was detected in a standard ELISA.
- NPB neutralizing-non-E-binding antibodies.
- the quaternary epitope displayed on a ZIKV infectious virion is typically a conformational epitope.
- the quaternary epitope displayed on a ZIKV infectious virion may be formed at the interface of two envelope protein monomers making up a dimer ("envelope dimer epitope”; EDE) or it may be formed across neighbouring dimers ("herring- bone epitope”).
- the antibody according to the present invention preferably comprises (at least) three complementarity determining regions (CDRs) on a heavy chain and (at least) three CDRs on a light chain.
- complementarity determining regions (CDRs) are the hypervariable regions present in heavy chain variable domains and light chain variable domains.
- the CDRs of a heavy chain and the connected light chain of an antibody together form the antigen receptor.
- the three CDRs (CDR1 , CDR2, and CDR3) are arranged non-consecutively in the variable domain. Since antigen receptors are typically composed of two variable domains (on two different polypeptide chains, i.e.
- a single antibody molecule usually has two antigen receptors and therefore contains twelve CDRs.
- the CDRs on the heavy and/or light chain may be separated by framework regions, whereby a framework region (FR) is a region in the variable domain which is less "variable" than the CDR.
- FR framework region
- a chain or each chain, respectively
- the position of the CDR amino acids are defined according to the IMGT numbering system (IMGT: http://www.imgt.org/; cf. Lefranc, M.-P. et al. (2009) Nucleic Acids Res. 37, D1 006-D1 012).
- Table 1 shows the SEQ ID NO's of the amino acid sequences of the heavy chain CDR's (CDRH1 , CDRH2, and CDRH3) and of the heavy chain variable region (referred to as "VH") of exemplary antibodies according to the present invention:
- Table 2 shows the SEQ ID NO's of the amino acid sequences of the light chain CDR's (CDRL1 , CDRL2, and CDRL3) and of the light chain variable region (referred to as "VL") of exemplary antibodies according to the present invention:
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises amino acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to at least one of the CDR sequences, the VH sequence and/or the VL sequence shown in Table 1 and/or in Table 2.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 75, 39, 21 , 57, 239, 243, 247, 251 , 255, 259, 263, 267, 271 , 275, 279, 283, 287, 291 , 295, 299, 303, 307, 31 1 , 31 5, 31 9, 323, 327, 331 , 335, 339, 343, 347, 351 , 355, 359, 363, 367, 371 , 375, 379, 383, 387, 391 , 395, and 399, or a
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39, 57 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 3 or according to SEQ ID NO: 75; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 21 or according to SEQ ID NO: 39; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 3 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 1 , 1 9, 37, 55, 73, 237, 241 , 245, 249, 253, 257, 261 , 265, 269,
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, 38, 56, 74, 238, 242, 246, 250, 254, 258, 262, 266, 270, 274, 278, 282, 286, 290, 294, 298, 302, 306, 310, 31 4, 31 8, 322, 326, 330, 334, 338, 342, 346, 350, 354, 358, 362, 366, 370, 374, 378, 382, 386, 390, 394, and 398, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39, 57, 75, 239, 243, 247, 251 , 255, 259, 263, 267, 271 , 275, 279, 283, 287, 291 , 295, 299, 303, 307, 31 1 , 31 5, 31 9, 323, 327, 331 , 335,
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 1 , 1 9, 37, 55 and 73 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, 38, 56 and 74 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39, 57 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 1 , 1 9, 37 and 73 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, 38 and 74 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to SEQ ID NO: 1 or according to SEQ ID NO: 73; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 3 or according to SEQ ID NO: 75; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to SEQ ID NO: 1 9 or according to SEQ ID NO: 37; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 21 or according to SEQ ID NO: 39; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to SEQ ID NO: 1 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 3 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to any of SEQ ID NOs: 4, 22, 40, 58 and 76 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 23, 24, 41 , 42, 59, 60, 77 and 78 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to any of SEQ ID NOs: 7, 25, 43, 61 and 79 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to any of SEQ ID NOs: 4, 22, 40 and 76 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 23, 24, 41 , 42, 77 and 78 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to any of SEQ ID NOs: 7, 25, 43 and 79 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- SEQ ID NO: 76 or according to SEQ ID NO: 76; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 77 and 78 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 7 or according to SEQ ID NO: 79; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 23, 24, 41 and 42 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 25 or according to SEQ ID NO: 43; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 7 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH 1 , CDRH2, and CDRH3 amino acid sequences (i) according to SEQ ID NOs: 1 - 3; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 9 - 21 ; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 37 - 39; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 1 9 - 23 and 25
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii i) according to SEQ ID NOs: 1 9 - 23 and 25; or functional
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 73 - 77 and 79;
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 9 - 23 and 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 9 - 22 and 24 - 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 37 - 41 and
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) and, optionally, a light chain variable region (VL), wherein the heavy chain variable region (VH) comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 8, 26, 44, 62, 80, 240, 244, 248, 252, 256, 260, 264, 268, 272, 276, 280, 284, 288, 292, 296, 300, 304, 308, 312, 31 6, 320, 324, 328, 332, 336, 340, 344, 348, 352, 356, 360, 364, 368, 372, 376, 380, 384, 388, 392, 396, and 400; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%,
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 80 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 27 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 44 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the antibody, or the antigen binding fragment thereof, according to the present invention is gZKA1 90, gZKA64, gZKA230, gZKA1 85 or gZKA78, preferably the antibody, or the antigen binding fragment thereof, is gZKA1 90, gZKA64, gZKA230 or gZKA1 85, more preferably the antibody, or the antigen binding fragment thereof, is gZKA1 90 or gZKA64, and most preferably the antibody, or the antigen binding fragment thereof, is gZKA1 90.
- the present inventors have isolated monoclonal antibody (mAb) according to the present invention, which are referred to herein as ZKA1 90, ZKA64, ZKA230, ZKA1 85 and ZKA78 (cf. Tables 1 and 2, Example 1 ). Based on those antibodies, in particular on the VH and VL genes of those antibodies, the terms "gZKA1 90", “gZKA64”, “gZKA230”, “gZKA1 85” and “gZKA78”, as used herein, refer to the respective “generic" antibodies, or antigen binding fragments thereof.
- gZKA1 90 refers to an antibody, or antigen binding fragment thereof, having a CDRH 1 amino acid sequence according to SEQ ID NO: 1 , a CDRH2 amino acid sequence according to SEQ ID NO: 2, a CDRH3 amino acid sequence according to SEQ ID NO: 3, a CDRL1 amino acid sequence according to SEQ ID NO: 4, a CDRL2 amino acid sequence according to SEQ ID NO: 5 or 6, and a CDRL3 amino acid sequence according to SEQ ID NO: 7.
- the heavy chain variable region (VH) has preferably an amino acid sequence according to SEQ ID NO: 8 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 9.
- gZKA64 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 73, a CDRH2 amino acid sequence according to SEQ ID NO: 74, a CDRH3 amino acid sequence according to SEQ ID NO: 75, a CDRL1 amino acid sequence according to SEQ ID NO: 76, a CDRL2 amino acid sequence according to SEQ ID NO: 77 or 78, and a CDRL3 amino acid sequence according to SEQ ID NO: 79.
- the heavy chain variable region (VH) has preferably an amino acid sequence according to SEQ ID NO: 80 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 81 .
- gZKA230 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 37, a CDRH2 amino acid sequence according to SEQ ID NO: 38, a CDRH3 amino acid sequence according to SEQ ID NO: 39, a CDRL1 amino acid sequence according to SEQ ID NO: 40, a CDRL2 amino acid sequence according to SEQ ID NO: 41 or 42, and a CDRL3 amino acid sequence according to SEQ ID NO: 43.
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 44 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 45.
- gZKA1 85 refers to an antibody, or antigen binding fragment thereof, having a CDRH 1 amino acid sequence according to SEQ ID NO: 1 9, a CDRH2 amino acid sequence according to SEQ ID NO: 20, a CDRH3 amino acid sequence according to SEQ ID NO: 21 , a CDRL1 amino acid sequence according to SEQ ID NO: 22, a CDRL2 amino acid sequence according to SEQ ID NO: 23 or 24, and a CDRL3 amino acid sequence according to SEQ ID NO: 25.
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 26 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 27.
- gZKA78 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 55, a CDRH2 amino acid sequence according to SEQ ID NO: 56, a CDRH3 amino acid sequence according to SEQ ID NO: 57, a CDRL1 amino acid sequence according to SEQ ID NO: 58, a CDRL2 amino acid sequence according to SEQ ID NO: 59 or 60, and a CDRL3 amino acid sequence according to SEQ ID NO: 61 .
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 62 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 63.
- the antibody, or an antigen binding fragment thereof, according to the present invention is for use as a medicament.
- the antibody, or an antigen binding fragment thereof, according to the present invention may be used in the preparation of a medicament. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention is for use in the prevention and/or treatment of Zika virus infection. In other words, the antibody, or an antigen binding fragment thereof, according to the present invention may be used in the preparation of a medicament or use in the prevention and/or treatment of Zika virus infection. This aspect is described in more detail below.
- the invention also provides a nucleic acid molecule comprising a polynucleotide encoding the antibody, or the antigen binding fragment thereof, according to the present invention as described above.
- nucleic acid molecules and/or polynucleotides include, e.g., a recombinant polynucleotide, a vector, an oligonucleotide, an RNA molecule such as an rRNA, an mRNA, an miRNA, an siRNA, or a tRNA, or a DNA molecule such as a cDNA. Nucleic acid sequences encoding part or all of the light and heavy chains and CDRs of the antibodies of the present invention are preferred.
- nucleic acid sequences encoding part or all of the light and heavy chains, in particular VH and VL sequences and CDRs of the exemplary antibodies of the invention.
- Tables 1 and 2 provide the SEQ ID numbers for the amino acid sequences of the CDRs and VH and VL of exemplary antibodies according to the present invention.
- Table 3 below provides the SEQ ID numbers for exemplary nucleic acid sequences encoding the CDRs and VH and VL of exemplary antibodies according to the present invention. Due to the redundancy of the genetic code, the present invention also comprises sequence variants of these nucleic acid sequences and in particular such sequence variants, which encode the same amino acid sequences.
- a nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components.
- the term nucleic acid molecule preferably refers to DNA or RNA molecules. In particular, it is used synonymous with the term "polynucleotide".
- a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone.
- the term "nucleic acid molecule” also encompasses modified nucleic acid molecules, such as base- modified, sugar-modified or backbone-modified etc. DNA or RNA molecules.
- Table 3 shows exemplary nucleic acid sequences of the CDR's and the heavy chain variable region (VH) and the light chain variable region (VL) of five exemplary antibodies according to the present invention ("ZKA1 90", “ZKA64”, “ZKA230”, “ZKA1 85”, “ZKA78”):
- the sequence of the nucleic acid molecule according to the present invention comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 1 0 - 1 8, 28 - 36, 46 - 54, 64 - 72, and 82 - 90; or a functional sequence variant thereof.
- nucleic acid sequences according to the invention include nucleic acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the nucleic acid encoding a CDR, a VH sequence and/or a VL sequence used in an (exemplary) antibody according to the present invention, for example to the sequences shown in Table 3.
- the nucleic acid molecule may be manipulated to insert, delete or alter certain nucleic acid sequences. Changes from such manipulation include, but are not limited to, changes to introduce restriction sites, to amend codon usage, to add or optimize transcription and/or translation regulatory sequences, etc. It is also possible to change the nucleic acid to alter the encoded amino acids. For example, it may be useful to introduce one or more (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) amino acid substitutions, deletions and/or insertions into the antibody's amino acid sequence.
- Such point mutations can modify effector functions, antigen-binding affinity, post-translational modifications, immunogenicity, etc., can introduce amino acids for the attachment of covalent groups (e.g., labels) or can introduce tags (e.g., for purification purposes). Mutations can be introduced in specific sites or can be introduced at random, followed by selection (e.g., molecular evolution). For instance, one or more nucleic acids encoding any of the CDR regions, a VH sequence and/or a VL sequence of an (exemplary) antibody of the invention can be randomly or directionally mutated to introduce different properties in the encoded amino acids. Such changes can be the result of an iterative process wherein initial changes are retained and new changes at other nucleotide positions are introduced. Further, changes achieved in independent steps may be combined. Different properties introduced into the encoded amino acids may include, but are not limited to, enhanced affinity.
- vectors for example, expression vectors, comprising a nucleic acid molecule according to the present invention.
- a vector comprises a nucleic acid molecule as described above.
- the term "vector” refers to a nucleic acid molecule, preferably to a recombinant nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g. mRNA, or peptides, polypeptides or proteins.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- the present invention also provides cell expressing the antibody, or the antigen binding fragment thereof, according to the present invention; and/or comprising the vector according the present invention.
- cel ls examples include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cel ls or plant cells.
- the cells are mammalian cells, more preferably a mammalian cell line.
- Preferred examples include human cells, CHO cells, HEK293T cells, PER.C6 cel ls, NS0 cells, human liver cells, myeloma cells or hybridoma cel ls.
- the cell may be transfected with a vector according to the present invention, preferably with an expression vector.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g.
- the term "transfection” encompasses any method known to the ski lled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cel ls, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g. based on cationic lipids and/or liposomes, calcium phosphate precipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine etc.
- the introduction is non-viral.
- the cells of the present invention may be transfected stably or transiently with the vector according to the present invention, e.g. for expressing the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are stably transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are transiently transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- Antibodies of the invention may be coupled, for example, to a drug for delivery to a treatment site or coupled to a detectable label to faci litate imaging of a site comprising cells of interest.
- Methods for coupling antibodies to drugs and detectable labels are well known in the art, as are methods for imaging using detectable labels.
- Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an antibody of the invention and an epitope of interest can be facilitated by attaching a detectable substance to the antibody.
- Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin; and
- suitable radioactive material include 1251, 1 31 1, 35S, or 3 H.
- labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like.
- Labeled antibodies according to the present invention may be thus be used in such assays for example as described in US 3,766, 1 62; US 3,791 ,932; US 3,81 7,837; and US 4,233,402.
- An antibody according to the invention may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- radioisotopes examples include, but are not limited to, 1-131 , 1-1 23, 1-125, Y-90, Re-188, Re-1 86, At- 21 1 , Cu-67, Bi-212, Bi-21 3, Pd-109, Tc-99, ln-1 1 1 , and the like.
- Such antibody conjugates can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin.
- Radiolabeled Antibody in Cancer Therapy in Monoclonal Antibodies for Cancer Detection and Therapy, ed. Baldwin et al. (Academic Press, New York, 1 985), pp. 303-31 6; and Thorpe et al. (1 982) Immunol. Rev. 62:1 1 9-1 58.
- an antibody, or antibody fragment thereof can be conjugated to a second antibody, or antibody fragment thereof, to form an antibody heteroconjugate as described in US 4,676,980.
- linkers may be used between the labels and the antibodies of the invention, e.g., as described in US 4,831 , 1 75.
- Antibodies or, antigen-binding fragments thereof may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721 .
- Treatment may consist of a combination of treatment with conjugated and non-conjugated antibodies administered simultaneously or subsequently e.g., as described in WO00/52031 ; WO00/52473.
- Antibodies of the invention may also be attached to a solid support. Additionally, antibodies of the invention, or functional antibody fragments thereof, can be chemical ly modified by covalent conjugation to a polymer to, for example, increase their circulating half-life. Examples of polymers, and methods to attach them to peptides, are shown in US 4,766, 1 06; US 4,1 79,337; US 4,495,285 and US 4,609,546. In some embodiments the polymers may be selected from polyoxyethylated polyols and polyethylene glycol (PEG).
- PEG polyethylene glycol
- PEG is soluble in water at room temperature and has the general formula: R(0-CH 2 -CH 2 )nO-R, wherein R can be hydrogen, or a protective group such as an alkyl or alkanol group.
- the protective group may have between 1 and 8 carbons.
- the protective group is methyl.
- the symbol n is a positive integer. In one embodiment n is between 1 and 1 ,000. In another embodiment n is between 2 and 500.
- the PEG has an average molecular weight between 1 ,000 and 40,000, more preferably the PEG has a molecular weight between 2,000 and 20,000, even more preferably the PEG has a molecular weight between 3,000 and 1 2,000.
- PEG may have at least one hydroxy group, for example the PEG may have a terminal hydroxy group.
- the PEG is the terminal hydroxy group which is activated to react with a free amino group on the inhibitor.
- the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the present invention.
- Water-soluble polyoxyethylated polyols are also useful in the present invention. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. In one embodiment, POG is used.
- glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides, this branching would not necessarily be seen as a foreign agent in the body.
- POG may have a molecular weight in the same range as PEG.
- Another drug delivery system that can be used for increasing circulatory half-life is the liposome. Methods of preparing liposome delivery systems are known to one of skill in the art. Other drug delivery systems are known in the art and are described in, for example, referenced in Poznansky et al. (1 980) and Poznansky (1 984).
- Antibodies of the invention may be provided in purified form. Typically, the antibody will be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies of the invention may be immunogenic in non-human (or heterologous) hosts e.g., in mice.
- the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- antibodies of the invention for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
- Antibodies according to the invention can be made by any method known in the art.
- the general methodology for making monoclonal antibodies using hybridoma technology is well known (Kohler, G. and Milstein, C,. 1 975; Kozbar et al. 1 983).
- the alternative EBV immortalization method described in WO2004/076677 is used.
- a preferred method is described in WO 2004/076677.
- B cells producing the antibody of the invention are transformed with EBV and a polyclonal B cell activator. Additional stimulants of cellular growth and differentiation may optionally be added during the transformation step to further enhance the efficiency. These stimulants may be cytokines such as IL-2 and IL-1 5.
- IL-2 is added during the immortalization step to further improve the efficiency of immortalization, but its use is not essential.
- the immortalized B cells produced using these methods can then be cultured using methods known in the art and antibodies isolated therefrom. Another preferred method is described in WO 201 0/046775. In this method plasma cel ls are cultured in limited numbers, or as single plasma cells in microwell culture plates. Antibodies can be isolated from the plasma cell cultures. Further, from the plasma cell cultures, RNA can be extracted and PCR can be performed using methods known in the art.
- the VH and VL regions of the antibodies can be amplified by RT-PCR (reverse transcriptase PCR), sequenced and cloned into an expression vector that is then transfected into HEK293T cells or other host cells.
- RT-PCR reverse transcriptase PCR
- the cloning of nucleic acid in expression vectors, the transfection of host cells, the culture of the transfected host cells and the isolation of the produced antibody can be done using any methods known to one of skill in the art.
- the antibodies may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as HPLC or affinity chromatography. Techniques for purification of antibodies, e.g., monoclonal antibodies, including techniques for producing pharmaceutical-grade antibodies, are well known in the art.
- Fragments of the antibodies of the invention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- Antibody "fragments” include Fab, Fab', F(ab')2 and Fv fragments.
- the invention also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody of the invention.
- the invention includes a scFv comprising the CDRs from an antibody of the invention.
- heavy or light chain monomers and dimers single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, e.g., single chain Fv in which the heavy and light chain variable domains are joined by a peptide linker.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody.”
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- sequences of the invention may be a component of multispecific molecules in which the sequences of the invention target the epitopes of the invention and other regions of the molecule bind to other targets.
- exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1 126-1 1 36).
- Standard techniques of molecular biology may be used to prepare DNA sequences encoding the antibodies or antibody fragments of the present invention. Desired DNA sequences may be synthesized completely or in part using oligonucleotide synthesis techniques. Site-directed mutagenesis and polymerase chain reaction (PCR) techniques may be used as appropriate.
- Any suitable host cell/vector system may be used for expression of the DNA sequences encoding the antibody molecules of the present invention or fragments thereof.
- Bacterial, for example E. coli, and other microbial systems may be used, in part, for expression of antibody fragments such as Fab and F(ab')2 fragments, and especially Fv fragments and single chain antibody fragments, for example, single chain Fvs.
- Eukaryotic, e.g., mammalian, host cell expression systems may be used for production of larger antibody molecules, including complete antibody molecules.
- Suitable mammalian host cells include, but are not limited to, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- the present invention also provides a process for the production of an antibody molecule according to the present invention comprising culturing a host cell comprising a vector encoding a nucleic acid of the present invention under conditions suitable for expression of protein from DNA encoding the antibody molecule of the present invention, and isolating the antibody molecule.
- the antibody molecule may comprise only a heavy or light chain polypeptide, in which case only a heavy chain or light chain polypeptide coding sequence needs to be used to transfect the host cel ls.
- the cell line may be transfected with two vectors, a first vector encoding a light chain polypeptide and a second vector encoding a heavy chain polypeptide.
- a single vector may be used, the vector including sequences encoding light chain and heavy chain polypeptides.
- antibodies according to the invention may be produced by (i) expressing a nucleic acid sequence according to the invention in a host cell, e.g.
- the method may include (ii i) purifying the isolated antibody.
- Transformed B cells and cultured plasma cells may be screened for those producing antibodies of the desired specificity or function.
- the screening step may be carried out by any immunoassay, e.g., ELISA, by staining of tissues or cells (including transfected cells), by neutralization assay or by one of a number of other methods known in the art for identifying desired specificity or function.
- the assay may select on the basis of simple recognition of one or more antigens, or may select on the additional basis of a desired function e.g., to select neutralizing antibodies rather than just antigen- binding antibodies, to select antibodies that can change characteristics of targeted cells, such as their signaling cascades, their shape, their growth rate, their capability of influencing other cells, their response to the influence by other cells or by other reagents or by a change in conditions, their differentiation status, etc.
- Individual transformed B cell clones may then be produced from the positive transformed B cell culture.
- the cloning step for separating individual clones from the mixture of positive cells may be carried out using limiting dilution, micromanipulation, single cell deposition by cell sorting or another method known i n the art.
- Nucleic acid from the cultured plasma cells can be isolated, cloned and expressed in H EK293T cells or other known host cells using methods known in the art.
- the immortalized B cell clones or the transfected host-cells of the invention can be used in various ways e.g., as a source of monoclonal antibodies, as a source of nucleic acid (DNA or mRNA) encoding a monoclonal antibody of interest, for research, etc.
- the invention also provides a composition comprising immortalized B memory cells or transfected host cells that produce antibodies according to the present invention.
- the immortalized B cell clone or the cultured plasma cel ls of the invention may also be used as a source of nucleic acid for the cloning of antibody genes for subsequent recombinant expression.
- Expression from recombinant sources is more common for pharmaceutical purposes than expression from B cells or hybridomas e.g., for reasons of stabi lity, reproducibility, culture ease, etc.
- the invention also provides a method for preparing a recombinant cell, comprising the steps of: (i) obtaining one or more nucleic acids ⁇ e.g., heavy and/or light chain mRNAs) from the B cell clone or the cultured plasma cells that encodes the antibody of interest; (ii) inserting the nucleic acid into an expression vector and (iii) transfecting the vector into a host cell in order to permit expression of the antibody of interest in that host cell.
- nucleic acids ⁇ e.g., heavy and/or light chain mRNAs
- the invention provides a method for preparing a recombinant cell, comprising the steps of: (i) sequencing nucleic acid(s) from the B cell clone or the cultured plasma cel ls that encodes the antibody of interest; and (ii) using the sequence information from step (i) to prepare nucleic acid(s) for insertion into a host cell in order to permit expression of the antibody of interest in that host cell.
- the nucleic acid may, but need not, be manipulated between steps (i) and (ii) to introduce restriction sites, to change codon usage, and/or to optimize transcription and/or translation regulatory sequences.
- the invention also provides a method of preparing a transfected host cell, comprisi ng the step of transfecting a host cell with one or more nucleic acids that encode an antibody of interest, wherein the nucleic acids are nucleic acids that were derived from an immortalized B cell clone or a cultured plasma cel l of the invention.
- the procedures for first preparing the nucleic acid(s) and then using it to transfect a host cell can be performed at different times by different people in different places (e.g., in different countries).
- recombinant cells of the invention can then be used for expression and culture purposes. They are particularly useful for expression of antibodies for large-scale pharmaceutical production. They can also be used as the active ingredient of a pharmaceutical composition. Any suitable culture technique can be used, including but not limited to static culture, rol ler bottle culture, ascites fluid, hollow-fiber type bioreactor cartridge, modular minifermenter, stirred tank, microcarrier culture, ceramic core perfusion, etc.
- the transfected host cell may be a eukaryotic cell, including yeast and animal cells, particularly mammalian DC ls (e.g., CHO cells, NS0 cells, human cells such as PER.C6 or HKB-1 1 cel ls, myeloma cel ls, or a human liver cell), as well as plant cells, whereby mammalian cells are preferred.
- mammalian DC ls e.g., CHO cells, NS0 cells, human cells such as PER.C6 or HKB-1 1 cel ls, myeloma cel ls, or a human liver cell
- Preferred expression hosts can glycosylate the antibody of the invention, particularly with carbohydrate structures that are not themselves immunogenic in humans.
- the transfected host cell may be able to grow in serum-free media.
- the transfected host cell may be able to grow in culture without the presence of animal-derived products.
- the transfected host cell may also be cultured to give
- the invention also provides a method for preparing one or more nucleic acid molecules ⁇ e.g., heavy and light chain genes) that encode an antibody of interest, comprising the steps of: (i) preparing an immortalized B cell clone or culturing plasma cells according to the invention; (ii) obtaining from the B cell clone or the cultured plasma cells nucleic acid that encodes the antibody of interest. Further, the invention provides a method for obtaining a nucleic acid sequence that encodes an antibody of interest, comprising the steps of: (i) preparing an immortalized B cell clone or culturing plasma cells according to the invention; (ii) sequencing nucleic acid from the B cell clone or the cultured plasma cells that encodes the antibody of interest.
- a method for preparing one or more nucleic acid molecules ⁇ e.g., heavy and light chain genes that encode an antibody of interest, comprising the steps of: (i) preparing an immortalized B cell clone or culturing plasma cells according
- the invention further provides a method of preparing nucleic acid molecule(s) that encode an antibody of interest, comprising the step of obtaining the nucleic acid that was obtained from a transformed B cell clone or cultured plasma cells of the invention.
- a method of preparing nucleic acid molecule(s) that encode an antibody of interest comprising the step of obtaining the nucleic acid that was obtained from a transformed B cell clone or cultured plasma cells of the invention.
- the invention also comprises a method for preparing an antibody (e.g., for pharmaceutical use) according to the present invention, comprising the steps of: (i) obtaining and/or sequencing one or more nucleic acids ⁇ e.g., heavy and light chain genes) from the selected B cel l clone or the cultured plasma cells expressing the antibody of interest; (ii) inserting the nucleic acid(s) into or using the nucleic acid(s) sequence(s) to prepare an expression vector; (iii) transfecting a host cell that can express the antibody of interest; (iv) culturing or sub- culturing the transfected host cells under conditions where the antibody of interest is expressed; and, optional ly, (v) purifying the antibody of interest.
- obtaining and/or sequencing one or more nucleic acids ⁇ e.g., heavy and light chain genes
- the invention also provides a method of preparing an antibody comprising the steps of: culturing or sub-culturing a transfected host cell population, e.g. a stably transfected host cell population, under conditions where the antibody of interest is expressed and, optionally, purifying the antibody of interest, wherein said transfected host cell population has been prepared by (i) providing nucleic acid(s) encoding a selected antibody of interest that is produced by a B cel l clone or cultured plasma cells prepared as described above, (ii) inserting the nucleic acid(s) into an expression vector, (iii) transfecting the vector in a host cell that can express the antibody of interest, and (iv) culturing or sub-culturing the transfected host cell comprising the inserted nucleic acids to produce the antibody of interest.
- a transfected host cell population e.g. a stably transfected host cell population
- purifying the antibody of interest wherein said transfected host cell population
- the present invention also provides a pharmaceutical composition comprising one or more of:
- the present invention also provides a pharmaceutical composition comprising the antibody, or the antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention and/or the cell according to the present invention.
- the pharmaceutical composition may preferably also contain a pharmaceutically acceptable carrier, diluent and/or excipient.
- a pharmaceutically acceptable carrier may facilitate administration, it should not itself induce the production of antibodies harmful to the individual receiving the composition. Nor should it be toxic.
- Suitable carriers may be large, slowly metabol ized macromolecules such as proteins, polypeptides, liposomes, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
- pharmaceutically acceptable carriers in a pharmaceutical composition according to the present invention may be active components or inactive components.
- the pharmaceutically acceptable carrier in a pharmaceutical composition according to the present invention is not an active component in respect to Zika virus infection.
- Pharmaceutically acceptable salts can be used, for example mineral acid salts, such as hydrochlorides, hydrobromides, phosphates and sulphates, or salts of organic acids, such as acetates, propionates, malonates and benzoates.
- Pharmaceutical ly acceptable carriers in a pharmaceutical composition may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the subject.
- compositions of the invention may be prepared in various forms.
- the compositions may be prepared as injectables, either as liquid solutions or suspensions.
- Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared (e.g., a lyophilized composition, similar to SynagisTM and HerceptinTM, for reconstitution with sterile water containing a preservative).
- the composition may be prepared for topical administration e.g., as an ointment, cream or powder.
- the composition may be prepared for oral administration e.g., as a tablet or capsule, as a spray, or as a syrup (optionally flavored).
- the composition may be prepared for pulmonary administration e.g., as an inhaler, using a fine powder or a spray.
- the composition may be prepared as a suppository or pessary.
- the composition may be prepared for nasal, aural or ocular administration e.g., as drops.
- the composition may be in kit form, designed such that a combined composition is reconstituted just prior to administration to a subject.
- a lyophilized antibody may be provided in kit form with sterile water or a sterile buffer.
- the active ingredient in the composition is an antibody molecule, an antibody fragment or variants and derivatives thereof, in particular the active ingredient in the composition is an antibody, an antibody fragment or variants and derivatives thereof, according to the present invention.
- the composition may be susceptible to degradation in the gastrointestinal tract.
- the composition may contain agents which protect the antibody from degradation but which release the antibody once it has been absorbed from the gastrointestinal tract.
- compositions of the invention generally have a pH between 5.5 and 8.5, in some embodiments this may be between 6 and 8, and in other embodiments about 7.
- the pH may be maintained by the use of a buffer.
- the composition may be sterile and/or pyrogen free.
- the composition may be isotonic with respect to humans.
- pharmaceutical compositions of the invention are supplied in hermetically-sealed containers.
- compositions present in several forms of administration include, but are not limited to, those forms suitable for parenteral administration, e.g., by injection or infusion, for example by bolus injection or continuous infusion.
- parenteral administration e.g., by injection or infusion, for example by bolus injection or continuous infusion.
- the product may take the form of a suspension, solution or emulsion in an oi ly or aqueous vehicle and it may contain formulatory agents, such as suspending, preservative, stabilizing and/or dispersing agents.
- the antibody molecule may be in dry form, for reconstitution before use with an appropriate sterile liquid.
- a vehicle is typically understood to be a material that is suitable for storing, transporting, and/or administering a compound, such as a pharmaceutically active compound, in particular the antibodies according to the present invention.
- the vehicle may be a physiologically acceptable liquid, which is suitable for storing, transporting, and/or administering a pharmaceutically active compound, in particular the antibodies according to the present invention.
- compositions of this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enteral, sublingual, intravaginal or rectal routes. Hyposprays may also be used to administer the pharmaceutical compositions of the invention.
- the pharmaceutical composition may be prepared for oral administration, e.g. as tablets, capsules and the like, for topical administration, or as injectable, e.g. as liquid solutions or suspensions, whereby it is particularly preferred that the pharmaceutical composition is an injectable.
- Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection are also be preferred, e.g. that the pharmaceutical composition is in lyophilized form.
- the active ingredient will preferably be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stabi lity.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stabi lity.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a "prophylactically effective amount” or a “therapeutical ly effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a proliferatively effective amount or a "therapeutical ly effective amount” (as the case may be)
- the actual amount administered, and rate and time-course of administration, wil l depend on the nature and severity of what is being treated.
- the pharmaceutical composition according to the present invention may be provided for example in a pre-filled syringe.
- inventive pharmaceutical composition as defined above may also be administered orally in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful di luents include lactose and dried cornstarch.
- the active ingredient i.e. the inventive transporter cargo conjugate molecule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readi ly accessible by topical application, e.g. including diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readi ly prepared for each of these areas or organs.
- the inventive pharmaceutical composition may be formulated in a suitable ointment, containing the inventive pharmaceutical composition, particularly its components as defined above, suspended or dissolved in one or more carriers.
- Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the inventive pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- Dosage treatment may be a single dose schedule or a multiple dose schedule.
- the pharmaceutical composition may be provided as single-dose product.
- the amount of the antibody in the pharmaceutical composition - in particular if provided as single-dose product - does not exceed 200 mg, more preferably does not exceed 1 00 mg, and even more preferably does not exceed 50 mg.
- the pharmaceutical composition according to the present invention may be administered daily, e.g. once or several times per day, e.g. once, twice, three times or four times per day, preferably once or twice per day, more preferable once per day, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 1 3, 1 4, 1 5, 1 6, 1 7, 1 8, 1 9, 20 or 21 or more days, e.g. daily for 1 , 2, 3, 4, 5, 6 months.
- the pharmaceutical composition according to the present invention may be administered weekly, e.g. once or twice per week, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 1 , 12, 1 3, 14, 1 5, 1 6, 1 7, 1 8, 1 9, 20 or 21 or more weeks, e.g.
- the pharmaceutical composition according to the present invention may be preferably administered monthly, e.g. once per month or, more preferably, every second month for 1 , 2, 3, 4, or 5 or more years. It is also preferred that the administration continues for the lifetime.
- one single administration only is also envisaged, in particular in respect to certain indications, e.g. for prevention of Zika virus infection in case of accidental exposure, e.g. in non-immunised subjects.
- the most preferred treatment schedule is postexposure prophylaxis (PEP), wherein one or more single doses are administered as soon as possible after Zika infection.
- PEP postexposure prophylaxis
- a prophylactic setting wherein one or more single doses are administered to prevent Zika infection (i.e. before Zika infection, in particular in non-Zika- immunised subjects) is also preferred.
- the amount of the antibody, or the antigen binding fragment thereof, in the pharmaceutical composition according to the present invention does not exceed 1 g, preferably does not exceed 500 mg, more preferably does not exceed 200 mg, even more preferably does not exceed 1 00 mg, and particularly preferably does not exceed 50 mg.
- compositions typically include an "effective" amount of one or more antibodies of the invention, i.e. an amount that is sufficient to treat, ameliorate, attenuate or prevent a desired disease or condition, or to exhibit a detectable therapeutic effect.
- Therapeutic effects also include reduction or attenuation in pathogenic potency or physical symptoms.
- the precise effective amount for any particular subject will depend upon their size, weight, and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. The effective amount for a given situation is determined by routine experimentation and is within the judgment of a clinician.
- an effective dose wi ll generally be from about 0.005 to about 100 mg/kg, preferably from about 0.0075 to about 50 mg/kg, more preferably from about 0.01 to about 10 mg/kg, and even more preferably from about 0.02 to about 5 mg/kg, of the antibody of the present invention (e.g. amount of the antibody in the pharmaceutical composition) in relation to the bodyweight (e.g., in kg) of the individual to which it is administered.
- the antibody of the present invention e.g. amount of the antibody in the pharmaceutical composition
- bodyweight e.g., in kg
- the pharmaceutical composition according to the present invention may also comprise an additional active component, which may be a further antibody or a component, which is not an antibody.
- the additional active component is preferably a checkpoint inhibitor. It is also preferred that a ZIKV neutralizing antibody, or an antigen binding fragment thereof, as described herein is combined with a ZIKV NS1 -binding antibody, or an antigen binding fragment thereof, as described herein as additional active component (co-agent). Thereby, the pathogenic role of NS1 may be blocked in addition to neutralization of ZIKV.
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components, e.g. as described as co-agents below in the context of a combination therapy.
- the antibody, or the antigen binding fragment, according to the present invention can be present either in the same pharmaceutical composition as the additional active component or, preferably, the antibody, or the antigen binding fragment, according to the present invention is comprised by a first pharmaceutical composition and the additional active component is comprised by a second pharmaceutical composition different from the first pharmaceutical composition. Accordingly, if more than one additional active component is envisaged, each additional active component and the antibody, or the antigen binding fragment, according to the present invention is preferably comprised by a different pharmaceutical composition. Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- antibody, or the antigen binding fragment, according to the present invention and the additional active component provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term “synergy” is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition” of an activity or process, it is intended that the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- a pharmaceutical composition comprising the antibody according to gZKA1 90, gZKA64, gZKA230, gZKA1 85, gZKA78 or an antigen binding fragment thereof, and a pharmaceutical ly acceptable carrier is preferred.
- a composition of the invention may include antibodies of the invention, wherein the antibodies may make up at least 50% by weight (e.g., 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more) of the total protein in the composition.
- the antibodies are preferably in purified form.
- the present invention also provides a method of preparing a pharmaceutical composition comprising the steps of: (i) preparing an antibody of the invention; and (ii) admixing the purified antibody with one or more pharmaceutical ly-acceptable carriers.
- a method of preparing a pharmaceutical composition comprises the step of: admixing an antibody with one or more pharmaceutically-acceptable carriers, wherein the antibody is a monoclonal antibody that was obtained from a transformed B cell or a cultured plasma cell of the invention.
- nucleic acid typically DNA
- Suitable gene therapy and nucleic acid delivery vectors are known in the art.
- compositions may include an antimicrobial particularly if packaged in a multiple dose format. They may comprise detergent e.g., a Tween (polysorbate), such as Tween 80. Detergents are generally present at low levels e.g., less than 0.01 %. Compositions may also include sodium salts (e.g., sodium chloride) to give tonicity. For example, a concentration of 10 ⁇ 2mg/ml NaCl is typical.
- compositions may comprise a sugar alcohol (e.g., mannitol) or a disaccharide (e.g., sucrose or trehalose) e.g., at around 1 5-30 mg/ml (e.g., 25 mg/ml), particularly if they are to be lyophilized or if they include material which has been reconstituted from lyophilized material.
- the pH of a composition for lyophilization may be adjusted to between 5 and 8, or between 5.5 and 7, or around 6.1 prior to lyophilization.
- the compositions of the invention may also comprise one or more immunoregulatory agents.
- one or more of the immunoregulatory agents include(s) an adjuvant.
- the present invention provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in (i) prevention and/or treatment of Zika virus infection; or in (ii) diagnosis of Zika virus infection.
- use of the antibody, or an antigen binding fragment thereof, according to the present invention is preferred in (i) prevention and/or treatment of Zika virus infection as described herein; or in (ii) diagnosis of Zika virus infection as described herein.
- Methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably plasma or serum.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, i n particular following the contacting of an antibody or an antibody fragment with a sample.
- a detection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person ski lled in the art and include, e.g., ELISA (enzyme- linked immunosorbent assay).
- prevention of Zika virus infection refers in particular to prophylactic settings, wherein the subject was not diagnosed with Zika virus i nfection (either no diagnosis was performed or diagnosis results were negative) and/or the subject does not show symptoms of Zika virus infection. Accordingly, prevention of Zika virus infection includes "post-exposure prophylaxis" (PEP), i.e. preventive treatment after a possible Zika virus infection, for example after a mosquito bite in a Zika virus affected area.
- PEP post-exposure prophylaxis
- Prevention of Zika virus infection is in particular useful in high-risk subjects, such as in pregnant subjects and/or in subjects staying in Zika virus affected areas (such as subjects living in Zika virus affected areas or travelling to Zika virus affected areas).
- the subject is typically infected by Zika virus, diagnosed with Zika virus infection and/or showing symptoms of Zika virus infection.
- treatment and “therapy'V'therapeutic” of ZIKV infection include (complete) cure as well as attenuation of ZIKV infection.
- Preferred methods of diagnosis of Zika virus infection are the diagnosis methods as described herein, e.g. using the neutralizing antibody, or antigen binding fragment thereof, according to the present invention and/or the ZIKV NS1 -binding antibody, or antigen binding fragment thereof, according to the present invention.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is preferably used for treatment of Zika virus infection in subjects diagnosed with Zika virus infection or in subjects showing symptoms of Zika infection.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus i nfection in asymptomatic subjects. Those subjects may be diagnosed or not diagnosed with Zika virus infection.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cel l according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection in pregnant subjects, in particular to prevent congenital infection.
- this may be performed in a similar manner as for the prevention of HCMV congential infection as described in Nigro G, Adler SP, La Torre R, Best AM, Congenital Cytomegalovirus Collaborating Group: Passive immunization during pregnancy for congenital cytomegalovirus infection; N Engl J Med 2005, 353:1 350-1362.
- the antibody, or the antigen-binding fragment thereof, according to the present invention can pass the placenta through the interaction with FcRn if administered to a pregnant subject, e.g. by (i.v.) injection or any other route of administration as described herein.
- FcRn the interaction of "LALA" variants of antibodies as described herein with FcRn is not compromised. It is believed that FcRn is already expressed in the first trimester in the placenta.
- the antibody, or the antigen-binding fragment thereof, according to the present invention may also be administered to the extra-amniotic space.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection, wherein the antibody, or the antigen binding fragment thereof, the nucleic acid, the vector, the cell, or the pharmaceutical composition is administered up to seven days after (a possible) Zika virus infection, preferably up to five days after (a possible) Zika virus infection, more preferably up to three days after (a possible) Zika virus infection, and most preferably up to one day after (a possible) Zika virus infection.
- Such a treatment schedule may be useful in therapeutic settings as well as in prophylactic settings, in particular in post-exposure prophylaxis (PEP).
- PEP post-exposure prophylaxis
- the first administration of the the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is as soon as possible after a possible ZIKV infection, e.g. after a mosquito bite in a ZIKV affected area.
- the first administration of the the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is typically up to one or more days after (a possible) ZIKV infection, as described above.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection, wherein the antibody, or the antigen binding fragment thereof, the nucleic acid, the vector, the cell, or the pharmaceutical composition is administered up to three months before (a possible) Zika virus infection, preferably up to one month before (a possible) Zika virus infection, more preferably up to two weeks before (a possible) Zika virus infection, even more preferably up to one week before (a possible) Zika virus infection, and most preferably up to one day before (a possible) Zika virus infection.
- a treatment schedule refers in particular to a prophylactic setting.
- one or more subsequent administrations may follow, preferably a single dose per day or per every second day for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 1 3, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 days.
- one or more subsequent administrations may follow, preferably a single dose once or twice per week for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 1 3, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 weeks.
- one or more subsequent administrations may follow, preferably a single dose every 2 or 4 weeks for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 1 3, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 weeks.
- one or more subsequent administrations may fol low, preferably a single dose every two or four months for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 13, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 months.
- one or more subsequent administrations may follow, preferably a single dose once or twice per year for 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 years.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered at a (single) dose of 0.005 to 100 mg/kg bodyweight, preferably at a (single) dose of 0.0075 to 50 mg/kg bodyweight, more preferably at a (single) dose of 0.01 to 1 0 mg/kg bodyweight, even more preferably at a (single) dose of 0.05 to 5 mg/kg bodyweight, and particularly preferably at a (single) dose of 0.1 to 1 mg/kg bodyweight.
- a (single) dose of 0.005 to 100 mg/kg bodyweight preferably at a (single) dose of 0.0075 to 50 mg/kg bodyweight, more preferably at a (single) dose of 0.01 to 1 0 mg/kg bodyweight, even more preferably at a (single) dose of
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention may be administered by any number of routes such as oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enteral, sublingual, intravaginal or rectal routes.
- Intravenous administration, or subcutaneous administration or intramuscular administration are preferred and i ntravenous administration or subcutaneous administration are more preferred.
- the antibody, or an antigen binding fragment thereof, according to the present invention may also be administered intra- or extra-amniotic, e.g. by injection.
- the present invention also provides a method of preventing and/or treating Zika virus infection in a subject, wherein the method comprises administering to a subject in need thereof the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention.
- Preferred embodiments of this method correspond to preferred embodiments of the medical use as described above (and below, regarding combination therapy).
- a preferred subject in this method is a subject diagnosed with Zika virus infection or showing symptoms of Zika virus infection.
- Another preferred subject in this method is a pregnant subject.
- the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in the methods and uses according to the invention can be carried out alone or in combination with a co-agent (also referred to as "additional active component” herein), which is in particular useful for preventing and/or treating ZIKV infection.
- a co-agent also referred to as "additional active component” herein
- the invention encompasses the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, wherein it is administered to a subject prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful for treating and/or preventing ZIKV infection.
- Said antibody, nucleic acid, vector, cell or pharmaceutical composition, that is administered simultaneously with said co-agents can be administered in the same or different composition(s) and by the same or different route(s) of administration.
- Said other therapeutic regimens or co-agents may be, for example, a checkpoint inhibitor.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered in combination with a checkpoint inhibitor for the (medical) uses as described herein.
- Preferred checkpoint inhibitors are directed to a blockade of PD-1 /PD-L1 and/or of CTLA4 and, thus, include anti-PD-1 antibodies, anti-PD-L1 antibodies and anti-CTLA4 antibodies.
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components.
- a ZIKV neutralizing antibody, or an antigen binding fragment thereof, as described herein is combined with a ZIKV NS1 -binding antibody, or an antigen binding fragment thereof, as described herein as additional active component (co-agent).
- additional active component co-agent
- a ZIKV NS1 -binding antibody, or an antigen binding fragment thereof, as described herein is a preferred additional active component (co-agent).
- the antibody, or the antigen binding fragment, according to the present invention can be present either in the same pharmaceutical composition as the additional active component (co-agent) or, preferably, the antibody, or the antigen binding fragment, according to the present invention is comprised by a first pharmaceutical composition and the additional active component (co-agent) is comprised by a second pharmaceutical composition different from the first pharmaceutical composition. Accordingly, if more than one additional active component (co-agent) is envisaged, each additional active component (co-agent) and the antibody, or the antigen binding fragment, according to the present invention is preferably comprised by a different pharmaceutical composition. Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- the antibody, or the antigen binding fragment, according to the present invention and the additional active component (co-agent) provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term “synergy” is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition” of an activity or process, it is intended that the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- the present invention also provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention for monitoring the quality of an anti-Zika vaccine by checking that the antigen of said vaccine contains the specific epitope in the correct conformation.
- Preferred antigens comprised by such as anti-Zika vaccine to be checked include ZIKV envelope protein or any other molecule/complex comprising or consisting of (i) domain III of ZIKV E protein (EDI1I) as described above or (ii) a quaternary ZIKV epitope as described above.
- the present invention also provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in diagnosis of Zika virus infection.
- an isolated blood sample e.g., whole blood, serum and/or plasma
- an isolated blood sample e.g., whole blood, serum and/or plasma
- methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably serum or plasma.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample. Such a detection step is typical ly performed at the bench, i.e. without any contact to the human or animal body.
- the present invention also provides a kit of parts comprising at least one antibody, or antigen binding fragment thereof, according to the present invention, at least one nucleic acid according to the present invention, at least one vector according to the present invention, at least one cell according to the present invention, and/or at least one pharmaceutical composition according to the present invention.
- the kit may comprise means for administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, such as a syringe or a vessel, a leaflet, and/or a co-agent to be administered as described above.
- Antibodies specifically binding to NS1 protein ofZika virus in a further aspect, the present invention also provides an isolated antibody, or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV).
- ZIKV NS1 protein occurs intracellular, secreted and cell-surface associated and in particular secreted ZIKV NS1 protein is typically found in body fluids, such as serum, saliva, urine etc., of subjects infected with ZIKV. Secreted and cell-surface- associated NS1 are highly immunogenic and elicit production of antibodies. NS1 is known to be an important biomarker for early diagnosis of ZIKV infection. Accordingly, the antibody, or an antigen binding fragment thereof, according to the present invention that specifically binds to NS1 protein of ZIKA virus (ZIKV), is for example useful in diagnosis of ZIKV infection.
- ZIKV ZIKA virus
- binding may be assessed by standard ELISA as known to the skilled person and as described above.
- the relative affinities of antibody binding may be determined by measuring the concentration of the antibody (ECso) required to achieve 50% maximal binding at saturation.
- the ECso of the antibody, or an antigen binding fragment thereof, according to the present invention to ZIKV NS1 protein is no more than 50 ng/ml, preferably said ECso is no more than 25 ng/ml, more preferably said ECso is no more than 1 5 ng/ml, even more preferably said EC50 is no more than 10 ng/ml, and most preferab ly said EC50 is no more than 5 ng/ml, such as for example about 2 or 3 ng/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention that specifically binds to NS1 protein of ZIKA virus (ZIKV), does essentially not bind to Dengue virus (DENV) NS1 protein.
- "essentially not binding” means that for the antibody, or an antigen binding fragment thereof, no EC S o-value up to 1 0 2 ng/ml, preferably up to 1 0 3 ng/ml, more preferably up to 5*1 0 3 ng/ml, even more preferably up to 8*1 0 3 ng/ml, and most preferably up to 10' 1 ng/ml can be determined in a standard ELISA to Dengue virus (DENV) NS1 protein.
- the concentration of the antibody, or an antigen binding fragment thereof, required to achieve 50% maximal binding at saturation (EC50) to Dengue virus (DENV) NS1 protein in a standard ELISA is typically more than 1 0 2 ng/ml, preferably more than 1 0 3 ng/ml, more preferably more than 5*1 0 3 ng/ml, even more preferably more than 8*10 3 ng/ml, and most preferably more than 10 4 ng/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention that specifically binds to NS1 protein of ZIKA virus (ZIKV), does essentially not bind to Yellow fever virus (YFV) NS1 protein, West ni le virus (WNV) NS1 protein, Japanese encephalitis virus (JEV) NS1 protein and/or to Tick-borne encephalitis virus (TBEV) NS1 protein.
- ZIKV ZIKA virus
- essentially not binding means that for the antibody, or an antigen binding fragment thereof, no ECso-value up to 1 0 2 ng/ml, preferably up to 10 3 ng/ml, more preferably up to 5*1 0 3 ng/ml, even more preferably up to 8*1 0 3 ng/ml, and most preferably up to 1 0 4 ng/ml can be determined in a standard ELISA to Yellow fever virus (YFV) NS1 protein, West nile virus (WNV) NS1 protein, Japanese encephalitis virus (JEV) NS1 protein and/or to Tick-borne encephalitis virus (TBEV) NS1 protein.
- YFV Yellow fever virus
- WNV West nile virus
- JEV Japanese encephalitis virus
- TBEV Tick-borne encephalitis virus
- the concentration of the antibody, or an antigen binding fragment thereof, required to achieve 50% maximal binding at saturation (EC50) to Yellow fever virus (YFV) NS1 protein, West nile virus (WNV) NS1 protein, Japanese encephalitis virus GEV) NS1 protein and/or to Tick-borne encephalitis virus (TBEV) NS1 protein in a standard ELISA is typical ly more than 1 0 2 ng/ml, preferably more than 1 0 3 ng/ml, more preferably more than 5*1 0 3 ng/ml, even more preferably more than 8*1 0 3 ng/ml, and most preferably more than 1 0 4 ng/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention, that specifically binds to NS1 protein of ZIKA virus (ZIKV), is a human antibody. It is also preferred that the antibody, or an antigen binding fragment thereof, according to the present invention, that specifically binds to NS1 protein of ZIKA virus (ZIKV), is a monoclonal antibody, preferably a human monoclonal antibody. Furthermore, it is also preferred that the antibody, or an antigen binding fragment thereof, according to the present invention, that specifically binds to NS1 protein of ZIKA virus (ZIKV), is a recombinant antibody.
- the antibody according to the present invention or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV), comprises an Fc moiety. More preferably, the antibody according to the present invention, or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV), comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
- the antibody according to the present invention or an antigen binding fragment thereof, comprising an Fc moiety and/or comprises a CH2 L4A mutation, a CH2 L5A mutation, or both, it is referred to the detailed description of the Fc moiety and of the CH2 L4A mutation, CH2 L5A mutation, or both in the context of the neutralizing antibodies according to the present invention as above.
- the corresponding detailed description as well as preferred embodiments apply accordingly also for the antibody according to the present invention, or an antigen binding fragment thereof, that specifical ly binds to NS1 protein of ZIKA virus (ZIKV).
- the antibody according to the present invention, or an antigen binding fragment thereof, that specifical ly binds to NS1 protein of ZIKA virus (ZIKV), does not comprise an Fc moiety.
- the antibody according to the present invention, or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV) is a purified antibody, a single chain antibody, Fab, Fab', F(ab')2, Fv or scFv.
- the antibody according to the present invention, or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV) is labelled as described herein, for example biotinylated, such as a biotinylated Fab, Fab', or F(ab')2 fragment.
- the antibody according to the present invention, or an antigen binding fragment thereof, that specifically binds to NS1 protein of ZIKA virus (ZIKV) binds to antigenic site S1 and/or to antigenic site S2 of Zika virus NS1 protein.
- anti-ZIKV NS1 antibodies binding to antigenic site SI and/or to antigenic site S2 of ZIKV NS1 protein are not cross-reactive with dengue virus NS1 protein (DENV NS1 ).
- This surprising finding indicates that antigenic sites S1 and S2 on ZIKV NS1 can be used to distinguish ZIKV NS1 - specific antibodies from antibodies cross-reactive to DENV NS1 .
- Antigenic sites S1 and S2 of ZIKV NS1 protein were identified by the present inventors as described in Example 3, Figure 6. Whether an antibody is binding to antigenic site S1 and/or S2 may be easily identified by the skilled person by using cross-competition studies, for example as described below or in Example 3, wherein the S1 -specific antibody according to gZKA1 5 (SEQ ID NOs: 91 - 99) and/or the S2-specific antibody according to gZKA35 (SEQ ID NOs: 127 - 135) may be used as "second antibody”.
- any competition full or partial
- gZKA1 5 and/or gZKA35 indicates that the antibody to be tested binds to antigenic site S1 and/or to antigenic site S2, respectively.
- commercially available systems for characterization of protein-protein binding such as for example "Octet® RED96 System” provided by ForteBio, may be used, in particular according to the supplier's instructions.
- ZIKV-NS1 protein e.g. diluted to 2.5 pg/ml in PBS
- ZIKV-NS1 protein may be immobi lized (e.g. for 7-9 minutes) on the surface of an APS coated sensor-chip.
- Coated biosensors may then be placed into wells containing blocking buffer (e.g., 0.1 % BSA in PBS; e.g. for 6 minutes) to block free Biosensor binding sites.
- Coated-Biosensors may then be incubated (e.g., for 8 minutes) with the antibody/antibodies to be tested (e.g.
- step 2 Biosensors were moved to wel ls containing the "second antibodies", e.g. gZKA1 5 and/or gZKA35 (e.g. for 8 minutes) (step 2). Competition, partial competition or no competition can thus be determined in step 2, depending on whether no association (competition), low association (partial competition) or (strong) association (no competition) is detected.
- the antibody according to the present invention preferably comprises (at least) three complementarity determining regions (CDRs) on a heavy chain and (at least) three CDRs on a light chain.
- complementarity determining regions are the hypervariable regions present in heavy chain variable domains and light chain variable domains.
- the CDRs of a heavy chain and the connected light chain of an antibody together form the antigen receptor.
- the three CDRs (CDR1 , CDR2, and CDR3) are arranged non-consecutively in the variable domain. Since antigen receptors are typically composed of two variable domains (on two different polypeptide chains, i.e.
- a single antibody molecule usually has two antigen receptors and therefore contains twelve CDRs.
- the CDRs on the heavy and/or light chain may be separated by framework regions, whereby a framework region (FR) is a region in the variable domain which is less "variable" than the CDR.
- FR framework region
- a chain or each chain, respectively
- the sequences of the heavy chains and light chains of five exemplary antibodies of the invention, comprising three different CDRs on the heavy chain and three different CDRs on the light chain were determined.
- the position of the CDR amino acids are defined according to the IMGT numbering system (IMGT: http://www.imgt.org/; cf. Lefranc, M.-P. et al. (2009) Nucleic Acids Res. 37, D1 006-D1 012).
- Table 4 shows the SEQ ID NO's of the amino acid sequences of the heavy chain CDR's (CDRH1 , CDRH2, and CDRH3) and of the heavy chain variable region (referred to as "VH") of exemplary antibodies according to the present invention:
- Table 5 shows the SEQ ID NO's of the amino acid sequences of the light chain CDR's (CDRL1 , CDRL2, and CDRL3) and of the light chain variable region (referred to as "VL") of exemplary antibodies according to the present invention:
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises amino acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to at least one of the CDR sequences, the VH sequence and/or the VL sequence shown in Table 4 and/or in Table 5.
- the antibody or antigen binding fragment thereof comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 93, 1 1 1 , 1 29, 1 55, 1 59, 1 63, 1 67, 1 71 , 1 75, 1 79, 1 83, 1 87, 1 91 , 1 95, 1 99, 203, 207, 21 1 , 21 5, 21 9, 223, 227, 231 , and 235; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%,
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 93, 1 1 1 and 129, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- At least one CDR preferably the at least one heavy chain CDRH3
- At least one CDR preferably the at least one heavy chain CDRH3 comprises or consists of an amino acid sequence according to SEQ ID NO: 1 1 1 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- At least one CDR preferably the at least one heavy chain CDRH3
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 91 , 109, 127, 1 53, 1 57, 1 61 , 1 65, 1 69, 1 73, 1 77, 1 81 , 185, 1 89, 1 93, 1 97, 201 , 205, 209, 21 3, 21 7, 221 , 225, 229, and 233; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 92, 1 1 0, 128, 1 54, 1 58, 1 62, 1 66, 1 70, 1 74, 1 78, 1 82, 1 86, 1 90, 1 94, 1 98, 202, 206, 21 0, 214, 21 8, 222, 226, 230, and 234; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 93, 1 1 1 , 129, 1 55, 1 59, 1 63, 1 67, 1 71 , 1 75, 1 79, 1 83, 187, 1 91 , 1 95, 1 99, 203, 207, 21 1 , 21 5, 21 9, 223, 227, 231 , and 235; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to any of SEQ ID NOs: 91 , 1 09 and 127, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 92, 1 1 0 and 128, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 93, 1 1 1 and 129, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to SEQ ID NO: 91 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO: 92 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NOs: 93 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to SEQ ID NO: 1 09 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NOs: 1 1 1 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to SEQ ID NO: 127 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO: 128 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NOs: 129 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to any of SEQ ID NOs: 94, 1 12 and 1 30, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 95, 96, 1 13, 1 14, 1 31 and 1 32, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to any of SEQ ID NOs: 97, 1 1 5 and 1 33, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 97 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- 1 1 2 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 1 1 5 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRLl comprises an amino acid sequence according to SEQ ID NO:
- ⁇ 30 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 1 33 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences (i) according to SEQ ID NOs: 91 - 93; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 109 - 1 1 1 ; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 1 27 - 1 29; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 91 - 95 and 97; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 91 - 94 and 96 - 97; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 1 09 -
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) and, optionally, a light chain variable region (VL), wherein the heavy chain variable region (VH) comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 98, 1 1 6, 1 34, 1 56, 1 60, 1 64, 1 68, 1 72, 1 76, 1 80, 1 84, 1 88, 1 92, 1 96, 200, 204, 208, 212, 21 6, 220, 224, 228, 232, and 236; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 98 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 99 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 1 1 6 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at
- the antibody, or the antigen binding fragment thereof, according to the present invention is gZKA1 5, gZKA25, or gZKA35, more preferably the antibody, or the antigen binding fragment thereof, is gZKA25 or gZKA35.
- the present inventors have isolated monoclonal antibody (mAb) according to the present invention, which are referred to herein as ZKA1 5, ZKA25 and ZKA35 (cf. Tables 4 and 5, Example 1 ). Based on those antibodies, in particular on the VH and VL genes of those antibodies, the terms "gZKA1 5", “gZKA25” and “gZKA35”, as used herein, refer to the respective “generic" antibodies, or antigen binding fragments thereof.
- gZKA1 5" refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 91 , a CDRH2 amino acid sequence according to SEQ ID NO: 92, a CDRH3 amino acid sequence according to SEQ ID NO: 93, a CDRL1 amino acid sequence according to SEQ ID NO: 94, a CDRL2 amino acid sequence according to SEQ ID NO: 95 or 96, and a CDRL3 amino acid sequence according to SEQ ID NO: 97.
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 98 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 99.
- gZKA25 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 1 09, a CDRH2 amino acid sequence according to SEQ ID NO: 1 10, a CDRH3 amino acid sequence according to SEQ ID NO: 1 1 1 , a CDRL1 amino acid sequence according to SEQ ID NO: 1 12, a CDRL2 amino acid sequence according to SEQ ID NO: 1 13 or 1 14, and a CDRL3 amino acid sequence according to SEQ ID NO: 1 1 5.
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 1 6 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 1 1 7.
- gZKA35 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 127, a CDRH2 amino acid sequence according to SEQ ID NO: 128, a CDRH3 amino acid sequence according to SEQ ID NO: 129, a CDRL1 amino acid sequence according to SEQ ID NO: 130, a CDRL2 amino acid sequence according to SEQ ID NO: 1 31 or 1 32, and a CDRL3 amino acid sequence according to SEQ ID NO: 1 33.
- the heavy chain variable region (V H ) has preferably an amino acid sequence according to SEQ ID NO: 134 and the light chain variable region (V L ) has preferably an amino acid sequence according to SEQ ID NO: 1 35.
- production of antibodies (above section “production of antibodies”) and “optional additional features of antibodies” (above section “optional additional features of antibodies”) apply to all antibodies, and antigen binding fragments thereof, as described in the present application - i .e. those sections apply not only to the neutralizing antibodies, and antigen-binding fragments thereof, according to the present invention, but also to the NS1 -protein binding antibodies, and antigen-binding fragments thereof, according to the present invention.
- the antibody, or the antigen binding fragment thereof, according to the present invention is labelled, for example biotinylated.
- antibodies of the invention may be coupled to a detectable label, for example to provide measurability, e.g. for quantification or to facilitate imaging.
- Labeled antibodies may be employed in a wide variety of assays, in particular in immunoassays, employing a wide variety of labels.
- Preferred labels include radionuclides, enzymes, coenzymes, fluorescers, chemi luminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes (e.g., fluorescent dyes, tandem dyes), and the like.
- suitable enzymes include horseradish peroxidase (HRP), alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 1251, 131 1, 35S, or 3H.
- HRP horseradish peroxidase
- alkaline phosphatase alkaline phosphatase
- ⁇ -galactosidase acetylcholinesterase
- labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like, preferably in ELISA.
- Labeled antibodies according to the present invention may be thus be used in such assays for example as described in US 3, 766,1 62; US 3,791 ,932; US 3,81 7,837; and US 4,233,402.
- Preferred labels include (i) enzymes as described above, e.g. horseradish peroxidase (HRP) or alkaline phosphatase, in particular in Western Blotting, ELISA and immunohistochemistry; (ii) prosthetic group complexes as described above, e.g. streptavidin/biotin and avidin/biotin, in particular in ELISA and immunohistochemistry; (iii) fluorescers as described above, such as fluorescent dyes and fluorescent proteins (e.g., (enhanced) green fluorescent protein (EGFP); TagBFP, Turquoise, Venus, K02, Cherry, Apple, Kate2), in particular in immunofluorescence and flow cytometry; and (iv) tandem dyes in flow cytometry.
- enzymes as described above, e.g. horseradish peroxidase (HRP) or alkaline phosphatase, in particular in Western Blotting, ELISA and immunohistochemistry
- prosthetic group complexes e.g.
- the antibody, or the antigen binding fragment thereof is biotinylated.
- Biotin binds to streptavidin and avidin with an extremely high affinity, fast on-rate, and high specificity. Biotin-binding to streptavidin and avidin is resistant to extremes of heat, pH and proteolysis, making capture of biotinylated molecules possible in a wide variety of environments.
- the antibody, or the antigen binding fragment thereof, according to the present invention may be biotinylated chemically or enzymatically.
- Chemical biotinylation utilizes various conjugation chemistries to yield nonspecific biotinylation of amines (e.g., NHS-coupling gives biotinylation of any primary amines in the antibody, see below).
- Enzymatic biotinylation results in biotinylation of a specific lysine within a certain sequence by use of a bacterial biotin ligase.
- a second antibody, or antibody fragment thereof may also be used as label.
- the antibody, or the antigen binding fragment thereof, according to the present invention is conjugated to a second antibody, or antibody fragment thereof, to form an antibody heteroconjugate as described for example in US 4,676,980.
- the second antibody may optionally be labelled as described herein.
- NHS esters may be used in particular in the case of fluorescent dye labels.
- a fluorescent dye label may be purchased in an activated form of the label with an inbuilt NHS ester (also called a 'succinimidyl ester').
- the activated dye can be reacted under appropriate conditions with the antibody or with the antigen binding fragment thereof (e.g. via a lysine group). Excess reactive dye can be removed (e.g. by column chromatography) before the labeled antibody or antigen binding fragment thereof can be used in an immunoassay.
- Heterobifunctional reagents may be used in particular if the label is a protein molecule (e.g. HRP, alkaline phosphatase, or phycoerythrin).
- the antibody or the antigen binding fragment thereof and the label may have multiple amines.
- some of the lysines on one molecule e.g. on the antibody or on the antigen binding fragment thereof
- a 'heterobifunctional reagent' is then used to introduce the Y groups, which subsequently react with X groups when antibody and label are mixed, thus creating heterodimeric conjugates.
- Carbodiimides such as EDC may be used in particular to create covalent links between amine- and carboxyl-containing molecules. Carbodiimides activate carboxyl groups, and the activated intermediate is then attacked by an amine (e.g. provided by a lysine residue on the antibody or the antigen binding fragment thereof). Carbodiimides may be used in particular to conjugate antibodies to carboxylated particles (e.g. latex particles, magnetic beads), and to other carboxylated surfaces, such as microwell plates or chip surfaces. Carbodiimides may also be used to attach dyes or protein labels to antibodies or antigen binding fragments thereof.
- Sodium periodate may be used in particular for labelling with horseradish peroxidase (HRP).
- HRP horseradish peroxidase
- Periodate activates carbohydrate chains on the HRP molecule to create aldehyde groups, which are capable of reacting with lysines on the antibody or antigen binding fragment thereof. Since HRP itself has very few lysines, it is relatively easy to create antibody-HRP conjugates without significant HRP polymerization.
- linkers may be used between the labels and the antibodies of the invention, e.g., as described in US 4,831 , 1 75.
- Antibodies or, antigen-binding fragments thereof may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721 .
- the present invention also provides a complex comprising
- such a complex is preferably a label conjugated to the antibody, or the antigen binding fragment thereof, according to the present invention.
- the label and the antibody, or the antigen binding fragment thereof, according to the present invention are covalently linked.
- the complex according to the present invention may be a fusion protein comprising (i) the antibody according to the present invention and (ii) a label, which is a peptide or a protein, such as a fluorescent peptide or protein, e.g. EGFP.
- a label which is a peptide or a protein, such as a fluorescent peptide or protein, e.g. EGFP.
- the present invention also provides a nucleic acid molecule comprising a polynucleotide encoding the antibody, or the antigen binding fragment thereof, according to the present invention as described above or the complex according to the present invention as described above, in particular if the complex according to the present invention is a fusion protein as described above.
- nucleic acid molecules and/or polynucleotides include, e.g., a recombinant polynucleotide, a vector, an oligonucleotide, an RNA molecule such as an rRNA, an mRNA, an miRNA, an siRNA, or a tRNA, or a DNA molecule such as a cDNA.
- Nucleic acid sequences encoding part or all of the light and heavy chains and CDRs of the antibodies of the present invention are preferred.
- nucleic acid sequences encoding part or al l of the light and heavy chains in particular VH and VL sequences and CDRs of the exemplary antibodies of the invention.
- Tables 4 and 5 provide the SEQ ID numbers for the amino acid sequences of the CDRs and VH and VL of exemplary antibodies according to the present invention.
- nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components.
- nucleic acid molecule preferably refers to DNA or RNA molecules. In particular, it is used synonymous with the term "polynucleotide”.
- a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone.
- nucleic acid molecule also encompasses modified nucleic acid molecules, such as base- modified, sugar-modified or backbone-modified etc. DNA or RNA molecules.
- Table 6 shows exemplary nucleic acid sequences of the CDR's and the heavy chain variable region (VH) and the light chain variable region (VL) of three exemplary antibodies according to the present invention ("ZKA1 5", “ZKA25”, “ZKA35”):
- the sequence of the nucleic acid molecule according to the present invention comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 1 00 - 1 08, 1 1 8 - 126, and 136 - 1 44.
- nucleic acid sequences according to the invention include nucleic acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the nucleic acid encoding a CDR, a VH sequence and/or a VL sequence used in an (exemplary) antibody according to the present invention, for example to the sequences shown in Table 6.
- the nucleic acid molecule may be manipulated to insert, delete or alter certain nucleic acid sequences. Changes from such manipulation include, but are not limited to, changes to introduce restriction sites, to amend codon usage, to add or optimize transcription and/or translation regulatory sequences, etc. It is also possible to change the nucleic acid to alter the encoded amino acids. For example, it may be useful to introduce one or more ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) amino acid substitutions, deletions and/or insertions into the antibody's amino acid sequence.
- Such point mutations can modify effector functions, antigen-binding affinity, post-translational modifications, immunogenicity, etc., can introduce amino acids for the attachment of covalent groups (e.g., labels) or can introduce tags (e.g., for purification purposes). Mutations can be introduced in specific sites or can be introduced at random, followed by selection (e.g., molecular evolution). For instance, one or more nucleic acids encoding any of the CDR regions, a VH sequence and/or a VL sequence of an (exemplary) antibody of the invention can be randomly or directionally mutated to introduce different properties in the encoded amino acids. Such changes can be the result of an iterative process wherein initial changes are retained and new changes at other nucleotide positions are introduced. Further, changes achieved in independent steps may be combined. Different properties introduced into the encoded amino acids may include, but are not limited to, enhanced affinity.
- vectors for example, expression vectors, comprising a nucleic acid molecule according to the present invention.
- a vector comprises a nucleic acid molecule as described above.
- vector refers to a nucleic acid molecule, preferably to a recombinant nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- the present invention also provides cell expressing the antibody, or the antigen binding fragment thereof, according to the present invention; and/or comprising the vector according the present invention.
- Examples of such cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells or plant cells.
- the cells are mammalian cells, more preferably a mammalian cell line.
- Preferred examples include human cells, CHO cells, HEK293T cells, PER.C6 cells, NS0 cells, human liver cells, myeloma cells or hybridoma cel ls.
- the cell may be transfected with a vector according to the present invention, preferably with an expression vector.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, preferably into eukaryotic cells.
- RNA e.g. mRNA
- transfection encompasses any method known to the ski lled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g.
- the introduction is non-viral.
- the cel ls of the present invention may be transfected stably or transiently with the vector according to the present invention, e.g. for expressing the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are stably transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are transiently transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the present invention also provides a composition comprising the antibody, or the antigen binding fragment thereof, according to the present invention; the complex according to the present invention as described above; the nucleic acid molecule according to the present invention as described above; the vector according to the present invention as described above; or the cell according to the present invention as described above.
- a composition comprising the antibody, or the antigen binding fragment thereof, according to the present invention or the complex according to the present invention as described above is preferred.
- Such a composition may be a pharmaceutical composition as described above in the context of the neutralizing antibodies, whereby the detailed description and preferred embodiments of such a pharmaceutical composition as described above apply accordingly to the antibody, or the antigen binding fragment thereof, according to the present invention, that binds to ZIKV NS1 protein.
- the composition may also be used for non-pharmaceutical purposes, such as in diagnosis (of ZIKV infection) or for analytical purposes.
- the composition is in liquid form, e.g. to provide the antibody or the antigen binding fragment thereof in a liquid for direct use, e.g. in a diagnosis assay.
- the l iquid (vehicle) may be chosen according to the purpose, e.g. depending on the assay.
- the composition according to the present invention comprises PBS (phosphate-buffered saline) or another buffer.
- Such buffers are preferably biological buffers, and the composition may thus comprise any of MES, BIS-TRIS, ADA, PIPES, ACES, MOPSO, BIS-TRIS propane, BES, MOPS, TES, HEPES, DIPSO, TAPSO, Trizma, POPSO, HEPPS, TRICINE, Gly-Gly, BICINE, HEPBS, TAPS, AMPD, AMPSO, CHES, CAPSO, AMP, CAPS and CABS. It is also preferred that the composition comprises Ringer's solution.
- the composition may also comprise Tris, e.g., Tris-HCI.
- composition according to the present invention may also comprise a detergent e.g., a Tween (polysorbate), such as Tween 20 or Tween 80.
- a detergent e.g., a Tween (polysorbate), such as Tween 20 or Tween 80.
- Detergents are preferably present at low levels e.g., less than 0.01 %.
- Compositions may also include sodium salts (e.g., sodium chloride) to give tonicity. For example, a concentration of 1 0+2mg/ml NaCl is typical.
- composition according to the present invention may optionally comprise a protein stabilizer, such as BSA (bovine serum albumin) or HSA (human serum albumin).
- a protein stabilizer such as BSA (bovine serum albumin) or HSA (human serum albumin).
- BSA bovine serum albumin
- HSA human serum albumin
- protein stabilizers which may optionally be included in the composition according to the present invention, include buffers, e.g.
- salts such as sodium chloride
- amino acids such as histidine, glycine, and arginine
- polyols/disaccharides/polysaccharides such as trehalose and sucrose (disaccharides), mannitol and sorbitol (sugar alcohols)
- surfactants such as polysorbate 20, polysorbate 80, and proteins like HSA or BSA
- polymers such as dextran and polyethylene glycol
- antioxidants such as sodium chloride
- amino acids such as histidine, glycine, and arginine
- polyols/disaccharides/polysaccharides such as trehalose and sucrose (disaccharides), mannitol and sorbitol (sugar alcohols)
- surfactants such as polysorbate 20, polysorbate 80, and proteins like HSA or BSA
- polymers such as dextran and polyethylene glycol
- antioxidants such as sodium chloride
- composition according to the present invention may optionally comprise a preservative, such as sodium azide.
- a preservative such as sodium azide. Preservatives are typically used to prevent microbial contamination.
- the present invention also provides a kit of parts comprising the antibody, or the antigen binding fragment thereof, according to the present invention, the complex according to the present invention or the composition according to the present invention.
- kit of parts may optionally further comprise one or more of the following: (i) one or more solutions, e.g. to be used in a diagnosis assay, e.g. to dilute the antibody or the antigen binding fragment thereof;
- vessels or devices e.g. useful in a diagnosis assay, for example one or more ELISA plates.
- the kit according to the present invention as described above also comprises a substrate for the development of the color.
- a substrate for the development of the color.
- a substrate include p-NPP, in particular in case of detection through alkaline phosphatase; or an enzyme like ABTS, TMB or OPD, in particular in case of use of horse-radish peroxidase (HRP).
- the substrate may be diluted in an appropriate buffer, e.g. a buffer as described above in the context of the composition according to the present invention.
- the substrate and the buffer may be provided as separate entities in the kit.
- the kit according to the present invention may also comprise an enzyme conjugated streptavidin, or another system to detect the binding of the probe antibody.
- the probe antibody may be made in murinized form and in this case the binding may be detected with an anti-mouse secondary antibody - without the need for biotinylation.
- the anti-mouse secondary antibody is typically polyclonal and/or cross- adsorbed for not reacting with human antibodies.
- the kit according to the present invention preferably comprises one or more ELISA plates. More preferably, those ELISA plates are pre-coated with ZIKV-NS1 protein. Optionally, such pre-coated ELISA-plates may be pre-blocked.
- the present invention also provides the use of the antibody, or the antigen binding fragment thereof, according to the present invention, that binds to ZIKV NS1 protein, the complex according to the present invention, the composition according to the present invention or the kit of parts according to the present invention in diagnosis of Zika virus (ZIKV) infection.
- Diagnosis of Zika virus (ZIKV) infection is typically performed in vitro, e.g. in an isolated sample of the subject to be diagnosed.
- Preferred isolated samples of the subject include samples of a body fluid and tissue samples. A sample of a body fluid is more preferred.
- Preferred body fluids for diagnosis of ZIKV infection include blood (e.g. whole blood, plasma, serum), saliva and uri ne. Blood, in particular plasma or serum, is most preferred.
- the present invention also provides the use of the antibody, or the antigen binding fragment thereof, according to the present invention, that binds to ZIKV NS1 protein, the complex according to the present invention, the composition according to the present invention or the kit of parts according to the present invention in determining whether an isolated sample (of a body fluid), such as an isolated blood sample, is infected with Zika virus.
- a body fluid such as an isolated blood sample
- preferred body fluids for diagnosis of ZIKV infection include blood (e.g. whole blood, plasma, serum), saliva and urine. Blood, in particular plasma or serum, is more preferred.
- different diagnosis assays may be used for diagnosis of Zika virus infection.
- Preferred diagnosis assays are immunoassays.
- immunoassays include ELISA, immunofluorescence, immunohistochemistry and flow cytometry.
- diagnosis includes ELISA.
- a standard ELISA, a sandwich ELISA or a blockade of binding assay may be used.
- the diagnosis assay detects
- a blockade-of-binding assay is used.
- an isolated sample from a subject to be diagnosed e.g., a sample of a body fluid, such as blood (e.g. whole blood, plasma, serum), saliva and urine
- a sample of a body fluid such as blood (e.g. whole blood, plasma, serum), saliva and urine)
- a body fluid such as blood (e.g. whole blood, plasma, serum), saliva and urine)
- the antibody, or the antigen binding fragment thereof, according to the present invention is added, wherein the antibody or the antigen binding fragment thereof according to the present invention is preferably labelled, e.g. biotinylated.
- inhibition of binding of the antibody or the antigen binding fragment thereof according to the present invention can be determined.
- inhibition of binding shows the presence of anti-ZIKV NS1 antibodies in the sample of the subject, thus indicating ZIKV infection of the subject.
- samples of non-infected subjects in contrast, typically no inhibition of binding is expected.
- such an assay using the ZIKV NS1 -binding antibodies of the present invention does not score positive in subjects that were already infected with other flaviviruses. Flaviviruses typically induce a large number of antibodies that are cross-reactive with ZIKV. In other words this assay is highly specific and not affected by cross-reactive Abs.
- inhibition of binding of exemplary biotinylated antibodies or antigen binding fragments thereof according to the present invention may be assessed by determining the optimal concentration of the antibody or the antigen binding fragment thereof according to the present invention to achieve 70% maximal binding to ZIKV NS1 protein.
- the optimal concentrations of the exemplary antibodies gZKA15, gZKA25 and gZKA35 to achieve 70% maximal binding to ZIKV NS1 protein are 38, 1 7 and 7 ng/ml, respectively.
- % inhib (1 - [(OD sample-OD neg ctr)/ (OD pos ctr-OD neg ctr)]) x 1 00
- % inhib refers to the percentage of inhibition of binding of the antibody or the antigen binding fragment thereof according to the present invention to ZIKV NS1 protein
- OD sample refers to the optical density of the sample
- OD neg ctr refers to the optical density of a negative control
- OD pos ctr refers to the optical density of a positive control.
- This assay provides several advantages, such as the abi lity to detect clinical, sub-clinical and asymptomatic ZIKV infections at the population level, being able to distinguish them from other flavivirus infections, such as DENV.
- the diagnosis assay according to the present invention provides higher precision than direct ELISA binding assays.
- the present invention also provides a method for (in vitro) diagnosis of Zika infection (in an isolated sample), wherein the antibody, or the antigen binding fragment thereof, according to the present invention, that binds to ZIKV NS1 protein, the complex according to the present invention, the composition according to the present invention or the kit of parts according to the present invention is used for determining whether an isolated sample (of a body fluid), such as an isolated blood sample, is infected with Zika virus.
- preferred isolated samples include samples of a body fluid and tissue samples. A sample of a body fluid is more preferred.
- Preferred body fluids for diagnosis of ZIKV infection include blood (e.g. whole blood, plasma, serum), saliva and urine. Blood, in particular plasma or serum, is most preferred.
- preferred diagnosis assays are immunoassays. Preferred examples of immunoassays include ELISA, immunofluorescence, immunohistochemistry and flow cytometry. Preferably, diagnosis includes ELISA. Most preferably, a blockade-of-binding assay as described above is used.
- the method for (in vitro) diagnosis of Zika infection comprises a step of
- the method for ⁇ in vitro) diagnosis of Zika infection comprises the following steps: (0) adding an isolated sample from a subject to be diagnosed (e.g., a sample of a body fluid, such as blood (e.g. whole blood, plasma, serum), saliva and urine) to an ELISA plate coated with ZIKV NS1 protein;
- a subject to be diagnosed e.g., a sample of a body fluid, such as blood (e.g. whole blood, plasma, serum), saliva and urine
- the present invention also provides the neutralizing antibody, or the antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cel l according to the present invention, or the pharmaceutical composition according to the present invention for use according in treatment or prevention of ZIKV infection in subjects diagnosed with Zika virus infection by using the antibody, or the antigen binding fragment thereof, according to the present invention, that binds to ZIKV NS1 protein, the complex according to the present invention, the composition according to the present invention, the kit of parts according to the present invention or the method for ZIKV diagnosis according to the present invention.
- the present invention also provides a method of preventing and/or treating Zika virus infection, the method comprising the following steps:
- the present invention also provides a kit of parts comprising
- Such a kit of parts is particularly useful in a method as described above.
- ZIKV infection can be specifical ly diagnosed as well as prevented and/or treated.
- Figure 1 shows the reactivity (ELISA) and ZIKV and DENV1 neutralizing activity of antibodies derived from four ZIKV immune donors (ZKA, ZKB, ZKC and ZKD) to E protein of ZIKV and DENV1 -4 and to EDIII-domain of ZIKV E protein;
- NNB - neutralizing, non-E-protein binding antibodies NNB - neutralizing, non-E-protein binding antibodies.
- Figure 2 shows the reactivity (ELISA) of antibodies derived from four ZIKV immune donors (ZKA, ZKB, ZKC and ZKD) to NS1 protein of ZIKV, DENVI -4 and other flaviviruses.
- ZKA ZIKV immune donors
- ZKB ZKB
- ZKC ZKD
- Encephalitis virus and TBEV - Tick-borne Encephalitis virus (nd, not determined).
- Figure 3 shows the binding of ZKA1 90, ZKA78 and ZKA64 antibodies to ZIKV and
- Figure 4 shows the binding of ZKA1 85 and ZKA1 90 antibodies to ZIKV E, DENV1 VLP and to ZIKV EDIII proteins as measured by ELISA.
- Figure 5 shows the binding of ZKA1 5, ZKA25 and ZKA35 antibodies to ZIKV and
- Figure 6 shows for Example 3 ZIKV NS1 protein antigenic site mapping using cross- competition Octet-binding studies.
- A-B Cross-competition matrix performed by Octet on 24 mAbs specific for ZIKV NS1 (A) or cross-reactive to DENV NS1 (B). +, lack of binding of the secondary Ab; +/-, partial loss of binding of the secondary mAb; -, binding of the secondary mAb. Strikethrough cells, not tested.
- C Map of the antigenic sites targeted by ZIKV NS1 -specific mAbs as defined using BLI (Octet) cross-competition.
- Figure 8 shows for Example 5 the neutralizing activity of ZKA1 90, ZKA64, ZKA64- LALA ZKA230 and ZKA78 antibodies against ZIKV (H/PF/201 3 strain) and DENV1 on Vero cells as measured by flow-cytometry (% of infected cells).
- Figure 9 shows for Example 5 the neutralizing activity of ZKA1 90, ZKA64, ZKA1 85,
- FIG. 10 shows for Example 6 the infection enhancing activity (ADE, antibody-dependent enhancement) of ZKA1 90, ZKA64, ZKA64-LALA, ZKA1 85, ZKA230 and ZKA78 antibodies for ZIKV (H/PF/2013 strain) on non-permissive K562 cells as measured by flow-cytometry (% of infected cells).
- Figure 11 shows for Example 6 that four ZIKV-immune plasma and one DENV-immune plasma showed similar capacity to enhance ZIKV infection of K562 cells (upper panel).
- FIG. 12 shows the amino acid alignment of the EDIII region of 39 ZIKV strains from the Asian lineage since 201 3 (including the prototypic strai n MR766 of the African lineage isolated in 1 947).
- Figure 13 shows for Example 5 the neutralizing activity of ZKA1 90 and ZKA1 90-LALA antibody against three strains of ZIKV (H/PF/201 3, MR766 and MRS_OPY_Martinique_PaRi_201 5) on Vero cells as measured by flow- cytometry (% of infected cells).
- Example 1 Isolation of ZIKV-specific antibodies and production of monoclonal antibodies lgG+ memory B cells were isolated from cryopreserved peripheral blood mononuclear cells (PBMCs) of four ZIKV-infected donors (ZKA, ZKB, ZKC and ZKD) using CD22 microbeads (Miltenyi Biotec), followed by depletion of cells carrying IgM, IgD and IgA by cell sorting.
- PBMCs peripheral blood mononuclear cells
- ZKA ZIKV-infected donors
- ZKA ZKB
- ZKC ZKC
- ZKD CD22 microbeads
- Memory B cells from the ZIKV-infected donors were then immortalized with EBV (Epstein Barr Virus) and CpG (CpG oligodeoxynucleotide 2006) in multiple replicate wells as previously described (Traggiai, E.
- Neutralization assays were undertaken on Vero cells.
- ZIKV H/PF/2013 that resulted in an infection rate (m.o.i, multiplicity of infection) of 0.35 was incubated with superntanants for 1 h at 37% (5% C02) before the addition to pre-seeded 5 ⁇ 00 Vero cells. These were incubated for a further 5 days, after which supernatant was removed and WST-1 reagent (Roche) was added. Positive cultures were collected and expanded. From positive cultures the VH and VL sequences were retrieved by RT-PCR.
- Antibodies were cloned into human IgGI and Ig kappa or Ig lambda expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, US) essentially as described (Ti ller T, Meffre E, Yurasov S, Tsuij i M, Nussenzweig MC, Wardemann H (2008) Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 329: 1 12-124). Monoclonal antibodies were produced from EBV-immortalized B cells or by transient transfection of 293 Freestyle cells (Invitrogen).
- Figure 1 provides an overview over selected ZIKV neutralizing antibodies (cf. Tables 1 and 2 for the amino acid sequences of their CDRs and heavy/light chain variable regions). The last two columns of Figure 1 provide the neutralization activities (IC 50 ) of ZIKV and DENV1 (if tested).
- the other columns provide binding activities (ECso) of the antibodies to ZIKV E protein (ZIKV E), DENV1 E protein (DENV1 E), DENV2 E protein (DENV2 E), DENV3 E protein (DENV3 E), DENV4 E protein (DENV4 E), DENV1 virus-like particle (DENV1 VLP), DENV2 virus-like particle (DENV2 VLP), DENV3 virus-like particle (DENV3 VLP), DENV4 virus-like particle (DENV4 VLP), and to EDIII-domain of ZIKV E protein (Dill ZKA).
- Additional antibodies were isolated for their ability to bind to ZIKV NS1 protein (cf. Fig. 2). Positive cultures were collected and expanded. From positive cultures the VH and VL sequences were retrieved by RT-PCR. Antibodies were cloned into human lgG1 and Ig kappa or Ig lambda expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, US) essentially as described (Tiller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig MC, Wardemann H (2008) Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 329: 1 12-124).
- Monoclonal antibodies were produced from EBV-immortalized B cells or by transient transfection of 293 Freestyle cells (Invitrogen). Supernatants from B cel ls or transfected cel ls were collected and IgG were affinity purified by Protein A or Protein G chromatography (GE Healthcare) and desalted against PBS.
- Figure 2 provides an overview over selected ZIKV NS1 -protein binding antibodies (cf. Tables 4 and 5 for the amino acid sequences of their CDRs and heavy/light chain variable regions). Namely, Figure 2 provides binding activities (EC50) of the antibodies to ZIKV NS1 protein (ZIKV NS1 ), DENV1 NS1 protein (DENV1 NS1 ), DENV2 NS1 protein (DENV2 NS1 ), DENV3 NS1 protein (DENV3 NS1 ), DENV4 NS1 protein (DENV4 NS1 ), yellow-fever virus NS1 protein (YFV NS1 ), West-Nile virus NS1 protein (WNV NS1 ), Japanese-Encephalitis virus NS1 protein (JEV NS1 ), and to Tick-borne Encephalitis virus NS1 protein (TBEV NS1 ).
- Example 2 Characterization of antibodies ZKA190, ZKA1 85, ZKA230, ZKA64 and ZKA78
- Example 1 a large number of ZIKV-neutralizing antibodies were identified and characterized for their specificity to ZIKV, in particular ZIKV E protein and ZIKV EDIII as well as for their cross-reactivity towards DENV.
- Antibodies ZKA1 90 SEQ ID NOs: 1 - 1 8
- ZKA1 85 SEQ ID NOs: 1 9 - 36
- ZKA230 SEQ ID NOs: 37 - 54
- ZKA64 SEQ ID NOs: 73 - 90
- ZKA 78 SEQ ID NOs: 55 - 72
- ELISA ELISA plates were coated with ZIKV E protein at 1 or 3 pg/ml, blocked with 10% FCS in PBS, incubated with sera or human antibodies and washed. Bound antibodies were detected by incubation with AP-conjugated goat anti-human IgG (Southern Biotech). Plates were then washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The relative affinities of monoclonal antibody binding were determined by measuring the concentration of antibody (EC50) required to achieve 50% maximal binding at saturation.
- EC50 concentration of antibody
- results are shown in Figures 3 and 4.
- ZKA64 and ZKA1 90 bound to ZIKV E and ZIKV EDIII ("Dill Zl") with low EC50 values, thereby indicating that ZKA64 and ZKA1 90 are binding to domain III of ZIKV E protein (EDIII).
- ZKA78 bound to ZIKV E, but not to ZIKV EDIII, indicating that ZKA78 is binding to ZIKV E, but not targeting the EDIII region.
- ZKA1 85 and ZKA230 did not show any detectable binding to ZIKV E and ZIKV EDIII (Fig. 4).
- ZKA1 85 and ZKA230 were referred to as "neutralizing-non-E-binding" (NNB) antibodies.
- NNB antibodies are assumed to recognize quaternary epitopes that are displayed on the ZIKV infectious virions but not on soluble proteins.
- ZKA190, ZKA1 85, ZKA230, and ZKA64 showed any detectable binding to DENV E proteins ( Figure 1 , DENV1 -4 serotypes, and Figures 3 and 4), indicating that ZKA1 90, ZKA1 85, ZKA230, and ZKA64 are specific for ZIKV and not cross-reactive to dengue virus.
- ZKA78 in contrast, which is assumed to bind to ZIKV EDI/11, but not to ZIKV EDIII (cf. Fig. 3), bound to DENV E proteins ( Figures 1 and 3), indicating that ZKA78 is a cross-reactive antibody binding to both, ZIKV and DENV.
- ZKA64 and ZKA1 90 were additionally tested against E protein of dengue virus (DENV, serotypes number 1 - 4).
- ZKA64 and ZKA1 90 did not bind to DENV1 -4 E protein, thereby confirming that ZKA64 and ZKA1 90 are specific for ZIKV.
- ZKA78 in contrast, bound to DENV1 -4 E, confirming that ZKA78 is a cross-reactive antibody binding to the E protein of both ZIKV and DENV (cf. Fig. 1 ).
- Example 1 a large number of NSI -reactive antibodies were identified and then characterized for their specificity to ZIKV NSI and cross-reactivity towards other fiavivirus NS1 proteins (Fig. 2).
- Antibodies ZKA1 5 SEQ ID NOs: 91 - 1 08
- ZKA25 SEQ ID NOs: 1 09 - 1 26
- ZKA35 SEQ ID NOs: 127 - 1444
- ZIKV NS1 and DENV1 NS1 , DENV2 NS1 , DENV3 NS1 and DENV4 NS1 were then further characterized for binding to ZIKV NS1 and DENV1 NS1 , DENV2 NS1 , DENV3 NS1 and DENV4 NS1 .
- a standard ELISA was used.
- ELISA plates were coated with ZIKV NS1 protein at 1 pg/ml, blocked with 1 0% FCS in PBS, incubated with sera or human antibodies and washed. Bound antibodies were detected by incubation with AP-conjugated goat anti-human IgG (Southern Biotech). Plates were then washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The relative affinities of monoclonal antibody binding were determined by measuring the concentration of antibody (EC50) required to achieve 50% maximal binding at saturation. Results are shown in Figure 5. All three antibodies (ZKA1 5, ZKA25 and ZKA35) bound with high affinity to ZIKV NS1 but not to the DENV1 -4 NS1 antigens (Fig. 5).
- bio-layer interferometry competition assays were used.
- a cross-competition matrix was generated using biolayer interferometry (BLI; Octet) on 1 3 antibodies specific for ZIKV NS1 (i.e. not cross-reactive with DENV NS1 ), namely antibodies ZKA24, ZKA1 5, ZKA32, ZKA1 9, ZKA50, ZKA37, ZKA46, ZKA1 0, ZKA48, ZKA35, ZKA25, ZKA44, and ZKA30 (cf. Fig. 6A). As can be retrieved from Fig. 2 none of those 13 antibodies showed detectable binding to DENV NS1 .
- Biosensors After binding of the first set of mAbs (step 1 ), Biosensors were moved to wells containing different mAbs for 8 minutes (step 2). Association of the second mAb resulted in recognition of a different antigenic site compared to the first mAb (e.g. non-competition). Competition or partial competition were determined in step 2 when no association or low association was detected, respectively.
- a cross-competition matrix was created by multiple runs of competitions in order to predict antigenic site mapping on ZIKV NS1 .
- Results are shown in Figures 6A and 6C.
- all of the ZIKV NS1 -specific antibodies tested were binding to antigenic site(s) S1 and/or S2 (Fig. 6A).
- some of the antibodies did not compete with others.
- ZKA1 5 did not compete for binding with ZKA25 and ZKA35 and vice versa (Fig. 6A).
- antibody ZKA1 5 was assigned to the antigenic site S1
- antibodies ZKA25 and ZKA35 were assigned to the antigenic site S2 (Fig. 6C).
- antigenic sites (S1 and S2) on ZIKV NS1 were identified (Fig. 6C).
- Example 4 Use of ZIKV NS1 -specific antibodies in diagnosis of ZIKV infection
- the usefulness of the ZIKV NS1 -specific antibodies of the present invention in diagnosis of ZIKV infection was investigated. More specifically, the use of ZIKV NS1 -specific antibodies of the present invention to specifically detect the presence or absence of antibodies elicited against ZIKV NS1 in plasma samples of ZIKV- or DENV-infected donors was determined.
- a "blockade of binding" assay was used.
- the abi lity of ZIKV NS1 - reactive plasma antibodies to inhibit the binding of the biotinylated antibody ZKA35 to ZIKV NS1 was measured.
- ZIKV NS1 -specific antibody ZKA35 was biotinylated using the EZ-Link NHS-PEO solid phase biotinylation kit (Pierce). Labelled ZKA35 was tested for binding to ZIKV NS1 to determine the optimal concentration of ZKA35 to achieve 70% maximal binding.
- biotinylated anti-ZIKV NS1 antibody ZKA35 was added at the concentration achieving 70% maximal binding and the mixture was incubated at room temperature for 1 5 minutes. Plates were washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (1 -[(OD sample-OD neg ctr)/ (OD pos ctr-OD neg ctr)]) x 100.
- Example 5 The antibodies according to the present invention potently neutralize ZIKV infection
- the isolated antibodies ZKA1 90, ZKA1 85, ZKA230, ZKA64 and ZKA78 were tested for their ability to neutralize ZIKV and DENV1 infection in vitro.
- Neutralization of DENV and ZIKV infection by antibodies was measured using a micro- neutralization flow cytometry-based assay. Different dilutions of antibodies were mixed with ZIKV (MOI of 0.35) or attenuated DENV1 (all at MOI of 0.04) for 1 hour at 37°C and added to 5000 Vero cells/well in 96-well flat-bottom plates. After four days for ZIKV and five days for DENV, the cells were fixed with 2% formaldehyde, permeabilized in PBS 1 % FCS 0.5% saponin, and stained with the mouse mAb 4G2.
- the cells were incubated with a goat anti- mouse IgG conjugated to Alexa Fluor488 (Jackson Immuno- Research, 1 1 54851 64) and analyzed by flow cytometry. In other cases the ZIKV neutralization data are also determined measuring cell viability using the WST-1 reagent (Roche).
- the neutralization titer (50% inhibitory concentration [IC50]) was expressed as the antibody concentration that reduced the infection by 50% compared to cell-only control wells.
- Results are shown in Figures 8, 9 and 1 3.
- the EDIII-specific mAbs ZKA64 and ZKA1 90 and the NNB mAb ZKA230 were highly potent in ZIKV neutralization (strain H/PF/2013), with IC50 values of 93, 9 and 10 ng/ml, respectively ( Figure 8, upper panel).
- the cross- reactive antibody ZKA78 only partial ly neutralized ZIKV infectivity and cross-neutralized DENV1 infectivity ( Figure 8, lower panels).
- Simi lar data were obtained by measuring the ZIKV-induced cytopathic effect as measured with the WST-1 reagent ( Figure 9).
- NNB antibody ZKA1 85 was also included in the panel of tested antibodies and showed an IC50 similar to the most potent antibodies ZKA1 90 (EDIII-specific) and ZKA230 (NNB). It is important to note that the ultra-potent ZKA64 and ZKA1 90 antibodies in addition to their abi lity to neutralize the ZIKV H/PH/2013 strain (present example), also bound to the E protein and EDIII derived from the ZIKV strains MR766 and SPH201 5, respectively ( Figure 1 and Figure 3). ZKA1 90 and ZKA1 90-LALA was also confirmed to effectively neutralize two additional ZIKV strains (MR766 and MRS_OPY_Martinique_PaRi_201 5) (Fig. 13). Taken together the results indicate that the ultra-potent ZKA64 and ZKA1 90 antibodies cross-react with multiple strains of ZIKV belonging to different genotypes and origins (East African and Asian from Kenya, French Polynesia, Martinique and Brazil).
- Example 6 The "LALA” mutation inhibits antibody-dependent enhancement of ZIKV infection by serum antibodies
- Neutralizing antibodies were also tested for their ability to enhance the infection of ZIKV in the non-permissive K562 cells (antibody-dependent enhancement assay, ADE assay).
- ADE antibody-dependent enhancement assay
- ADE was measured by a flow based assay using K562 cells.
- Antibodies and ZIKV H/PF/201 3 (MOl 0.1 75) were mixed for 1 hour at 37°C and added to 5000 K562 cells/well. After four days, cells were fixed, permeabilized, and stained with m4G2. The number of infected cells was determined by flow cytometry.
- LALA variant In view thereof it was investigated whether ADE could be also induced by immune sera and whether this could be blocked by neutralizing antibodies delivered as a "LALA variant".
- each of the heavy chains was mutated at amino acids 4 and 5 of CH2 domain by substituting an alanine in place of the natural leucine using site-directed mutagenesis.
- LALA variants (of human IgGI antibodies) do not bind to Fc-gamma-receptors and complement.
- ZKA64-LALA antibody was used in ZIKV ADE. Since ADE of ZIKV is observed using ZIKV- or DENV-immune plasma, ZIKV (MOI 0.1 75) was mixed with plasma from primary ZIKV- or DENV-infected donors for 30 minutes at 37°C. ZKA64-LALA antibody was added at 50 pg/ml, mixed with 5000 K562 cells/well and incubated for three days. Cells were then stained with 4G2 and analyzed by flow cytometry.
- ADE effect of ZIKV- and DENV-immune plasma was completely blocked by the EDIII-specific ZKA64-LALA antibody.
- the ADE blocking ability of a single EDIII-specific LALA antibody could be related not only to its capacity to out-compete serum enhancing antibodies but also to neutralize virus once internalized into endosomes.
- a potently neutralizing antibody such as ZKA190, ZKA230, ZKA1 85 or ZKA64, developed in the "LALA" form, have a strong potential to be used in prophylactic or therapeutic settings to prevent congenital ZIKV infection, e.g. in pregnant women and/or in people living in high risk areas.
- the use of the LALA form avoids the risk of ZIKV ADE and, as shown above, could also block ADE of pre-existing cross-reactive antibodies, such as in the case of patients already immune to DENV.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Microbiology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Dermatology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (39)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2016/066684 WO2018010789A1 (en) | 2016-07-13 | 2016-07-13 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| SG11201809879WA SG11201809879WA (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| MYPI2018704108A MY190553A (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| HRP20231196TT HRP20231196T1 (hr) | 2016-07-13 | 2017-07-12 | Nova protutijela koja se specifično vežu na epitope zika virusa i njihova upotreba |
| CN201780042888.7A CN109563157B (zh) | 2016-07-13 | 2017-07-12 | 特异性地结合至寨卡病毒表位的新型抗体和其用途 |
| MX2019000526A MX2019000526A (es) | 2016-07-13 | 2017-07-12 | Anticuerpos nuevos que se unen especificamente a los epitopos del virus del zika y usos de los mismos. |
| UAA201901101A UA126381C2 (uk) | 2016-07-13 | 2017-07-12 | Нові антитіла, які специфічно зв'язуються з епітопами вірусу зіка, та їх застосування |
| AU2017297757A AU2017297757B2 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| BR112018074456-5A BR112018074456A2 (pt) | 2016-07-13 | 2017-07-12 | anticorpos que se ligam especificamente aos epítopos do zika vírus e usos dos mesmos |
| KR1020197004192A KR102595764B1 (ko) | 2016-07-13 | 2017-07-12 | 지카 바이러스 에피토프에 특이적으로 결합하는 신규 항체 및 그의 용도 |
| SI201731420T SI3484915T1 (sl) | 2016-07-13 | 2017-07-12 | Nova protitelesa, ki se specifično vežejo na epitope virusa zika, in njihova uporaba |
| EP17742985.9A EP3484915B1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| CR20190066A CR20190066A (es) | 2016-07-13 | 2017-07-12 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| JP2019501482A JP7252888B2 (ja) | 2016-07-13 | 2017-07-12 | ジカウイルスエピトープに特異的に結合する新規抗体及びその使用 |
| IL262710A IL262710B2 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| EA201990243A EA201990243A1 (ru) | 2016-07-13 | 2017-07-12 | Новые антитела, которые специфически связываются с эпитопами вируса зика, и их применения |
| LTEPPCT/EP2017/067581T LT3484915T (lt) | 2016-07-13 | 2017-07-12 | Naujo tipo antikūnai, specifiškai susirišantys su zika viruso epitopais, ir jų panaudojimas |
| EP23191207.2A EP4342911A1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| PE2019000034A PE20190398A1 (es) | 2016-07-13 | 2017-07-12 | Anticuerpos nuevos que se unen especificamente a los epitopos del virus del zika y usos de los mismos |
| DK17742985.9T DK3484915T5 (da) | 2016-07-13 | 2017-07-12 | Nye antistoffer, som specifikt binder til zika-virus-epitoper og anvendelse heraf |
| PH1/2018/502348A PH12018502348B1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| HUE17742985A HUE063272T2 (hu) | 2016-07-13 | 2017-07-12 | Zika-vírus epitópokhoz specifikusan kötõdõ új antitestek és alkalmazásaik |
| PCT/EP2017/067581 WO2018011283A1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| ES17742985T ES2959883T3 (es) | 2016-07-13 | 2017-07-12 | Nuevos anticuerpos que se unen específicamente a epítopos del virus del zika y usos de los mismos |
| US16/317,533 US11117954B2 (en) | 2016-07-13 | 2017-07-12 | Antibodies specifically binding to zika virus epitopes and uses thereof |
| CN202211721078.3A CN116199775A (zh) | 2016-07-13 | 2017-07-12 | 特异性地结合至寨卡病毒表位的新型抗体和其用途 |
| PL17742985.9T PL3484915T3 (pl) | 2016-07-13 | 2017-07-12 | Nowe przeciwciała swoiście wiążące się z epitopami wirusa zika i ich zastosowania |
| FIEP17742985.9T FI3484915T3 (fi) | 2016-07-13 | 2017-07-12 | Uusia zikavirusepitooppeihin spesifisesti sitoutuvia vasta-aineita ja niiden käyttöjä |
| CA3024374A CA3024374A1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| ZA2018/07467A ZA201807467B (en) | 2016-07-13 | 2018-11-07 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| DO2019000006A DOP2019000006A (es) | 2016-07-13 | 2019-01-08 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| CL2019000067A CL2019000067A1 (es) | 2016-07-13 | 2019-01-09 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos. |
| CONC2019/0001111A CO2019001111A2 (es) | 2016-07-13 | 2019-02-05 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| ECSENADI20199170A ECSP19009170A (es) | 2016-07-13 | 2019-02-07 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| DO2021000026A DOP2021000026A (es) | 2016-07-13 | 2021-02-10 | Anticuerpos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| US17/335,799 US20210363227A1 (en) | 2016-07-13 | 2021-06-01 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| US17/335,792 US11912757B2 (en) | 2016-07-13 | 2021-06-01 | Antibodies specifically binding to Zika virus epitopes and uses thereof |
| CL2021002994A CL2021002994A1 (es) | 2016-07-13 | 2021-11-12 | Anticuerpos nuevos que se unen específicamente a los epítopos del virus del zika y usos de los mismos. (divisional de la solicitud no. 201900067) |
| JP2023019144A JP2023062036A (ja) | 2016-07-13 | 2023-02-10 | ジカウイルスエピトープに特異的に結合する新規抗体及びその使用 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2016/066684 WO2018010789A1 (en) | 2016-07-13 | 2016-07-13 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018010789A1 true WO2018010789A1 (en) | 2018-01-18 |
Family
ID=56413654
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/066684 Ceased WO2018010789A1 (en) | 2016-07-13 | 2016-07-13 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| PCT/EP2017/067581 Ceased WO2018011283A1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/067581 Ceased WO2018011283A1 (en) | 2016-07-13 | 2017-07-12 | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
Country Status (31)
| Country | Link |
|---|---|
| US (3) | US11117954B2 (https=) |
| EP (2) | EP3484915B1 (https=) |
| JP (2) | JP7252888B2 (https=) |
| KR (1) | KR102595764B1 (https=) |
| CN (2) | CN116199775A (https=) |
| AU (1) | AU2017297757B2 (https=) |
| BR (1) | BR112018074456A2 (https=) |
| CA (1) | CA3024374A1 (https=) |
| CL (2) | CL2019000067A1 (https=) |
| CO (1) | CO2019001111A2 (https=) |
| CR (1) | CR20190066A (https=) |
| DK (1) | DK3484915T5 (https=) |
| DO (2) | DOP2019000006A (https=) |
| EA (1) | EA201990243A1 (https=) |
| EC (1) | ECSP19009170A (https=) |
| ES (1) | ES2959883T3 (https=) |
| FI (1) | FI3484915T3 (https=) |
| HR (1) | HRP20231196T1 (https=) |
| HU (1) | HUE063272T2 (https=) |
| IL (1) | IL262710B2 (https=) |
| LT (1) | LT3484915T (https=) |
| MX (1) | MX2019000526A (https=) |
| MY (1) | MY190553A (https=) |
| PE (1) | PE20190398A1 (https=) |
| PH (1) | PH12018502348B1 (https=) |
| PL (1) | PL3484915T3 (https=) |
| SG (1) | SG11201809879WA (https=) |
| SI (1) | SI3484915T1 (https=) |
| UA (1) | UA126381C2 (https=) |
| WO (2) | WO2018010789A1 (https=) |
| ZA (1) | ZA201807467B (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2019152666A (ja) * | 2018-03-02 | 2019-09-12 | 富士レビオ株式会社 | ジカウイルスを検出する方法及びキット |
| WO2020106358A1 (en) | 2018-11-20 | 2020-05-28 | Takeda Vaccines, Inc. | Novel anti-zika virus antibodies and uses thereof |
| US10829545B2 (en) | 2016-10-13 | 2020-11-10 | Massachusetts Institute Of Technology | Antibodies that bind Zika virus envelope protein and uses thereof |
| WO2020245663A1 (en) * | 2019-06-01 | 2020-12-10 | Institut Pasteur | Nanobody-based ns1 assay for the specific diagnosis of acute zika virus infection |
| JP2021130631A (ja) * | 2020-02-20 | 2021-09-09 | 国立感染症研究所長 | フラビウイルス交差中和抗体及び医薬組成物 |
| CN113498349A (zh) * | 2018-10-19 | 2021-10-12 | 胡默波斯生物医学公司 | 用于治疗狂犬病毒属病毒感染的抗体和方法 |
| WO2021236225A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
| WO2021236223A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for determining the potency of antigens |
| WO2021236845A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
| EP4061422A4 (en) * | 2019-11-19 | 2024-05-08 | Vanderbilt University | HUMAN ANTIBODIES THAT NEUTRALIZE ZIKA VIRUS AND METHODS OF USE THEREOF |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102405390B1 (ko) | 2016-07-13 | 2022-06-03 | 에보닉 오퍼레이션스 게엠베하 | 용해된 지질을 함유하는 바이오매스로부터 지질을 분리하는 방법 |
| WO2019042555A1 (en) | 2017-08-31 | 2019-03-07 | Humabs Biomed Sa | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
| EP3527664A1 (en) | 2018-02-15 | 2019-08-21 | Evonik Degussa GmbH | Method of isolating lipids from a lipids containing biomass |
| WO2019209974A2 (en) | 2018-04-24 | 2019-10-31 | The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. | Potent zika virus-specific and cross-neutralizing monoclonal antibodies to zika and dengue viruses following zikv infection or vaccination |
| WO2019219396A1 (en) | 2018-05-15 | 2019-11-21 | Evonik Operations Gmbh | Method of isolating lipids from a lysed lipids containing biomass by emulsion inversion |
| DK3794097T3 (da) | 2018-05-15 | 2024-12-16 | Evonik Operations Gmbh | Fremgangsmåde til isolering af lipider fra en lipid-indeholdende biomasse ved hjælp af hydrofob silica |
| WO2020061159A1 (en) * | 2018-09-20 | 2020-03-26 | Vanderbilt University | Human antibodies to zika virus |
| WO2020092564A1 (en) * | 2018-10-31 | 2020-05-07 | Icahn School Of Medicine At Mount Sinai | Human antibodies targeting zika virus ns1, ns1 polypeptides and uses thereof |
| WO2021050989A1 (en) * | 2019-09-13 | 2021-03-18 | Duke University | Zika antibodies and their use |
| KR20220093197A (ko) * | 2019-11-07 | 2022-07-05 | 인스티튜트 오브 마이크로바이올로지, 차이니즈 아카데미 오브 사이언스즈 | 지카/뎅기열 백신 및 이의 응용 |
| CN111138534B (zh) * | 2019-12-31 | 2021-09-28 | 武汉班科生物技术股份有限公司 | 寨卡病毒囊膜蛋白的鼠源单克隆抗体 |
| CN111100201B (zh) * | 2019-12-31 | 2021-09-28 | 武汉班科生物技术股份有限公司 | 针对寨卡病毒囊膜蛋白的鼠源单克隆抗体 |
| WO2022001803A1 (zh) * | 2020-06-28 | 2022-01-06 | 神州细胞工程有限公司 | 一种降低病毒ade效应的方法 |
| WO2022212858A2 (en) * | 2021-04-01 | 2022-10-06 | A2 Biotherapeutics, Inc. | Polypeptides targeting hla-a*11 and methods of use thereof |
| CN112921124B (zh) * | 2021-04-08 | 2021-09-28 | 广东创晟控股集团有限公司 | 一种快速检测病毒的试剂盒 |
| WO2024211789A1 (en) * | 2023-04-07 | 2024-10-10 | Fred Hutchinson Cancer Center | Cross-flavivirus binding domains and uses thereof |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL154600B (nl) | 1971-02-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| JPS5896026A (ja) | 1981-10-30 | 1983-06-07 | Nippon Chemiphar Co Ltd | 新規ウロキナ−ゼ誘導体およびその製造法ならびにそれを含有する血栓溶解剤 |
| DE3380726D1 (en) | 1982-06-24 | 1989-11-23 | Japan Chem Res | Long-acting composition |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| MY133346A (en) | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
| AU2003263853A1 (en) * | 2002-08-16 | 2004-03-03 | Board Of Regents The University Of Texas System | Compositions and methods related to flavivirus envelope protein domain iii antigens |
| AU2004215125B2 (en) | 2003-02-26 | 2011-01-06 | Institute For Research In Biomedicine | Monoclonal antibody production by EBV transformation of B cells |
| NZ544924A (en) | 2003-06-27 | 2009-03-31 | Biogen Idec Inc | Modified binding molecules comprising connecting peptides |
| EP2158318A2 (en) * | 2007-05-14 | 2010-03-03 | Biogen Idec MA, Inc. | Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto |
| PL2350128T3 (pl) | 2008-10-22 | 2015-03-31 | Inst Res Biomedicine | Sposoby wytwarzania przeciwciał z komórek plazmatycznych |
| MX367668B (es) * | 2013-03-15 | 2019-08-30 | Dana Farber Cancer Inst Inc | Anticuerpos neutralizadores de flavivirus y métodos de uso de los mismos. |
| CA3016697A1 (en) | 2016-03-11 | 2017-09-14 | The Johns Hopkins University | Live attenuated zika virus vaccine |
| US20170298119A1 (en) * | 2016-04-15 | 2017-10-19 | Visterra, Inc. | Antibody molecules to zika virus and uses thereof |
| TW201815821A (zh) | 2016-07-18 | 2018-05-01 | 美商再生元醫藥公司 | 抗茲卡病毒抗體及使用方法 |
| SI3658557T1 (sl) | 2017-07-28 | 2024-10-30 | Takeda Pharmaceutical Company Limited | Zaviralci TYK2 in njihova uporaba |
-
2016
- 2016-07-13 WO PCT/EP2016/066684 patent/WO2018010789A1/en not_active Ceased
-
2017
- 2017-07-12 EA EA201990243A patent/EA201990243A1/ru unknown
- 2017-07-12 MY MYPI2018704108A patent/MY190553A/en unknown
- 2017-07-12 CA CA3024374A patent/CA3024374A1/en active Pending
- 2017-07-12 CR CR20190066A patent/CR20190066A/es unknown
- 2017-07-12 KR KR1020197004192A patent/KR102595764B1/ko active Active
- 2017-07-12 CN CN202211721078.3A patent/CN116199775A/zh active Pending
- 2017-07-12 US US16/317,533 patent/US11117954B2/en not_active Expired - Fee Related
- 2017-07-12 EP EP17742985.9A patent/EP3484915B1/en active Active
- 2017-07-12 AU AU2017297757A patent/AU2017297757B2/en not_active Expired - Fee Related
- 2017-07-12 BR BR112018074456-5A patent/BR112018074456A2/pt not_active IP Right Cessation
- 2017-07-12 SI SI201731420T patent/SI3484915T1/sl unknown
- 2017-07-12 DK DK17742985.9T patent/DK3484915T5/da active
- 2017-07-12 FI FIEP17742985.9T patent/FI3484915T3/fi active
- 2017-07-12 PH PH1/2018/502348A patent/PH12018502348B1/en unknown
- 2017-07-12 IL IL262710A patent/IL262710B2/en unknown
- 2017-07-12 HR HRP20231196TT patent/HRP20231196T1/hr unknown
- 2017-07-12 UA UAA201901101A patent/UA126381C2/uk unknown
- 2017-07-12 HU HUE17742985A patent/HUE063272T2/hu unknown
- 2017-07-12 PL PL17742985.9T patent/PL3484915T3/pl unknown
- 2017-07-12 MX MX2019000526A patent/MX2019000526A/es unknown
- 2017-07-12 LT LTEPPCT/EP2017/067581T patent/LT3484915T/lt unknown
- 2017-07-12 JP JP2019501482A patent/JP7252888B2/ja active Active
- 2017-07-12 CN CN201780042888.7A patent/CN109563157B/zh active Active
- 2017-07-12 ES ES17742985T patent/ES2959883T3/es active Active
- 2017-07-12 SG SG11201809879WA patent/SG11201809879WA/en unknown
- 2017-07-12 WO PCT/EP2017/067581 patent/WO2018011283A1/en not_active Ceased
- 2017-07-12 PE PE2019000034A patent/PE20190398A1/es unknown
- 2017-07-12 EP EP23191207.2A patent/EP4342911A1/en not_active Withdrawn
-
2018
- 2018-11-07 ZA ZA2018/07467A patent/ZA201807467B/en unknown
-
2019
- 2019-01-08 DO DO2019000006A patent/DOP2019000006A/es unknown
- 2019-01-09 CL CL2019000067A patent/CL2019000067A1/es unknown
- 2019-02-05 CO CONC2019/0001111A patent/CO2019001111A2/es unknown
- 2019-02-07 EC ECSENADI20199170A patent/ECSP19009170A/es unknown
-
2021
- 2021-02-10 DO DO2021000026A patent/DOP2021000026A/es unknown
- 2021-06-01 US US17/335,792 patent/US11912757B2/en active Active
- 2021-06-01 US US17/335,799 patent/US20210363227A1/en not_active Abandoned
- 2021-11-12 CL CL2021002994A patent/CL2021002994A1/es unknown
-
2023
- 2023-02-10 JP JP2023019144A patent/JP2023062036A/ja active Pending
Non-Patent Citations (9)
| Title |
|---|
| ANONYMOUS: "C01864M datasheet", 3 May 2016 (2016-05-03), XP002767869, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01864M-1.pdf> [retrieved on 20170307] * |
| ANONYMOUS: "C01865M Datasheet", 23 June 2016 (2016-06-23), XP002767870, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01865M-1.pdf> [retrieved on 20160307] * |
| ANONYMOUS: "C01866M Datasheet", 26 April 2016 (2016-04-26), XP002767871, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01866M-1.pdf> [retrieved on 20170307] * |
| ANONYMOUS: "Choose the best ZIKA virus antibodies", XP002767866, Retrieved from the Internet <URL:https://www.arigobio.com/news/view/Zika_Virus> [retrieved on 20170307] * |
| ANONYMOUS: "Mouse anti-ZIKA virus antibodies NS1 antibody", XP002767867, Retrieved from the Internet <URL:https://thenativeantigencompany.com/product/mouse-anti-zika-virus-ns1-antibody-b4/> [retrieved on 20170307] * |
| ANONYMOUS: "Zika virus antigens and antibodies", XP002767868, Retrieved from the Internet <URL:http://www.amsbio.com/zika-virus-antigens-antibodies.aspx> [retrieved on 20170307] * |
| GIOVANNA BARBA-SPAETH ET AL: "Structural basis of potent Zika-dengue virus antibody cross-neutralization", NATURE, vol. 536, no. 7614, 23 June 2016 (2016-06-23), United Kingdom, pages 48 - 53, XP055328133, ISSN: 0028-0836, DOI: 10.1038/nature18938 * |
| K. STETTLER ET AL: "Specificity, cross-reactivity, and function of antibodies elicited by Zika virus infection", SCIENCE, vol. 353, no. 6301, 19 August 2016 (2016-08-19), pages 823 - 826, XP055352097, ISSN: 0036-8075, DOI: 10.1126/science.aaf8505 * |
| LIANPAN DAI ET AL: "Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody", CELL HOST & MICROBE, vol. 19, no. 5, 2 May 2016 (2016-05-02), NL, pages 696 - 704, XP055352074, ISSN: 1931-3128, DOI: 10.1016/j.chom.2016.04.013 * |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10829545B2 (en) | 2016-10-13 | 2020-11-10 | Massachusetts Institute Of Technology | Antibodies that bind Zika virus envelope protein and uses thereof |
| US11267873B2 (en) | 2016-10-13 | 2022-03-08 | Massachusetts Institute Of Technology | Antibodies that bind zika virus envelope protein and uses thereof |
| JP2019152666A (ja) * | 2018-03-02 | 2019-09-12 | 富士レビオ株式会社 | ジカウイルスを検出する方法及びキット |
| CN113498349A (zh) * | 2018-10-19 | 2021-10-12 | 胡默波斯生物医学公司 | 用于治疗狂犬病毒属病毒感染的抗体和方法 |
| JP2022507836A (ja) * | 2018-11-20 | 2022-01-18 | タケダ ワクチン,インコーポレイテッド | 新規の抗ジカウイルス抗体及びその使用 |
| WO2020106358A1 (en) | 2018-11-20 | 2020-05-28 | Takeda Vaccines, Inc. | Novel anti-zika virus antibodies and uses thereof |
| JP7463366B2 (ja) | 2018-11-20 | 2024-04-08 | タケダ ワクチン,インコーポレイテッド | 新規の抗ジカウイルス抗体及びその使用 |
| WO2020245663A1 (en) * | 2019-06-01 | 2020-12-10 | Institut Pasteur | Nanobody-based ns1 assay for the specific diagnosis of acute zika virus infection |
| EP4061422A4 (en) * | 2019-11-19 | 2024-05-08 | Vanderbilt University | HUMAN ANTIBODIES THAT NEUTRALIZE ZIKA VIRUS AND METHODS OF USE THEREOF |
| JP2021130631A (ja) * | 2020-02-20 | 2021-09-09 | 国立感染症研究所長 | フラビウイルス交差中和抗体及び医薬組成物 |
| EP4108773A4 (en) * | 2020-02-20 | 2024-03-27 | JAPAN as represented by DIRECTOR GENERAL of National Institute of Infectious Diseases | FLAVIVIRUS CROSS-NEUTRALIZING ANTIBODIES AND PHARMACEUTICAL COMPOSITION |
| JP7471555B2 (ja) | 2020-02-20 | 2024-04-22 | 国立感染症研究所長 | フラビウイルス交差中和抗体及び医薬組成物 |
| US12583912B2 (en) | 2020-02-20 | 2026-03-24 | Japan Institute For Health Security | Flavivirus cross neutralizing antibody and pharmaceutical composition |
| WO2021236845A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
| WO2021236223A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for determining the potency of antigens |
| WO2021236225A1 (en) | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11912757B2 (en) | Antibodies specifically binding to Zika virus epitopes and uses thereof | |
| US20240254207A1 (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| EP3359564A1 (en) | Antibodies that potently neutralize hepatitis b virus and uses thereof | |
| HK40002097B (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40002097A (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| EA046175B1 (ru) | Выделенное антитело или его антигенсвязывающий фрагмент, которые специфически связываются с эпитопом вируса зика, их получение и применения | |
| BR122024006890A2 (pt) | Anticorpo isolado, ou um fragmento de ligação ao antígeno do mesmo, molécula de ácido nucleico, vetor, célula, composição farmacêutica, uso dos mesmos, kit de partes, bem como ensaio de bloqueio de ligação para diagóstico in vitro de infecção por zika vírus | |
| HK40025147B (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40025147A (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40006233A (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40006233B (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16739097 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16739097 Country of ref document: EP Kind code of ref document: A1 |