WO2017087678A2 - Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof - Google Patents
Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof Download PDFInfo
- Publication number
- WO2017087678A2 WO2017087678A2 PCT/US2016/062540 US2016062540W WO2017087678A2 WO 2017087678 A2 WO2017087678 A2 WO 2017087678A2 US 2016062540 W US2016062540 W US 2016062540W WO 2017087678 A2 WO2017087678 A2 WO 2017087678A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- nos
- gitr
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- Glucocorticoid-induced TNFR-related protein a co-stimulatory molecule also known as TNFRSF18, AITR, CD357, and GITR-D
- GITR a co-stimulatory molecule also known as TNFRSF18, AITR, CD357, and GITR-D
- Other related members of the TNF receptor family include CD40, CD27, 4- 1BB, and OX40.
- GITR expression is low in naive CD4+ and CD8+ cells, it is constitutively expressed in regulatory T cells (Tone et al., PNAS 2003;100: 15059-64).
- GITR engagement promotes their activation, proliferation, and cytokine production (Watts, Annual Reviews in Immunology 2005;23:23-68).
- Regs CD4+CD25+ regulatory T cells
- GITR-L the ligand for GITR, is expressed at low levels in antigen-presenting cells (e.g., B cells, dendritic cells), but is transiently upregulated in these cells upon activation, e.g., by viral infection (Suvas et al., Virol. 2005;79: 11935-42).
- antigen-presenting cells e.g., B cells, dendritic cells
- viral infection e.g., by viral infection
- isolated antibodies such as monoclonal antibodies, in particular human monoclonal antibodies, that specifically bind GITR and have desirable functional properties. These properties include high affinity binding to human GITR, binding to monkey GITR (e.g., cynomolgus GITR), and the ability to stimulate antigen- specific T cell responses.
- the antibodies described herein can be used to stimulate antigen- specific T cell responses, such as in a tumor-bearing or virus-bearing (virus-infected) subject, and to detect GITR protein in a sample.
- isolated antibodies, or antigen binding portions thereof which bind to GITR and comprise a heavy chain constant region comprising (1) an amino acid sequence selected from the group consisting of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 or (2) a heavy chain constant region that differs therefrom in at most 5 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 223- 226, 283-290, 383-446 and 480-543, wherein the amino acid modification(s) are not at the specific amino acid(s) in SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 that are not present in the naturally-occurring human heavy chain constant regions.
- the antibodies exhibit at least one of the following properties:
- T cell activation e.g., antigen specific T cell activation
- the anti-GITR antibodies, or antigen binding portions thereof, described herein stimulate an anti-tumor immune response, for example, an antigen- specific T cell response.
- the anti-GITR antibodies, or antigen binding portions thereof increase cytokine production (e.g., IL-2 and/or IFN- ⁇ ) in GITR-expressing T cells and/or increase T cell proliferation.
- the anti-GITR antibodies, or antigen binding portions thereof do not bind to Fc receptors. In certain embodiments, the anti-GITR antibodies, or antigen binding portions thereof, bind to one or more FcyRs, e.g., activating or inhibitory, FcyRs.
- the anti-GITR antibodies, or antigen binding portions thereof bind to soluble human GITR with a K D of 10 nM or less as measured by Biacore, bind to membrane bound human GITR with a K D of 1 nM or less as measured by Scatchard, bind to membrane bound human GITR with an EC 50 of 1 nM or less as measured by FACS, bind to membrane bound cynomolgus GITR with an EC 50 of 10 nM or less as measured by FACS, induce or enhance T cell, e.g, T eff cell, activation without requiring multivalent cross-linking, inhibit the binding of GITR ligand to GITR with an EC 50 of 1 ⁇ g/mL or less as measured by FACS, and/or bind within the regions PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218) of mature human GITR (SEQ ID NO: 4).
- a heavy chain constant region comprising (1) an amino acid sequence selected from the group consisting of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 or (2) a heavy chain constant region that differs therefrom in at most 5 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543, wherein the amino acid modification(s) are not at the specific amino acid(s) in SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 that are not present in the naturally-occurring human heavy chain constant regions.
- heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 62, 63, and 64, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 65, 66, and 67, respectively;
- heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 62, 63, and 64, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 68, 69, and 70, respectively;
- heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 138, 139, and 140, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 144, 145, and 146, respectively; or
- (m) heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 342, 343, and 344, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 345, 346, and 347, respectively, and comprise a heavy chain constant region comprising (1) an amino acid sequence selected from the group consisting of SEQ ID NOs: 223-226, 283- 290, 383-446 and 480-543 or (2) a heavy chain constant region that differs therefrom in at most 5 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543, wherein the amino acid modification(s) are not at the specific amino acid(s) in SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 that are not present in the naturally-occurring human heavy chain constant regions.
- isolated monoclonal antibodies, or antigen binding portions thereof which bind to GITR and comprise heavy and light chain variable region sequences at least 85% identical, for example, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical, to the amino acid sequences selected from the group consisting of:
- isolated monoclonal antibodies, or antigen binding portions thereof which bind to GITR and comprise heavy chain and light chain sequences at least 80%, 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to the amino acid sequences selected from the group consisting of:
- the isolated monoclonal antibodies, or antigen binding portions thereof (a) bind to the same epitope on GITR as 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 9G7- 1, 9G7-2, 14E3, 19H8-1, 19H8-2 and/or 6G10, and (b) inhibit binding of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and/or 6G10 to GITR on activated T cells by at least 50%, 60%, 70%, 80% or 90% as measured by, e.g., FACS.
- the anti-GITR antibodies, or antigen binding portions thereof bind within the regions PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218) of mature human GITR (SEQ ID NO: 4). In some embodiments, the anti-GITR antibodies, or antigen binding portions thereof, described herein, bind to both human and cynomolgus GITR.
- the anti-GITR antibodies, or antigen-binding portions thereof are IgGl, IgG2, IgG3, or IgG4 antibodies, or variants thereof.
- the anti- GITR antibodies, or antigen-binding portions thereof comprise an effectorless IgGl Fc, for example, an effectorless IgGl Fc with the following mutations: L234A, L235E, G237A, A330S and P331S.
- the anti-GITR antibodies, or antigen-binding portions thereof comprise an Fc binding to, or having enhanced binding to, an activating FcyR, e.g., relative to a wild-type IgGl Fc.
- methionine residues in the CDR regions of the anti-GITR antibodies, or antigen-binding portions thereof are substituted for amino acid residues that do not undergo oxidation.
- the anti-GITR antibodies, or antigen-binding portions thereof are human or humanized antibodies.
- the modified heavy chain constant region comprises a heavy chain constant region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543 or a heavy chain constant region that differs therefrom in at most 5 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 223-226, 283-290, 383-446 and 480-543.
- the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227-275, 337, 339, 340, 348-352, 361, and 362, or a heavy chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227- 275, 337, 339, 340, 348-352, 361, and 362.
- the light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371 or a light chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371.
- bispecific molecules comprising an anti-GITR antibody linked to a molecule having a second binding specificity.
- nucleic acids encoding the heavy and/or light chain variable regions of the anti-GITR antibodies, or antigen binding portions thereof, expression vectors comprising the nucleic acid molecules, and cells transformed with the expression vectors.
- immunoconjugates comprising the anti-GITR antibodies described herein, linked to an agent.
- compositions comprising anti-GITR antibodies, or antigen binding portions thereof, and a carrier.
- kits comprising the anti-GITR antibodies, or antigen binding portions thereof, and instructions for use.
- a method of preparing the anti-GITR antibodies comprising expressing an anti-GITR antibody in a cell and isolating the antibody from the cell.
- a method of stimulating an antigen-specific T cell response comprising contacting the T cell with an anti-GITR antibody, or antigen binding portion thereof, such that an antigen-specific T cell response is stimulated.
- a method of activating or co- stimulating a T cell comprising contacting a cell, e.g., an effector T cell, with an anti-GITR antibody, or antigen binding portion thereof, and CD3, wherein the effector T cell is activated or co-stimulated.
- a method of increasing IL-2 and/or IFN- ⁇ production in and/or proliferation of a T cell comprising contacting the T cell with an effective amount of an anti- GITR antibody, or antigen binding portion thereof.
- a method of increasing IL-2 and/or IFN- ⁇ production in T cells in a subject comprising administering an effective amount of an anti-GITR antibody, or antigen binding portion thereof, bispecific molecule or conjugate comprising the anti-GITR antibody, or composition comprising the anti-GITR antibody, to increase IL-2 and/or IFN- ⁇ production from the T cells.
- a method of reducing or depleting the number of T regulatory cells in a tumor of a subject in need thereof comprising administering an effective amount of an anti-GITR antibody, or antigen binding portion thereof, bispecific molecule or conjugate wherein the antibody, or antigen binding portion thereof, has effector or enhanced effector function, to reduce the number of T regulatory cells in the tumor.
- a method of stimulating an immune response in a subject comprising administering an effective amount of an anti-GITR antibody, or antigen binding portion thereof, bispecific molecule or conjugate to the subject such that an immune response in the subject is stimulated.
- the subject has a tumor and an immune response against the tumor is stimulated.
- a method of inhibiting the growth of tumor cells in a subject comprising administering to the subject an anti-GITR antibody, or antigen binding portion thereof, bispecific molecule or conjugate such that growth of the tumor is inhibited in the subject.
- a method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount an anti-GITR antibody, or antigen binding portion thereof, bispecific molecule or conjugate comprising the anti-GITR antibody, or composition comprising the anti-GITR antibody, to treat the cancer.
- the cancer is bladder cancer, breast cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, sarcoma, and virus- related cancer.
- the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- the methods described herein futher comprise administering one or more additional therapeutics with a anti-GITR antibody, for example, an anti-PDl antibody, a LAG-3 antibody, a CTLA-4 antibody, and/or a PD-L1 antibody.
- a anti-GITR antibody for example, an anti-PDl antibody, a LAG-3 antibody, a CTLA-4 antibody, and/or a PD-L1 antibody.
- a method of detecting the presence of GITR in a sample comprising contacting the sample with an anti-GITR antibody, or an antigen binding portion thereof, under conditions that allow for formation of a complex between the antibody, or antigen binding portion thereof, and GITR, and detecting the formation of a complex.
- anti-GITR antibodies described herein for treating cancer, stimulating an immune response in a subject, stimulating an antigen- specific T cell response, activating or co- stimulating a T cell, increasing IL-2 and/or IFN- ⁇ production in and/or proliferation of a T cell, reducing or depleting the number of T regulatory cells in a tumor, and/or inhibiting the growth of tumor cells.
- Figure 1 shows the amino acid sequences of the heavy and light chain variable regions of monoclonal antibodies 28F3 (SEQ ID NO: 13 and 14, respectively), 18E10 (SEQ ID NO: 39 and 40, respectively), and 19D3 (SEQ ID NO: 26 and 27, respectively).
- the VH and VL CDRs of 28F3 are underlined.
- Figure 2A shows the nucleotide sequence (SEQ ID NO: 147) and amino acid sequence (SEQ ID NO: 13) of the heavy chain variable region of the 28F3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 20), CDR2 (SEQ ID NO: 21) and CDR3 (SEQ ID NO: 22) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 2B shows the nucleotide sequence (SEQ ID NO: 148) and amino acid sequence (SEQ ID NO: 14) of the kappa light chain variable region of the 28F3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 23), CDR2 (SEQ ID NO: 24) and CDR3 (SEQ ID NO: 25) regions are delineated and the V and J germline derivations are indicated.
- Figure 3A shows the nucleotide sequence (SEQ ID NO: 158) and amino acid sequence (SEQ ID NO: 39) of the heavy chain variable region of the 18E10 human monoclonal antibody.
- the CDRl (SEQ ID NO: 46), CDR2 (SEQ ID NO: 47) and CDR3 (SEQ ID NO: 48) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 3B shows the nucleotide sequence (SEQ ID NO: 159) and amino acid sequence (SEQ ID NO: 40) of the kappa light chain variable region of the 18E10 human monoclonal antibody.
- the CDRl (SEQ ID NO: 49), CDR2 (SEQ ID NO: 50) and CDR3 (SEQ ID NO: 51) regions are delineated and the V and J germline derivations are indicated.
- Figure 4A shows the nucleotide sequence (SEQ ID NO: 154) and amino acid sequence (SEQ ID NO: 26) of the heavy chain variable region of the 19D3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 33), CDR2 (SEQ ID NO: 34) and CDR3 (SEQ ID NO: 35) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 4B shows the nucleotide sequence (SEQ ID NO: 155) and amino acid sequence (SEQ ID NO: 27) of the kappa light chain variable region of the 19D3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 36), CDR2 (SEQ ID NO: 37) and CDR3 (SEQ ID NO: 38) regions are delineated and the V and J germline derivations are indicated.
- Figure 5A shows the nucleotide sequence (SEQ ID NO: 162) and amino acid sequence (SEQ ID NO: 52) of the heavy chain variable region of the 3C3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 62), CDR2 (SEQ ID NO: 63) and CDR3 (SEQ ID NO: 64) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 5B shows the nucleotide sequence (SEQ ID NO: 163) and amino acid sequence (SEQ ID NO: 53) of the kappa light chain variable region (VK1) of the 3C3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 65), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 67) regions are delineated and the V and J germline derivations are indicated.
- Figure 5C shows the nucleotide sequence (SEQ ID NO: 164) and amino acid sequence (SEQ ID NO: 54) of the kappa light chain variable region (VK2) of the 3C3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 68), CDR2 (SEQ ID NO: 69) and CDR3 (SEQ ID NO: 70) regions are delineated and the V and J germline derivations are indicated.
- Figure 6A shows the nucleotide sequence (SEQ ID NO: 168) and amino acid sequence (SEQ ID NO: 71) of the heavy chain variable region of the 2G6 human monoclonal antibody.
- the CDRl (SEQ ID NO: 78), CDR2 (SEQ ID NO: 79) and CDR3 (SEQ ID NO: 80) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 6B shows the nucleotide sequence (SEQ ID NO: 169) and amino acid sequence (SEQ ID NO: 72) of the kappa light chain variable region of the 2G6 human monoclonal antibody.
- the CDRl (SEQ ID NO: 81), CDR2 (SEQ ID NO: 82) and CDR3 (SEQ ID NO: 83) regions are delineated and the V and J germline derivations are indicated.
- Figure 7A shows the nucleotide sequence (SEQ ID NO: 172) and amino acid sequence (SEQ ID NO: 84) of the heavy chain variable region of the 8A6 human monoclonal antibody.
- the CDRl (SEQ ID NO: 91), CDR2 (SEQ ID NO: 92) and CDR3 (SEQ ID NO: 93) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 7B shows the nucleotide sequence (SEQ ID NO: 173) and amino acid sequence (SEQ ID NO: 85) of the kappa light chain variable region of the 8A6 human monoclonal antibody.
- the CDRl (SEQ ID NO: 94), CDR2 (SEQ ID NO: 95) and CDR3 (SEQ ID NO: 96) regions are delineated and the V and J germline derivations are indicated.
- Figure 8A shows the nucleotide sequence (SEQ ID NO: 176) and amino acid sequence (SEQ ID NO: 97) of the heavy chain variable region of the 9G7 human monoclonal antibody.
- the CDRl (SEQ ID NO: 106), CDR2 (SEQ ID NO: 107) and CDR3 (SEQ ID NO: 108) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 8B shows the nucleotide sequence (SEQ ID NO: 177) and amino acid sequence (SEQ ID NO: 98) of the kappa light chain variable region (VK1) of the 9G7 human monoclonal antibody.
- the CDRl (SEQ ID NO: 109), CDR2 (SEQ ID NO: 110) and CDR3 (SEQ ID NO: 111) regions are delineated and the V and J germline derivations are indicated.
- Figure 8C shows the nucleotide sequence (SEQ ID NO: 178) and amino acid sequence (SEQ ID NO: 99) of the kappa light chain variable region (VK2) of the 9G7 human monoclonal antibody.
- the CDRl (SEQ ID NO: 112), CDR2 (SEQ ID NO: 113) and CDR3 (SEQ ID NO: 114) regions are delineated and the V and J germline derivations are indicated.
- Figure 9A shows the nucleotide sequence (SEQ ID NO: 182) and amino acid sequence (SEQ ID NO: 115) of the heavy chain variable region of the 14E3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 122), CDR2 (SEQ ID NO: 123) and CDR3 (SEQ ID NO: 124) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 9B shows the nucleotide sequence (SEQ ID NO: 183) and amino acid sequence (SEQ ID NO: 116) of the kappa light chain variable region of the 14E3 human monoclonal antibody.
- the CDRl (SEQ ID NO: 125), CDR2 (SEQ ID NO: 126) and CDR3 (SEQ ID NO: 127) regions are delineated and the V and J germline derivations are indicated.
- Figure 10A shows the nucleotide sequence (SEQ ID NO: 186) and amino acid sequence (SEQ ID NO: 128) of the heavy chain variable region of the 19H8 human monoclonal antibody.
- the CDRl (SEQ ID NO: 138), CDR2 (SEQ ID NO: 139) and CDR3 (SEQ ID NO: 140) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 10B shows the nucleotide sequence (SEQ ID NO: 187) and amino acid sequence (SEQ ID NO: 129) of the kappa light chain variable region (VK1) of the 19H8 human monoclonal antibody.
- the CDRl (SEQ ID NO: 141), CDR2 (SEQ ID NO: 142) and CDR3 (SEQ ID NO: 143) regions are delineated and the V and J germline derivations are indicated.
- Figure IOC shows the nucleotide sequence (SEQ ID NO: 188) and amino acid sequence (SEQ ID NO: 130) of the kappa light chain variable region (VK2) of the 19H8 human monoclonal antibody.
- the CDRl (SEQ ID NO: 144), CDR2 (SEQ ID NO: 145) and CDR3 (SEQ ID NO: 146) regions are delineated and the V and J germline derivations are indicated.
- Figure 11A shows the nucleotide sequence (SEQ ID NO: 353) and amino acid sequence (SEQ ID NO: 335) of the heavy chain variable region of the 6G10 human monoclonal antibody.
- the CDRl (SEQ ID NO: 342), CDR2 (SEQ ID NO: 343) and CDR3 (SEQ ID NO: 344) regions are delineated and the V, D and J germline derivations are indicated.
- Figure 11B shows the nucleotide sequence (SEQ ID NO: 354) and amino acid sequence (SEQ ID NO: 336) of the kappa light chain variable region of the 6G10 human monoclonal antibody.
- the CDRl (SEQ ID NO: 345), CDR2 (SEQ ID NO: 346) and CDR3 (SEQ ID NO: 347) regions are delineated and the V and J germline derivations are indicated.
- Figure 12 shows an alignment of the amino acid sequence of the heavy chain variable regions of 28F3 (SEQ ID NO: 13) with the human germline V H 3-33, 3-10 and JH6 amino acid sequences (SEQ ID NOs: 192, 193, and 196, respectively).
- Figure 13 shows an alignment of the amino acid sequence of the light chain variable region of 28F3 (SEQ ID NO: 14) with the human germline V K LI 8 and JK2 amino acid sequences (SEQ ID NOs: 204 and 205, respectively).
- Figure 14 shows an alignment of the amino acid sequence of the heavy chain variable regions of 18E10 (SEQ ID NO: 39) with the human germline V H 3-33, 6-19, and JH6 amino acid sequences (SEQ ID NOs: 192, 199, and 197, respectively).
- Figure 15 shows an alignment of the amino acid sequence of the light chain variable region of 18E10 (SEQ ID NO: 40) with the human germline V K L15 and JK2 amino acid sequences (SEQ ID NO: 207 and 205, respectively).
- Figure 16 shows an alignment of the amino acid sequence of the heavy chain variable regions of 19D3 (SEQ ID NO: 26) with the human germline V H 3-33, 3-16, and JH6 amino acid sequences (SEQ ID NOs: 192, 200, and 198, respectively).
- Figure 17 shows an alignment of the amino acid sequence of the light chain variable region of 19D3 (SEQ ID NO: 27) with the human germline V K L15 and JK2 amino acid sequences (SEQ ID NOs: 207 and 205, respectively).
- Figure 18 shows an alignment of the amino acid sequence of the heavy chain variable regions of 3C3 (SEQ ID NO: 52) with the human germline V H 4-34 and JH3 amino acid sequences (SEQ ID NOs: 201 and 202, respectively).
- Figure 19A shows an alignment of the amino acid sequence of the light chain variable region (VK1) of 3C3 (SEQ ID NO: 53) with the human germline V k L15 and JK2 amino acid sequences (SEQ ID NOs: 207 and 205, respectively).
- Figure 19B shows an alignment of the amino acid sequence of the light chain variable region (VK2) of 3C3 (SEQ ID NO: 54) with the human germline V k L20 and JK2 amino acid sequences (SEQ ID NOs: 208 and 206, respectively).
- Figure 20 shows an alignment of the amino acid sequence of the heavy chain variable regions of 2G6 (SEQ ID NO: 71) with the human germline V H 3-33 and JH6 amino acid sequences (SEQ ID NOs: 192 and 197, respectively).
- Figure 21 shows an alignment of the amino acid sequence of the light chain variable region of 2G6 (SEQ ID NO: 72) with the human germline V k L15 and JK2 amino acid sequences (SEQ ID NOs: 207 and 205, respectively).
- Figure 22 shows an alignment of the amino acid sequence of the heavy chain variable regions of 8A6 (SEQ ID NO: 84) with the human germline V H 3-33, 3-10, and JH6 amino acid sequences (SEQ ID NOs: 192, 193, and 197, respectively).
- Figure 23 shows an alignment of the amino acid sequence of the light chain variable region of 8A6 (SEQ ID NO: 85) with the human germline V k LI 8 and JK2 amino acid sequences (SEQ ID NOs: 204 and 205, respectively).
- Figure 24 shows an alignment of the amino acid sequence of the heavy chain variable regions of 9G7 (SEQ ID NO: 97) with the human germline V H 3-15, 3-10, and JH6 amino acid sequences (SEQ ID NOs: 203, 194, and 198, respectively).
- Figure 25A shows an alignment of the amino acid sequence of the light chain variable region (VK1) of 9G7 (SEQ ID NO: 98) with the human germline V k A27 and JK1 amino acid sequences (SEQ ID NOs: 209 and 210, respectively).
- Figure 25B shows an alignment of the amino acid sequence of the light chain variable region (VK2) of 9G7 (SEQ ID NO: 99) with the human germline V k A27 and JK5 amino acid sequences (SEQ ID NOs: 209 and 212, respectively).
- Figure 26 shows an alignment of the amino acid sequence of the heavy chain variable regions of 14E3 (SEQ ID NO: 115) with the human germline V H 4-34 and JH3 amino acid sequences (SEQ ID NOs: 201 and 202, respectively).
- Figure 27 shows an alignment of the amino acid sequence of the light chain variable region of 14E3 (SEQ ID NO: 116) with the human germline V k L15 and JK1 amino acid sequences (SEQ ID NOs: 207 and 211, respectively).
- Figure 28 shows an alignment of the amino acid sequence of the heavy chain variable regions of 19H8 (SEQ ID NO: 128) with the human germline V H 3-33, 3-10, and JH6 amino acid sequences (SEQ ID NOs: 192, 195, and 196, respectively).
- Figure 29A shows an alignment of the amino acid sequence of the light chain variable region (VK1) of 19H8 (SEQ ID NO: 129) with the human germline V k L18 and JK1 amino acid sequences (SEQ ID NOs: 204 and 211, respectively).
- Figure 29B shows an alignment of the amino acid sequence of the light chain variable region (VK2) of 19H8 (SEQ ID NO: 130) with the human germline V k L6 and JK4 amino acid sequences (SEQ ID NOs: 213 and 214, respectively).
- Figure 30 shows an alignment of the amino acid sequence of the heavy chain variable regions of 6G10 (SEQ ID NO: 335) with the human germline V H 3-33, 3-10, and JH6 amino acid sequences (SEQ ID NOs: 192, 195, and 196, respectively).
- Figure 31 shows an alignment of the amino acid sequence of the light chain variable region (VK1) of 6G10 (SEQ ID NO: 336) with the human germline V k L18 and JK2 amino acid sequences (SEQ ID NOs: 204 and 205, respectively).
- Figure 32 shows the binding affinity (in nM) of various anti-GITR antibodies for activated human T cells, with no antibody, IgGl, and hIgG2 antibody controls, as assessed by FACS.
- Figure 33 shows the binding affinity (in nM) of various anti-GITR antibodies for activated cynomolgus T cells, with no antibody and hlgGl and hIgG2 antibodies as controls, as assessed by FACS.
- Figures 34A and 34B show the ability of various anti-GITR antibodies to inhibit the binding of GITR ligand (GITR-L) to GITR 3A9 cells, with hlgGl, hIgG2, no antibody, and cells alone as controls.
- GITR-L GITR ligand
- Figure 34C shows binding of recombinant GITR-L to activated human CD4 and CD8 T cells.
- Figure 34D shows that GITR-L partially blocks binding of 28F3-hIgGl to activated human CD4+ T Cells. The binding of 28F3-hIgGl at a fixed concentration of 0.5 ⁇ g/mL to activated T cells was partially blocked by pre-bound GITR-L with an IC50 of 0.0024 ⁇ g/mL.
- Figure 34E shows that 28F3-hIgGl does not block the binding of 0.6 ⁇ g/ml of GITR-L to activated human T cells.
- pre-bound 28F3-hIgGl was unable to block GITR-L ranging from 100 mg/mL to 0.00056 mg/mL.
- Figure 34F shows that 28F3-hIgGl partially blocks the binding of 0.02 ⁇ g/ml of GITR-L to activated human T cells.
- the binding of GITR-L at a fixed concentration of 20 ng/mL to activated T cells was partially blocked by pre-bound 28F3-hIgGl with an IC50 of 0.075 ⁇ g/mL.
- Figure 35A shows a Western blot demonstrating that the anti-GITR antibody 28F3 binds to native, but not to denatured, human GITR, and that binding is not affected by the presence or absence of N-linked glyosylation.
- a "+" sign indicates samples treated with PNGase F to remove N-linked glycosylation.
- Figure 35B is a Coomassie blue stained gel showing the presence of all forms of human GITR before transfer onto the nitrocellulose for the Western blot analysis.
- Figure 36A-36B shows the binding of the 28F3 and 3C3 antibodies to native GITR fragments generated by digestion with Endoproteinase Arg-C (1), Endoproteinase Lys-C (2), Trypsin (3), Endoproteinase Glu-C (4), or Endoproteinase Asp-N (5).
- Figure 37 shows a heat map view of the anti-GITR antibody 28F3 binding to human GITR peptide fragments generated from digestion of a native human GITR protein with
- Endoproteinase Glu-C and Trypsin Endoproteinase Glu-C and Trypsin
- Glu-C and Trypsin Endoproteinase Arg-C
- Lys-C and Trypsin Endoproteinase Lys-C and Trypsin
- Trypsin or Endoproteinase Asp-N and Endoproteinase Glu-C ("AspN and GluC”), identifying the location of the epitope to which the 28F3 antibody binds ( boxed region).
- the amino acid sequence of the mature extracellular domain of human GITR is shown in dark grey and the sequence of mouse Fc, linked C- terminally to it is shown in light grey.
- Figure 38A shows the peptides in the flow-through fraction, after incubation of 28F3 coated beads to peptides resulting from a trypsin digestion of native human GITR.
- Figure 38B shows two main 28F3 bound peptides (indicated by an asterisk).
- Figure 38C shows the identification by LC-MS of the first of the two peaks in Figure 34B as corresponding to the N-terminal peptide having the sequence shown and lacking O-linked glycosylation.
- Figure 38D shows the identification by LC-MS of the second of the two peaks in Figure 34B as corresponding to the N-terminal peptide having the sequence shown and having an O- linked glycosylation on T20.
- Figure 38E shows the GITR peptide remaining following in situ digestion with endoproteinase Asp-N of a longer peptide that was incubated together with 28F3.
- Figure 39A shows a list of peptic peptides for recombinant human GITR/Fc and protein complex of recombinant human GITR/Fc and 28F3 IgGl, achieving a sequence coverage of 86% for the N-terminal region of GITR.
- Figure 39B shows the deuterium uptake levels by HDX mass spectrometry (MS) in the absence/presence of the 28F3 IgGl mAb ("GITR.6").
- Figure 39C depicts the two regions in mature human GITR bound by 28F3, as determined by HDX MS.
- Figure 40 shows the effects of various agonist anti-GITR antibodies on IL-2 secretion by 3A9-hGITR cells in the presence of plate-bound anti-CD3 antibodies.
- Figure 41A shows the effects of agonist anti-GITR antibodies 18E10, 13H2 (same as 28F3), and 28F3 on IL-2 secretion by 3A9-hGITR cells activated by a specific antigen.
- Figure 41B shows the effects of agonist anti-GITR antibodies 3C3 (shown as "GITR.3"), 28F3, 19D3, and 18E10 on IL-2 secretion by 3A9-hGITR cells activated by a specific antigen.
- Figure 42A shows the effects of various agonist anti-GITR HuMabs antibodies on interferon gamma (IFN- ⁇ ) secretion by T cells stimulated with CHO-OKT3 cells (i.e., CHO cells expressing OKT3 scfv).
- IFN- ⁇ interferon gamma
- Figure 42B shows the effects of the agonist anti-GITR antibody 28F3 on IL-2 secretion by CD4+ T cells stimulated with OKT3 expressing CHO cells, wherein the T cells are from a first donor.
- Figure 42C shows the effects of the anti-GITR antibody 28F3 on IFN- ⁇ secretion by CD4+ T cells stimulated with OKT3 expressing CHO cells, wherein the T cells are from the first donor.
- Figure 42D shows the effects of the anti-GITR antibody 28F3 on IL-2 secretion by CD4+ T cells stimulated with OKT3 expressing CHO cells, wherein the T cells are from a second donor.
- Figure 42E shows the effects of the anti-GITR antibody 28F3 on IFN- ⁇ secretion by CD4+ T cells stimulated with OKT3 expressing CHO cells, wherein the T cells are from the second donor.
- Figure 43 shows the effects of the anti-GITR antibody 28F3 (IgG2), 28F3-F(ab')2 fragment, and 28F3-Fab on IL-2 secretion by 3A9-hGITR cells stimulated with LK35.2 cells in the presence of HEL48-63 peptide.
- Figure 44 shows immunohistochemistry of human tonsil specimens with the monoclonal antibody 28F3-FITC.
- Figure 45A-45D show the effects of different isotypes of the rat anti-mouse GITR antibody, DTA-1, on anti-tumor activity measured by changes in the tumor volumes in individual mice treated with these isotypes in a MC38 colon adenocarcinoma model: (Figure 45A) control mouse IgGl antibody (10 mg/kg); ( Figure 45B) DTA-1 rat IgG2b (10 mg/kg); (Figure 45C) DTA-1 mouse IgGl (10 mg/kg); ( Figure 45D) DTA-1 mouse IgG2a (10 mg/kg). The number of tumor free (TF) mice per group is shown for each group of 10 mice.
- Figures 46A and 46B show the changes in mean (Figure 46A) and median tumor volumes (Figure 46B) of MC38 tumors in groups of mice treated with DTA-1 antibodies (10 mg/kg) of different isotypes.
- Figures 47A-47F show a flow cytometric analysis of spleens (Figures 47A-47C) and tumor infiltrating lymphocytes (TILs) ( Figures 47D-47F) from MC38 tumor-bearing mice treated with the different anti-GITR (DTA-1) and anti-CTLA-4 (9D9) isotypes and control antibody indicated.
- FIG. 47 A Percentage of CD8 + T cells in spleen
- Figure 47B Percentage of CD4 + cells in spleen
- Figure 47C Percentage of CD4 + cells that are also Foxp3 + in spleen
- Figure 47D Percentage of CD8 + T cells in TILs
- Figure 47E Percentage of CD4 + cells in TILs
- Figure 47F Percentage of CD4 + cells that are also Foxp3 + in TILs.
- Figures 48A-48F show the effects of different isotypes of the rat anti-mouse GITR antibody, DTA-1, re-engineered to minimize aggregation (referred to as "mGITR.7”), on antitumor activity as measured by changes in the tumor volumes in individual mice treated with these isotypes in a MC38 model:
- Figure 48 A control mouse IgGl antibody
- Figure 48B niGITR.7 mlgGl
- Figure 48C niGITR.7 mIgGl-D265A
- Figure 48D niGITR.7 mIgG2a
- Figure 48E niGITR.7 mIgG2b
- Figure 48F niGITR.7 rat IgG2b.
- the number of TF mice per group is shown for each group of 9 mice.
- Figures 49A and 49B show the changes in mean (Figure 49A) and median tumor volumes (Figure 49B) of MC38 tumors in groups of mice treated with re-engineered DTA-1 antibodies of different isotypes.
- Figures 50A and 50B show a flow cytometric analysis of the effects of different DTA-1 (reengineered “mGITR” DTA-1 or the originally engineered “DTA-1” antibodies) and anti- CTLA-4 (9D9) isotypes on Foxp3 + /CD4 + T regs in spleens ( Figure 50A) and TILs ( Figure 50B) from MC38 tumor-bearing mice.
- Figures 51A-51E show the anti-tumor activity of different mouse DTA-1 isotypes in a SalN fibrosarcoma mouse model as measured by the changes in tumor volumes of individual mice treated with these isotypes: ( Figure 51 A) control mouse IgGl antibody; ( Figure 5 IB) DTA- 1 mouse IgG2a; ( Figure 51C) DTA-1 rat IgG2b; ( Figure 5 ID) DTA-1 mouse IgGl; ( Figure 5 IE) DTA-1 mouse IgGl-D265A. The number of TF mice per group is shown for each group of up to 10 mice.
- Figures 52A and 52B shows the changes in mean (Figure 52A) and median tumor volumes (Figure 52B) of SalN tumors in groups of mice treated with DTA-1 antibodies of different isotypes.
- Figures 53 A and 53B show the effects of different DTA-1 and anti-CTLA-4 (9D9) isotypes on Foxp3 + /CD4 + T regs in spleens ( Figure 53A) and TILs (Figure 53B) from SalN tumor- bearing mice.
- Figures 54A-54D show the effects of the rat anti-GITR antibody, DTA-1, on tumor volume using a staged MC38 colon adenocarcinoma model. Mice were treated with (Figure 54A) control mlgGl, ( Figure 54B) mlgG + DTA-1, ( Figure 54C) mlgG + PD-1, and ( Figure 54D) PD-1 + DTA-1 on days 7, 10, and 14. The number of tumor free (TF) mice per group is shown for each group of 10 mice.
- Figure 55A and 55B shows the effect of various combinations of mutations in VH CDR3 in anti-GITR antibody 28F3 on binding to 3A9-hGITR cells.
- Figure 56A-56F shows the effect of various combinations of mutations in VH CDR3 in anti-GITR antibody 28F3 on the level of IL-2 secretion from 3A9-hGITR cells in the presence of plate bound anti-CD3.
- Figure 57 shows the binding affinity of the indicated anti-GITR antibodies for activated T cells.
- the antibodies tested comprised one of the following heavy chain constant region: an IgGl constant region ("anti-GITR.glf"), an effectorless IgGl constant region ("anti-GITR. gl. If"), an IgG2 constant region ("anti-GITR-G2"), an IgG2 hinge and IgGl Fc domain (“anti- GITR.G2.Glf”), and an IgG2 hinge and effectorless IgGl Fc domain (“anti-GITR.G2.Gl. lf").
- Figures 58A-58C show the secretion of IFN- ⁇ and IL-2 from donor CD4 T cells stimulated with soluble anti-human GITR antibodies with different heavy chain constant regions.
- Figure 58A shows IFN- ⁇ secretion from donor CD4 T cells stimulated with OKT3 expressing CHO cells and various concentrations of anti-human GITR antibodies with an IgG2-IgGl constant region.
- Figure 58B shows IL-2 secretion from donor CD4 T cells stimulated with OKT3 expressing CHO cells and various concentrations of an IgGl heavy chain constant domain or an IgG2-IgGl hybrid heavy chain constant domain.
- Figure 58C shows and IL-2 secretion from donor CD4 T cells stimulated with OKT3 expressing CHO cells and various concentrations of effectorless versions (IgGl.l) of the antibodies in Figures 55 A and B.
- Figure 59 shows a comparison of the indicated anti-GITR antibodies on IL-2 secretion from 3A9-hGITR cells in the presence of plate bound anti-CD3.
- Figures 60A-60D show the effect of 28F3.IgGl and 28F3.IgGl.l on the proliferation of Treg and Teff cells.
- Figures 61A-61F show the effect of 28F3.IgGl ("GITR.6IgGl”) and 28F3.IgGl.l ("GITR.6IgGl. l”) on NK cell induced lysis of activated CD4+ cells, CD8+ cells and Treg- enriched cells from two different donors.
- Figures 62A-62C show the effect of a control hlgGl antibody, 28F3.IgGl ("anti-GITR IgGl"), and 28F3.IgGl.l (anti-GITR IgGl.l ”) on the growth of MC38 tumors.
- Figures 63A and 63B show the mean volume and median volume, respectively, of MC38 tumors in mice treated with control hlgGl antibody, 28F3.IgGl ("anti-GITR IgGl "), and 28F3.IgGl. l ("anti-GITR IgGl.l ").
- Figures 64A and 64B show the mean % body weight change and median % body weight change, respectively, of mice with MC38 tumors treated with control hlgGl antibody,
- Figure 65 shows the effects of 28F3.IgGl ("GITR IgGl”), relative to isotype control, on the depletion of Treg cells in the MC38 tumor model.
- Figure 66 shows the effects of 28F3.IgGl ("GITR IgGl”), relative to isotype control, on the percentage of CD8+ T cells in the MC38 tumor model.
- Figure 67 shows the effect of soluble and cross-linked 28F3.IgGl ("GITR.6IgGl”) and 28F3.IgGl. l ("GITR.6IgGl.l”) on IFN- ⁇ secretion from T cells when co-cultured with CHO- OKT3 and CHO-OKT3-CD32a cells.
- Figure 68 shows the effect of soluble and cross-linked 28F3.IgGl ("GITR.6IgGl”) and 28F3.IgGl. l ("GITR.6IgGl.l”) on T cell proliferation when co-cultured with CHO-OKT3 and CHO-OKT3-CD32a cells.
- Figure 69 shows the level of IL-2 secreted by CD4+ T cells co-cocultured with CHO- OKT3 cells in the presence of an anti-GITR antibody having the indicated constant regions.
- Figure 70 shows antibody binding to anti-his Fab captured FcyR-his proteins. Binding responses are plotted as a percentage of the theoretical Rmax assuming a 1: 1 mAb:FcyR binding stoichiometry. The bars for each antibody are shown in the order provided by the color legends at the bottom of the slide.
- Figure 71 shows antibody binding to anti-his Fab captured FcgR-his proteins. Binding responses are plotted as a percentage of the theoretical Rmax assuming a 1: 1 mAb:FcyR binding stoichiometry. The bars for each antibody are shown in the order provided by the color legends at the bottom of the slide.
- Figure 72 shows an internalization time course analysis of anti-GITR antibodies.
- Figure 73A shows GITR and early endosome marker EEA2 co-localization analysis at time zero.
- Figure 73B shows GITR and early endosome marker EEA2 co-localization analysis at time 30 and 120 minutes.
- Figure 73C shows the results of quantification of endosomal co-localization shown in Figures 73A and 73B plotted as the ratio of colocalized pixel intensity relative to total staining.
- Figure 74A shows NFkB signaling activation in CD8+ T cells treated with the indicated anti-GITR antibodies.
- Figure 74B shows NFkB signaling activation in CD4+ T cells treated with the indicated anti-GITR antibodies.
- Figure 75 shows P38 activation in CD4+ T cells treated with the indicated anti-GITR antibodies.
- Figure 76A shows the level of IL-2 secreted by CD4+ T cells co-cocultured with CHO- OKT3 cells in the presence of different concentrations of an anti-GITR antibody having the indicated constant regions.
- Figure 76B shows the level of IL-2 secreted by CD4+ T cells co-cocultured with CHO- OKT3 cells in the presence of 5 ⁇ g/ml of an anti-GITR antibody having the indicated constant regions (same experiment as that in Figure 76A).
- Figure 76C shows the level of IL-2 secreted by CD4+ T cells co-cocultured with CHO- OKT3 cells in the presence of 1.25 ⁇ g/ml of an anti-GITR antibody having the indicated constant regions (same experiment as that in Figure 76A).
- Figure 76D shows the level of IL-2 secreted by CD4+ T cells co-cocultured with CHO- OKT3 cells in the presence of 0.313 ⁇ g/ml of an anti-GITR antibody having the indicated constant regions (same experiment as that in Figure 76A).
- Described herein are isolated antibodies, particularly monoclonal antibodies, e.g., human monocloncal antibodies, which specifically bind to GITR and thereby activate downstream GITR signaling ("agonist anti-GITR antibodies").
- the antibodies described herein are derived from particular heavy and light chain germline sequences and/or comprise particular structural features such as CDR regions comprising particular amino acid sequences.
- methods of using the antibodies for immune response enhancement alone or in combination with other immunostimulatory agents (e.g., antibodies) and/or cancer therapies. Accordingly, the anti-GITR antibodies described herein may be used in a treatment in a wide variety of therapeutic applications, including, for example, inhibiting tumor growth and treating viral infections.
- GITR GITR ligand
- GITR includes any variants or isoforms of GITR which are naturally expressed by cells. Accordingly, antibodies described herein may cross-react with GITR from species other than human (e.g., cynomolgus GITR). Alternatively, the antibodies may be specific for human GITR and may not exhibit any cross -reactivity with other species. GITR or any variants and isoforms thereof, may either be isolated from cells or tissues which naturally express them or be recombinantly produced using well-known techniques in the art and/or those described herein.
- Variant 1 (Accession No. NP_004186; SEQ ID NO: 1) consists of 241 amino acids and represents the longest transcript. It contains an extra coding segment that leads to a frame shift, compared to variant 2. The resulting protein (isoform 1) contains a distinct and shorter C-terminus, as compared to isoform 2.
- Variant 2 (Accession No. NP_683699; SEQ ID NO: 2) encodes the longest protein (isoform 2), consisting of 255 amino acids, and is soluble.
- Variant 3 (Accession No.
- NP_683700; SEQ ID NO: 3 contains an extra coding segment that leads to a frame shift, compared to variant 2.
- the resulting protein (isoform 3) contains a distinct and shorter C-terminus, as compared to isoform 2, and consists of 234 amino acids.
- Human GITR isoform 1 (Accession No. NP_004186; SEQ ID NO: 1; encoded by the nucleotide sequence having Accession No. NM_004195.2): MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRC
- Human GITR isoform 2 (Accession No. NP_683699.1; SEQ ID NO: 2; encoded by the nucleotide sequence having Accession No. NM_148901.1):
- Human GITR isoform 3 (Accession No. NP_683700.1; SEQ ID NO: 3; encoded by the nucleotide sequence having Accession No. NM_148902.1):
- the signal sequence of isoforms 1-3 corresponds to amino acids 1-25.
- the mature isoforms 1, 2 and 3 consist of amino acids 26 to 241, 255 or 234, respectively.
- the extracellular domain of mature GITR consists of amino acids 26-162 and has the amino acid sequence:
- QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSE WDCMCVQPEFHCGD PCCTTCRHHPCPPGQGVQS QGKFSFGFQCIDC AS GTFS GGHEGHCKPWTDCTQFGFLTV FPGNKTHNAVCVPGSPPAEP (SEQ ID NO: 4)
- Cynomolgus GITR protein sequence (SEQ ID NO: 5):
- Human GITR-L protein sequence (Accession No. NP_005083.2; SEQ ID NO: 6): MTLHPS PITCEFLFS TALIS PKMCLS HLENMPLS HS RTQG AQRS S WKLWLFCS IVMLLFLC SFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYG QVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV LKNNTYWGIILLANPQFIS
- antibody as used to herein includes whole antibodies and any antigen binding fragments (i.e. , “antigen-binding portions”) or single chains thereof.
- An “antibody” refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- VH heavy chain variable region
- L light chain constant region
- each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system.
- Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K D ) of 10 "5 to 10 "11 M or less. Any K D greater than about 10 "4 M is generally considered to indicate nonspecific binding.
- K D dissociation constant
- an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially
- an antigen is "substantially identical" to a given antigen if it exhibits a high degree of sequence identity to the given antigen, for example, if it exhibits at least 80%, at least 90%, preferably at least 95%, more preferably at least 97%, or even more preferably at least 99% sequence identity to the sequence of the given antigen.
- an antibody that binds specifically to human GITR may also have cross-reactivity with GITR antigens from certain primate species (e.g., cynomolgus GITR), but may not cross-react with GITR antigens from other species or with an antigen other than GITR.
- primate species e.g., cynomolgus GITR
- An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
- the IgG isotype is divided in subclasses in certain species: IgGl, IgG2, IgG3 and IgG4 in humans, and IgGl, IgG2a, IgG2b and IgG3 in mice.
- the anti-GITR antibodies described herein are of the IgGl or IgG2 subtype.
- Immunoglobulins, e.g., IgGl exist in several allotypes, which differ from each other in at most a few amino acids.
- Antibody includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies;
- chimeric and humanized antibodies include human and nonhuman antibodies; wholly synthetic antibodies; and single chain antibodies.
- antigen-binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human GITR). Such “fragments” are, for example between about 8 and about 1500 amino acids in length, suitably between about 8 and about 745 amino acids in length, suitably about 8 to about 300, for example about 8 to about 200 amino acids, or about 10 to about 50 or 100 amino acids in length. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CHI domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
- a Fab fragment a monovalent fragment consisting of the V L , V H , CL
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Antigen- binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
- bispecific or “bifunctional antibody” is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et ah, J. Immunol. 148, 1547-1553 (1992).
- the term "monoclonal antibody,” as used herein, refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to an antibody or antibody composition that display(s) a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal ⁇ e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e. , have at least 80% identity).
- Human antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g. , mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term “human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a “humanized” antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
- a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
- a “chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
- isotype refers to the antibody class (e.g. , IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
- antibody class e.g. , IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody
- Allotype refers to naturally occurring variants within a specific isotype group, which variants differ in a few amino acids (see, e.g., Jefferis et al. (2009) mAbs 1 : 1). Antibodies described herein may be of any allotype. As used herein, antibodies referred to as "IgGlf ' or "IgGl . If ' isotype are IgGl and effectorless IgGl .
- an antibody recognizing an antigen and "an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
- an "isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g. , an isolated antibody that specifically binds to GITR is substantially free of antibodies that specifically bind antigens other than GITR).
- An isolated antibody that specifically binds to an epitope of GITR may, however, have cross -reactivity to other GITR proteins from different species.
- an antibody that "inhibits binding of GITR-L to GITR” is intended to refer to an antibody that inhibits the binding of GITR-L to GITR, e.g., in binding assays using 3A9-hGITR cells, with an EC50 of about 1 ⁇ g/mL or less, such as about 0.9 ⁇ g/mL or less, about 0.85 ⁇ g/mL or less, about 0.8 ⁇ g/mL or less, about 0.75 ⁇ g/mL or less, about 0.7 ⁇ g/mL or less, about 0.65 ⁇ g/mL or less, about 0.6 ⁇ g/mL or less, about 0.55 ⁇ g/mL or less, about 0.5 ⁇ g/mL or less, about 0.45 ⁇ g/mL or less, about 0.4 ⁇ g/mL or less, about 0.35 ⁇ g/mL or less, about 0.3 ⁇ g/mL or less, about 0.25 ⁇ g/mL or less
- effector function refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event that results therefrom.
- exemplary “effector functions” include Clq binding, complement dependent cytotoxicity (CDC), Fc receptor binding, FcyR- mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP), and downregulation of a cell surface receptor (e.g., the B cell receptor; BCR).
- CDC complement dependent cytotoxicity
- Fc receptor binding FcyR- mediated effector functions
- ADCP antibody dependent cell-mediated phagocytosis
- BCR B cell surface receptor
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain).
- Fc receptor or “FcR” is a receptor that binds to the Fc region of an immunoglobulin.
- FcRs that bind to an IgG antibody comprise receptors of the FcyR family, including allelic variants and alternatively spliced forms of these receptors.
- the FcyR family consists of three activating (FcyRI, FcyRIII, and FcyRIV in mice; FcyRIA, FcyRIIA, and FcyRIIIA in humans) and one inhibitory (FcyRIIB) receptor.
- Table 1 Various properties of human FcyRs are summarized in Table 1.
- NK cells selectively express one activating Fc receptor (FcyRIII in mice and FcyRIIIA in humans) but not the inhibitory FcyRIIB in mice and humans.
- Human IgGl binds to most human Fc receptors and is considered equivalent to murine IgG2a with respect to the types of activating Fc receptors that it binds to.
- Fc region fragment crystallizable region
- Fc domain fragment crystallizable region
- Fc domain refers to the C- terminal region of the heavy chain of an antibody that mediates the binding of the
- an Fc region comprises the constant region of an antibody excluding the first constant region immunoglobulin domain (e.g., CHI or CL).
- the Fc region comprises two identical protein fragments, derived from the second (Cm) and third (CH 3 ) constant domains of the antibody's two heavy chains; IgM and IgE Fc regions comprise three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
- the Fc region comprises immunoglobulin domains Cy2 and Cy3 and the hinge between Cyl and Cy2.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position C226 or P230 (or amino acid between these two amino acids) to the carboxy-terminus of the heavy chain, wherein the numbering is according to the EU index as in Kabat.
- the CH2 domain of a human IgG Fc region extends from about amino acid 231 to about amino acid 340, whereas the CH domain is positioned on C-terminal side of a Cm domain in an Fc region, i.e.
- the Fc region may be a native sequence Fc, including any allotypic variant, or a variant Fc (e.g., a non-naturally occurring Fc). Fc may also refer to this region in isolation or in the context of an Fc-comprising protein polypeptide such as a "binding protein comprising an Fc region," also referred to as an "Fc fusion protein” (e.g., an antibody or immunoadhesin).
- a “native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- Native sequence Fc include the various allotypes of Fes (see, e.g., Jefferis et al. (2009) mAbs 1 : 1).
- a “hinge”, “hinge domain” or “hinge region” or “antibody hinge region” refers to the domain of a heavy chain constant region that joins the CHI domain to the CH2 domain and includes the upper, middle, and lower portions of the hinge (Roux et al. J. Immunol. 1998 161 :4083).
- the hinge provides varying levels of flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular disulfide bonding between the two heavy chain constant regions.
- a hinge starts at Glu216 and ends at Gly237 for all IgG isotypes (Roux et al., 1998 J Immunol 161 :4083).
- the sequences of wildtype IgGl, IgG2, IgG3 and IgG4 hinges are show in Tables 2 and 9. Table 2.
- hinge includes wildtype hinges (such as those set forth in Table 15), as well as variants thereof (e.g., non-naturally-occurring hinges or modified hinges).
- IgG2 hinge includes wildtype IgG2 hinge, as shown in Table 15, and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- Exemplary IgG2 hinge variants include IgG2 hinges in which 1, 2, 3 or all 4 cysteines (C219, C220, C226 and C229) are changed to another amino acid.
- an IgG2 comprises a C219S substitution.
- a hinge is a hybrid hinge that comprises sequences from at least two isotypes.
- a hinge may comprise the upper, middle or lower hinge from one isotype and the remainder of the hinge from one or more other isotypes.
- a hinge can be an IgG2/IgGl hinge, and may comprise, e.g., the upper and middle hinges of IgG2 and the lower hinge of IgGl.
- a hinge may have effector function or be deprived of effector function.
- the lower hinge of wildtype IgGl provides effector function.
- CHI domain refers to the heavy chain constant region linking the variable domain to the hinge in a heavy chain constant domain.
- a CHI domain starts at Al 18 and ends at V215.
- the term "CHI domain” includes wildtype CHI domains (such as having SEQ ID NO: 278 for IgGl and SEQ ID NO: 279 for IgG2; Table 15), as well as variants thereof (e.g., non-naturally-occurring CHI domains or modified CHI domains).
- the term "CHI domain” includes wildtype CHI domains and variants having 1, 2, 3, 4, 5, 1-3, 1- 5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- Exemplary CHI domains include CHI domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CHI domain that affect a biological activity of an antibody are provided herein.
- CH2 domain refers to the heavy chain constant region linking the hinge to the CH3 domain in a heavy chain constant domain. As used herein, a CH2 domain starts at P238 and ends at K340.
- CH2 domain includes wildtype CH2 domains (such as having SEQ ID NO: 280 for IgGl and SEQ ID NO: 297 for IgG2; Table 15), as well as variants thereof (e.g., non-naturally-occurring CH2 domains or modified CH2 domains).
- CH2 domain includes wildtype CH2 domains and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- exemplary CH2 domains include CH2 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life.
- a CH2 domain comprises the substitutions A330S/P331S that reduce effector function.
- Other modifications to the CH2 domain that affect a biological activity of an antibody are provided herein.
- CH3 domain refers to the heavy chain constant region that is C-terminal to the CH2 domain in a heavy chain constant domain. As used herein, a CH3 domain starts at G341 and ends at K447.
- CH3 domain includes wildtype CH3 domains (such as having SEQ ID NO: 282 for IgGl and SEQ ID NO: 298 for IgG2; Table 15), as well as variants thereof (e.g., non-naturally-occurring CH3 domains or modified CH3 domains).
- CH3 domain includes wildtype CH3 domains and variants having 1, 2, 3, 4, 5, 1-3, 1- 5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- exemplary CH3 domains include CH3 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CH3 domain that affect a biological activity of an antibody are provided herein.
- a “native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- Native sequence Fc includes the various allotypes of Fes (see, e.g., Jefferis et al. (2009) mAbs 1: 1).
- epitopes refers to a site on an antigen (e.g., GITR) to which an immunoglobulin or antibody specifically binds.
- Epitopes can be formed both from contiguous amino acids (usually a linear epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (usually a conformational epitope).
- contiguous amino acids are typically, but not always, retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- Methods for determining what epitopes are bound by a given antibody i.e., epitope mapping are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from (e.g., from GITR) are tested for reactivity with a given antibody (e.g., anti-GITR antibody).
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography, 2-dimensional nuclear magnetic resonance and HDX-MS (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
- epitopope mapping refers to the process of identification of the molecular determinants for antibody- antigen recognition.
- the term "binds to the same epitope” with reference to two or more antibodies means that the antibodies bind to the same segment of amino acid residues, as determined by a given method.
- Techniques for determining whether antibodies bind to the "same epitope on GITR" with the antibodies described herein include, for example, epitope mapping methods, such as, x- ray analyses of crystals of antigen: antibody complexes which provides atomic resolution of the epitope and hydrogen/deuterium exchange mass spectrometry (HDX-MS).
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- Antibodies that "compete with another antibody for binding to a target” refer to antibodies that inhibit (partially or completely) the binding of the other antibody to the target. Whether two antibodies compete with each other for binding to a target, i.e., whether and to what extent one antibody inhibits the binding of the other antibody to a target, may be determined using known competition experiments. In certain embodiments, an antibody competes with, and inhibits binding of another antibody to a target by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. The level of inhibition or competition may be different depending on which antibody is the "blocking antibody” (i.e., the cold antibody that is incubated first with the target).
- blocking antibody i.e., the cold antibody that is incubated first with the target.
- Competing antibodies bind to the same epitope, an overlapping epitope or to adjacent epitopes (e.g., as evidenced by steric hindrance).
- RIA radioimmunoassay
- EIA enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow and Lane, Antibodies: A
- the antibody (i) binds with an equilibrium dissociation constant (Kpj) of
- an antibody that "specifically binds to human GITR" refers to an antibody that binds to soluble or cell bound
- an antibody that "cross-reacts with cynomolgus GITR” refers to an antibody that binds to cynomolgus GITR with a K D of 10 " M or less, such as approximately less than 10 "8 M, 10 "9 M or 10 "10 M or even lower.
- such antibodies that do not cross-react with GITR from a non-human species exhibit essentially undetectable binding against these proteins in standard binding assays.
- K assoc or "k a ", as used herein, is intended to refer to the association rate of a particular antibody- antigen interaction
- k ⁇ s or "k d ,” as used herein, is intended to refer to the dissociation rate of a particular antibody- antigen interaction
- K D is intended to refer to the dissociation constant, which is obtained from the ratio of k d to k a (i.e,. k d /k a ) and is expressed as a molar concentration (M).
- K D values for antibodies can be determined using methods well established in the art. A preferred method for determining the KD of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as a Biacore® system or flow cytometry and Scatchard analysis.
- high affinity for an IgG antibody refers to an antibody having a Ko of 10 s M or less, more preferably 10 "9 M or less and even more preferably 10 "10 M or less for a target antigen.
- high affinity binding can vary for other antibody isotypes.
- “high affinity” binding for an IgM isotype refers to an antibody having a K D of 10 " M
- EC50 in the context of an in vitro or in vivo assay using an antibody or antigen binding fragment thereof, refers to the concentration of an antibody or an antigen- binding portion thereof that induces a response that is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- binds to immobilized GITR refers to the ability of an antibody described herein to bind to GITR, for example, expressed on the surface of a cell or which is attached to a solid support.
- cross-reacts refers to the ability of an antibody described herein to bind to GITR from a different species.
- an antibody described herein that binds human GITR may also bind another species of GITR (e.g., cynomolgus GITR).
- cross-reactivity may be measured by detecting a specific reactivity with purified antigen in binding assays ⁇ e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing GITR.
- Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BiacoreTM surface plasmon resonance (SPR) analysis using a BiacoreTM 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR surface plasmon resonance
- naturally-occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
- a “polypeptide” refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain.
- One or more amino acid residues in the protein may contain a modification such as, but not limited to, glycosylation, phosphorylation or disulfide bond formation.
- a “protein” may comprise one or more polypeptides.
- nucleic acid molecule is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule may be single- stranded or double- stranded, and may be cDNA.
- conservative sequence modifications of the sequences set forth herein, e.g., in Table 15, such as in SEQ ID NOs: 13-191, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
- conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
- modifications can be introduced into a sequence in Table 15, e.g., SEQ ID NOs: 13-191, by standard techniques known in the art, such as site-directed mutagenesis and PCR- mediated mutagenesis.
- Conservative amino acid substitutions include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g.
- a predicted nonessential amino acid residue in an anti-GITR antibody is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of an anti-GITR antibody coding sequence, such as by saturation mutagenesis, and the resulting modified anti-GITR antibodies can be screened for binding activity.
- nucleic acids For nucleic acids, the term "substantial homology" indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- the term "substantial homology" indicates that two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the amino acids.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4: 11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol.
- nucleic acid and protein sequences described herein can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or "rendered substantially pure” when purified away from other cellular components or other contaminants, e.g.
- nucleic acids e.g., the other parts of the chromosome
- proteins by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et ah , ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- Nucleic acids e.g., cDNA
- cDNA may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived" indicates that a sequence is identical or modified from another sequence).
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- vector is a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- vector is a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- Plasmid which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- a viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced ⁇ e.g. , bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors ⁇ e.g. , non-episomal mammalian vectors
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- recombinant expression vectors Such vectors are referred to herein as "recombinant expression vectors" (or simply, “expression vectors")
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
- viral vectors e.g. , replication defective retroviruses, adenoviruses and adeno-associated viruses
- recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell that comprises a nucleic acid that is not naturally present in the cell, and maybe a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
- an antigen refers to any natural or synthetic immunogenic substance, such as a protein, peptide, or hapten.
- An antigen may be GITR or a fragment thereof.
- An antigen may also be a tumor antigen, against which protective or therapeutic immune responses are desired, e.g. , antigens expressed by a tumor cell (e.g., in a vaccine in combination with an anti-GITR antibody).
- Antigens include tumor-associated antigens for the prevention or treatment of cancers.
- tumor-associated antigens include, but are not limited to, sequences comprising all or part of the sequences of hCG, gplOO or Pmell7, HER2/neu, WTl, mesothelin, CEA, gplOO, MARTI, TRP-2, melan-A, NY-ESO-1, NY-BR- 1, NY-CO-58, MN (gp250), idiotype, MAGE- 1, MAGE-3, MAGE- A3, Tyrosinase, Telomerase, SSX2 and MUC- 1 antigens, and germ cell derived tumor antigens.
- Tumor associated antigens also include the blood group antigens, for example, Le a , Le b , LeX, LeY, H-2, B- l, B-2 antigens.
- more than one antigen can be included in a construct.
- a MAGE antigen can be combined with other antigens such as melanin A, tyrosinase, and gplOO along with adjuvants such as GM-CSF or IL-12, and linked to an anti-APC antibody.
- mRNA human carcinoembryonic antigen-like 1
- An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8+ T cell, or the inhibition of a Treg cell.
- an “immunomodulator” or “immunoregulator” refers to an agent, e.g., a component of a signaling pathway, that may be involved in modulating, regulating, or modifying an immune response.
- Modulating,” “regulating,” or “modifying” an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g., an effector T cell).
- Such modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system.
- Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment.
- the immunomodulator is located on the surface of a T cell.
- An "immunomodulatory target” or “immunoregulatory target” is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
- Immunomodulatory targets include, for example, receptors on the surface of a cell
- immunomodulatory receptors and receptor ligands
- immunomodulatory ligands receptor ligands
- Immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
- Immuno stimulating therapy or “immunostimulatory therapy” refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
- “Potentiating an endogenous immune response” means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
- T effector cells refers to T cells (e.g., CD4+ and CD8+ T cells) with cytolytic activities as well as T helper (Th) cells, which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
- T eff T effector cells
- T helper cells which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
- Anti-GITR antibodies described herein activate T e ff cells, e.g., CD4+ and CD8+ T e ff cells.
- An increased ability to stimulate an immune response or the immune system can result from an enhanced agonist activity of T cell costimulatory receptors and/or an enhanced antagonist activity of inhibitory receptors.
- An increased abililty to stimulate an immune response or the immune system may be reflected by a fold increase of the EC50 or maximal level of activity in an assay that measures an immune response, e.g., an assay that measures changes in cytokine or chemokine release, cytolytic activity (determined directly on target cells or indirectly via detecting CD 107a or granzymes) and proliferation.
- the ability to stimulate an immune response or the immune system activity may be enhanced by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more.
- an antibody comprising a modified heavy chain constant region has more potent agonist activity, relative to the same antibody that does not comprise a modified heavy chain constant region.
- the enhanced agonist activity of an antibody can be determined, e.g., as shown in the Examples, e.g., by measuring the level of IFN- ⁇ or IL-2 secretion from T cells that are contacted with the antibody.
- the agonist activity may be enhanced by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more as defined by increased cytokine release or increased proliferation in effector T cells; reduced T regulatory cell activity if engagement on Tregs reduces Treg function; or increased depletion of Tregs.
- the amount of IFN- ⁇ or IL-2 secreted from T cells stimulated with an antibody comprising a modified heavy chain constant region may be at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more higher than that of T cells simulated with the same antibody that does not comprise a modified heavy chain constant region.
- the term "linked" refers to the association of two or more molecules.
- the linkage can be covalent or non-covalent.
- the linkage also can be genetic (i.e. , recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
- administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
- Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional,
- an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
- T cell-mediated response refers to a response mediated by T cells, including effector T cells (e.g. , CD8 + cells) and helper T cells (e.g. , CD4 + cells).
- T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- the terms “inhibits” or “blocks” are used interchangeably and encompass both partial and complete inhibition/blocking.
- the anti-GITR antibody inhibits binding of GITR-L to GITR by at least about 50%, for example, about 60%, 70%, 80%, 90%, 95%, 99%, or 100%, determined, e.g., as further described herein.
- the anti-GITR antibody inhibits binding of GITR-L to GITR by no more than 50%, for example, by about 40%, 30%, 20%, 10%, 5% or 1%, determined, e.g., as further described herein.
- the term "inhibits growth" of a tumor includes any measurable decrease in the growth of a tumor, e.g. , the inhibition of growth of a tumor by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 99%, or 100%.
- cancer refers a broad group of diseases characterized by the
- Unregulated growth of abnormal cells in the body Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
- treat refers to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease.
- Treatment can be of a subject having a disease or a subject who does not have a disease (e.g., for prophylaxis).
- a "hematological malignancy” includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes.
- Exemplary lymphomas include both B cell lymphomas (a B-cell hematological cancer) and T cell lymphomas.
- B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin' s lymphomas.
- Non- limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis.
- T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma.
- Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia.
- Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma.
- Other hematological and/or B cell- or T-cell-associated cancers are encompassed by the term hematological malignancy.
- an effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve a desired effect.
- a “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- a therapeutically effective amount or dosage of a drug includes a "prophylactically effective amount” or a “prophylactically effective dosage”, which is any amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease.
- a therapeutic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
- an anti-cancer agent is a drug that promotes cancer regression in a subject.
- a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
- "Promoting cancer regression” means that administering an effective amount of the drug, alone or in combination with an antineoplastic agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, a prevention of impairment or disability due to the disease affliction, or otherwise amelioration of disease symptoms in the patient.
- the terms "effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety.
- Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient.
- Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
- a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%.
- the ability of a compound to inhibit tumor growth can be evaluated using the assays described infra. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner. In other preferred embodiments described herein, tumor regression may be observed and continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
- patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "subject” includes any human or non-human animal.
- the methods and compositions described herein can be used to treat a subject having cancer.
- non-human animal includes all vertebrates, e.g., mammals and non- mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- antibodies e.g., fully human antibodies, which are characterized by particular functional features or properties.
- the antibodies specifically bind human GITR.
- antibodies may cross react with GITR from one or more non-human primates, such as cynomolgus GITR.
- the antibodies described herein exhibit one or more of the following functional properties:
- anti-GITR antibodies bind to GITR with high affinity, for example, with a K D of 10 "7 M or less, 10 "8 M or less, 10 "9 M or less, 10 "10 M or less, 10 "11 M or less, 10 "12 M or less, 10 "12 M to 10 “7 M, 10 "11 M to 10 "7 M, 10 "10 M to 10 "7 M, or 10 "9 M to 10 "7 M.
- an anti-GITR antibody binds to soluble human GITR, e.g, as determined by Biacore, with a K D of 10 "7 M or less, 10 "8 M or less, 10 "9 M (1 nM) or less, 10 "10 M or less, 10 "12 M to 10 “7 M, 10 "11 M to 10 "7 M, 10 "10 M to 10 "7 M, 10 “9 M to 10 “7 M, or 10 "8 M to 10 "7 M.
- an anti-GITR antibody binds to bound (e.g., cell membrane bound) human GITR, such as on activated human T cells, e.g., as determined by flow cytometry and Scatchard plot, with a K D of 10 "7 M or less, 10 "8 M or less, 10 "9 M (1 nM) or less, 10 "10 M or less, 10 "12 M to 10 "7 M, 10 "11 M to 10 "8 M, 10 "10 M to 10 “8 M, 10 "9 M to 10 “8 M, 10 "11 M to 10 "9 M, or 10 "10 M to 10 "9 M.
- an anti-GITR antibody binds to bound (e.g., cell membrane bound) human GITR, such as on activated human T cells, e.g., as determined by FACS, with an EC 50 of 10 "7 M or less, 10 "8 M or less, 10 "9 M (1 nM) or less, 10 "10 M or less, 10 "12 M to 10 "7 M, 10 "11 M to 10 "8 M, 10 "10 M to 10 "8 M, 10 "9 M to 10 “8 M, 10 "11 M to 10 “9 M, or 10 "10 M to 10 "9 M.
- an anti-GITR antibody binds to soluble human GITR with a K D of 10 " M or less, 10 "8 M or less, 10 "9 M (1 nM) or less, 10 "10 M or less, 10 "12 M to 10 “7 M, 10 "11 M to 10 " 7 M, 10 "10 M to 10 “7 M, 10 “9 M to 10 “7 M, or 10 "8 M to 10 “7 M, and to cell membrane bound human GITR with a K D or EC 50 of 10 "7 M or less, 10 "8 M or less, 10 "9 M (1 nM) or less, 10 "10 M or less, 10 "12 M to 10 “7 M, 10 "11 M to 10 “8 M, 10 "10 M to 10 “8 M, 10 “9 M to 10 “8 M, 10 "11 M to 10 “9 M, or 10 "10 M to 10 "9 M.
- Anti-GITR antibodies may bind to cynomolgus GITR, e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 5 o of 100 nM or less, 10 nM or less, 100 nM to 0.01 nM, 100 nM to 0.1 nM, 100 nM to 1 nM, or 10 nM to 1 nM, e.g, as measured by FACS (e.g., as described in the Examples).
- Anti-GITR antibodies may stimulate or enhance an immune response, e.g., by activating T eff cells, limiting the suppression of Teffector cells by Treg cells, depleting and/or inhibiting tumor Treg cells and/or activating NK cells, e.g., in the tumor.
- the anti-GITR antibodies may activate or costimulate T eff cells as evidenced, e.g., by enhanced cytokine (e.g., IL-2 and IFN- ⁇ ) secretion and/or enhanced proliferation.
- CD3 stimulation is also provided.
- a GITR antibody increases IL-2 secretion by a factor of 50%, 100% (i.e., 2 fold), 3 fold, 4 fold, 5 fold or more, optionally with a maximum of up to 10 fold, 30 fold, 100 fold, as measured, e.g., on primary human T cells or T cells expressing human GITR (e.g., as further described in the Examples).
- a GITR antibody increases IFN- ⁇ secretion by a factor of 50%, 100% (i.e., 2 fold), 3 fold, 4 fold, 5 fold or more, optionally with a maximum of up to 10 fold, 30 fold, 100 fold, as measured, e.g., on primary human T cells or T cells expressing human GITR (e.g., as further described in the Examples).
- Anti-GITR antibodies may inhibit binding of human GITRL to human GITR on cells, e.g., 3A9 cells expressing human GITR, e.g., with an EC 50 of 10 ⁇ g/ml or less, 1 ⁇ g/ml or less, 0.01 ⁇ g/ml to 10 ⁇ g/ml, 0.1 ⁇ g/ml to 10 ⁇ g/ml, or 0.1 ⁇ g/ml to 1 ⁇ g/ml (see Example 5).
- anti-GITR antibodies at most only partially inhibit binding of human GITRLto human GITR on cells, e.g., activated T cells (see Example 5).
- Anti-GITR antibodies may bind to an epitope, e.g., a conformational epitope in the N- terminal portion of human GITR, e.g., an epitope located within amino acids 1 to 39 of mature human GITR (see Example 9), as determined, e.g., by binding of the antibodies to fragments of human GITR, e.g., native (i.e., non-denatured) fragments of human GITR.
- an epitope e.g., a conformational epitope in the N- terminal portion of human GITR, e.g., an epitope located within amino acids 1 to 39 of mature human GITR (see Example 9), as determined, e.g., by binding of the antibodies to fragments of human GITR, e.g., native (i.e., non-denatured) fragments of human GITR.
- Anti-GITR antibodies may bind to, or to an epitope located within, amino acids 1 to 20 of mature human GITR, as determined, e.g., by binding of the antibodies to fragments of human GITR, e.g., native (i.e., non-denatured) fragments of human GITR, followed by enzymatic cleavage or by HDX (see Examples 11 and 12, respectively).
- Anti-GITR antibodies may bind to, or to an epitope within, amino acids 3 to 20 of mature human GITR (PTGGPGC GPGRLLLGTGT , SEQ ID NO: 217).
- Anti-GITR antibodies may bind to, or to an epitope within, amino acids 3 to 20 and amino acids 33 to 40 of mature human GITR, i.e., amino acid sequences PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218).
- anti-GITR antibodies bind to both glycosylated and unglycosylated human GITR.
- anti-GITR antibodies bind to amino acid sequences PTGGPGC GPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218), as determined by HDX, e.g., using the protocol set forth in the Examples.
- Anti-GITR antibodies may compete for binding to GITR with (or inhibit binding of) anti- GITR antibodies comprising CDRs or variable regions described herein, e.g., 28F3, 3C3-1, 3C3- 2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10.
- anti-GITR antibodies inhibit binding of 28F3, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, 19D3, 18E10, and/or 6G10 to human GITR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or by 100%.
- 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10 inhibit binding of anti-GITR antibodies to human GITR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or by 100%.
- anti-GITR antibodies inhibit binding of 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10 to human GITR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or by 100% and 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G 10 inhibit binding of the anti-GITR antibodies to human GITR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or by 100% (e.g., compete in both directions).
- anti-GITR antibodies induce or enhance T cell activation without requiring multivalent cross-linking, as determined, e.g., by the lack of requirement of FcR binding.
- anti-GITR antibodies are multivalent, e.g., bivalent.
- anti-GITR antibodies are not monovalent. It has been shown herein that F'(ab)2 fragments are more effective than Fab fragments at activating T cells (see,
- anti-GITR antibodies do not require cross-linking via Fc receptors for their agonist activity, however, cross-linking to Fc receptors enhances their agonist activity relative to the same antibody that does not bind to Fc receptors.
- anti-GITR antibodies have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 of the following features:
- binding to soluble human GITR e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with a K D of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by Scatchard;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., binding to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- Anti-GITR antibodies may also induce internalization of GITR in activated T cells, e.g., CD4+ and CD8+ T cells, e.g, within 10, 30 or 60 minutes, and subsequent signal transduction, e.g., activation (i.e., phosphorylation) of p65 NF-kB and p38 MAPkinase.
- activated T cells e.g., CD4+ and CD8+ T cells, e.g, within 10, 30 or 60 minutes
- subsequent signal transduction e.g., activation (i.e., phosphorylation) of p65 NF-kB and p38 MAPkinase.
- an antibody that exhibits one or more of these functional properties e.g., biochemical, immunochemical, cellular, physiological or other biological activities, or the like
- these functional properties e.g., biochemical, immunochemical, cellular, physiological or other biological activities, or the like
- anti-GITR antibody-induced increases in a measured parameter effects a statistically significant increase by at least 10% of the measured parameter, more preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100% (i.e, 2 fold), 3 fold, 5 fold or 10 fold, and in certain preferred embodiments, an antibody described herein may increase the measured parameter by greater than 92%, 94%, 95%, 97%, 98%, 99%, 100% (i.e, 2 fold), 3 fold, 5 fold or 10 fold.
- a measured parameter e.g., T cell proliferation, cytokine production
- an antibody described herein may increase the measured parameter by greater than 92%, 94%, 95%, 97%, 98%, 99%, 100% (i.e, 2 fold), 3 fold, 5 fold or 10 fold.
- anti-GITR antibody- induced decreases in a measured parameter effects a statistically significant decrease by at least 10% of the measured parameter, more preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, and in certain preferred embodiments, an antibody described herein may decrease the measured parameter by greater than 92%, 94%, 95%, 97%, 98% or 99%.
- Standard assays to evaluate the binding ability of the antibodies toward GITR of various species are known in the art, including for example, ELISAs, Western blots, and RIAs. Suitable assays are described in detail in the Examples.
- the binding kinetics (e.g. , binding affinity) of the antibodies also can be assessed by standard assays known in the art, such as by Biacore analysis.
- Assays to evaluate the effects of the antibodies on functional properties of GITR e.g. , ligand binding, T cell proliferation, cytokine production
- anti-GITR antibodies are not native antibodies or are not naturally-occurring antibodies.
- anti-GITR antibodies have post-translational modifications that are different from those of antibodies that are naturally occurring, such as by having more, less or a different type of post-translational modification.
- antibodies described herein are antibodies, e.g., monoclonal antibodies, having the CDR and/or variable region sequences of antibodies 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10, isolated and structurally characterized as described in Example 1, as well as antibodies having at least 80% identity (e.g., at least 85%, at least 90%, at least 95%, or at least 99% identity) to their variable region or CDR sequences.
- monoclonal antibodies having the CDR and/or variable region sequences of antibodies 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10, isolated and structurally characterized as described in Example 1, as well as antibodies having at least 80% identity (e.g., at least 85%, at least 90%, at least 95%, or at least 99% identity) to their variable region or CDR sequences.
- V H amino acid sequences of 28F3, 19D3, 18E10, 3C3 (3C3-1 and 3C3-2), 2G6, 8A6, 9G7 (9G7-1 and 9G7-2), 14E3, 19H8 (19H8-1 and 19H8-2), and 6G10 are set forth in SEQ ID NOs: 13, 26, 39, 52, 71,
- V L amino acid sequences of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are shown in SEQ ID NOs: 14, 27, 40, 53, 54, 72, 85, 98, 99, 116, 129, 130, and 336, respectively.
- isolated antibodies comprising heavy and light chain variable regions, wherein the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 26, 39, 52, 71, 84, 97, 115, 128, and 335.
- isolated antibodies comprising heavy and light chain variable regions, wherein the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 27, 40, 53, 54, 72,
- isolated antibodies or antigen-binding portion thereof, comprising:
- Anti-GITR antibodies may comprise the heavy and light chain CDRls, CDR2s and CDR3s of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10, or combinations thereof.
- amino acid sequences of the V H CDRls of 28F3, 19D3, 18E10, 3C3 (3C3-1 and 3C3-2), 2G6, 8A6, 9G7 (9G7-1 and 9G7-2), 14E3, 19H8 (19H8-1 and 19H8-2), and 6G10 are set forth in SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342, respectively.
- amino acid sequences of the V H CDR2s of 28F3, 19D3, 18E10, 3C3 (3C3-1 and 3C3-2), 2G6, 8A6, 9G7 (9G7-1 and 9G7-2), 14E3, 19H8 (19H8-1 and 19H8-2), and 6G10 are set forth in SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343, respectively.
- amino acid sequences of the V H CDR3s of 28F3, 19D3, 18E10, 3C3 (3C3-1 and 3C3-2), 2G6, 8A6, 9G7 (9G7-1 and 9G7-2), 14E3, 19H8 (19H8-1 and 19H8-2), and 6G10 are set forth in SEQ ID NOs: 22, 35, 48, 64, 80, 93, 108, 124, 140, and 344.
- amino acid sequences of the V L CDRls of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are set forth in SEQ ID NOs: 23, 36, 49, 65, 68, 81, 94, 109, 112, 125, 141, 144, and 345, respectively.
- amino acid sequences of the V L CDR2s of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are set forth in SEQ ID NOs: 24, 37, 50, 66, 69, 82, 95, 110, 113, 126, 142, 145, and 346, respectively.
- the amino acid sequences of the V L CDR3s of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are set forth in SEQ ID NOs: 25, 38, 51, 67, 70, 83, 96, 111, 114, 127, 143, 146, and 347, respectively.
- the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- V H CDRl, 2 and 3 sequences and V L CDRl, 2 and 3 sequences can be "mixed and matched" (i.e. , CDRs from different antibodies can be mixed and match, although each antibody must contain a VH CDRl, 2 and 3 and a VL CDRl, 2 and 3) to create other anti-GITR binding molecules described herein.
- GITR binding of such "mixed and matched" antibodies can be tested using the binding assays described above and in the Examples (e.g. , ELISAs).
- the CDRl, CDR2 and/or CDR3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence(s).
- V L CDR sequences are mixed and matched, the CDRl, CDR2 and/or CDR3 sequence from a particular V L sequence preferably is replaced with a structurally similar CDR sequence(s).
- VH and VL sequences can be created by substituting one or more VH and/or V L CDR region sequences with structurally similar sequences from the CDR sequences disclosed herein for monoclonal antibodies 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7- 1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10.
- isolated antibodies, or antigen binding portion thereof comprising:
- a heavy chain variable region CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342;
- a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343;
- a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 35, 48, 64, 80, 93, 108, 124, 140, and 344;
- a light chain variable region CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 23, 36, 49, 65, 68, 81, 94, 109, 112, 125, 141, 144, and 345;
- a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 37, 50, 66, 69, 82, 95, 110, 113, 126, 142, 145, and 346; and (f) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 25, 38, 51, 67, 70, 83, 96, 111, 114, 127, 143, 146, and 347;
- the antibody specifically binds to human GITR.
- the antibody comprises heavy and light chain variable regions, wherein the heavy chain variable region CDR1, CDR2, and CDR3 regions comprise:
- the antibody specifically binds to human GITR.
- the antibody comprises heavy and light chain variable regions, wherein the light chain variable region CDR1, CDR2, and CDR3 regions comprise:
- the antibody specifically binds to human GITR.
- the antibody comprises heavy and light chain variable regions, wherein:
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 20-22, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 23-25, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 33-35, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 36-38, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 46-48, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 49-51, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 62-64, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 65-67, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 62-64, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 68-70, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 78-80, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 81-83, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 91-93, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 94-96, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 106-108, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 109-111, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 106-108, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 112-114, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 122-124, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 125-127, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 138-140, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 141-143, respectively;
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 138-140, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 144-146, respectively; or
- the heavy chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 342-344, respectively, and the light chain variable region CDRl, CDR2, and CDR3 comprises SEQ ID NOs: 345-347, respectively;
- the antibody specifically binds to human GITR.
- a VH domain, or one or more CDRs thereof, described herein may be linked to a constant domain for forming a heavy chain, e.g., a full length heavy chain.
- a VL domain, or one or more CDRs thereof, described herein may be linked to a constant domain for forming a light chain, e.g., a full length light chain.
- a full length heavy chain (with the exception of the C-terminal lysine (K) or with the exception of the C-terminal glycine and lysine (GK), which may be absent) and full length light chain combine to form a full length antibody.
- a VH domain described herein may be fused to the constant domain of a human IgG, e.g., IgGl, IgG2, IgG3 or IgG4, which are either naturally-occurring or modified, e.g., as further described herein.
- a VH domain may comprise the amino acid sequence of any VH domain described herein fused to the following human IgGl amino acid sequence:
- the human IgGl constant domain may also be that of an allotypic variant.
- an allotypic variant of IgGl comprises an R107K, E189D and M191L (underlined above) and numbering according to that in SEQ ID NO: 7). Within the full length heavy region, these amino acid substitutions are numbered R214K, E356D and M358L.
- VL domain described herein may be fused to the constant domain of a human Kappa or Lambda light chain.
- a VL domain may comprise the amino acid sequence of any VL domain described herein fused to the following human IgGl kappa light chain amino acid sequence:
- the heavy chain constant region comprises a lysine or another amino acid at the C-terminus, e.g., it comprises the following last amino acids: LSPGK (SEQ ID NO: 220) for the heavy chain.
- the heavy chain constant region is lacking one or more amino acids at the C-terminus, and has, e.g., the C-terminal sequence LSPG (SEQ ID NO: 276) or LSP.
- amino acid sequences of exemplary heavy and light chains are set forth in Table 15 and correspond to SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227-275, 337, 339, 340, 348-352, 361, and 362 for the heavy chains and SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371 for the light chains.
- Heavy and light chains comprising an amino acid sequence that is at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75% or 70% identical to any of the heavy or light chains set forth in Table 15 (or their variable regions), e.g, SEQ ID NOs: 13-19, 26-32, 40-45, 52-61, 71- 77, 84-90, 97-105, 116-121, 128-137, 227-275, 337-341, 348-352, 361, 362, and 371 may be used for forming anti-human GITR antibodies having the desired characteristics, e.g., those further described herein.
- Exemplary variants are those comprising an allotypic variation, e.g., in the constant domain, and/or a mutation in the variable or constant regions, such as the mutations disclosed herein.
- Heavy and light chains comprising an amino acid sequence that differs in at most 1-30, 1-25, 1-20, 1-15, 1-10, 1-5, 1-4, 1-3, 1-2 or 1 amino acid (by substitution, addition or deletion) from any of the heavy or light chains set forth in Table 15 (or their variable regions) may be used for forming anti-human GITR antibodies having the desired characteristics, e.g., those further described herein.
- the antibodies described above exhibit one or more, two or , three or more, four or more, five or more, six or more, seven or more, eight or more, nine 3re, ten or more, eleven, or all of the following functional properties:
- soluble human GITR e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced, by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- Such antibodies include, for example, human antibodies, humanized antibodies, or chimeric antibodies.
- the anti-GITR antibodies described herein bind to both glycosylated (e.g., N-linked or O-linked glycosylation) and unglycosylated human GITR.
- the anti-GITR antibodies described herein bind to a conformational epitope.
- the anti-GITR antibodies described herein bind to amino acid residues within the following region of mature human GITR (SEQ ID NO: 4):
- QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGE (SEQ ID NO: 215), corresponding to amino acid residues 1-39 of mature human GITR isoforms 1, 2 or 3 (SEQ ID NO: 4).
- the anti-GITR antibody described herein binds to amino acid residues within the following region of mature human GITR (SEQ ID NO: 4):
- QRPTGGPGCGPGRLLLGTGT (SEQ ID NO: 216), corresponding to amino acid residues 1-20 of mature human GITR isoforms 1, 2 or 3 (SEQ ID NO: 4).
- the anti-GITR antibody described herein binds to amino acid residues within the following regions of mature human GITR (SEQ ID NO: 4):
- anti-GITR antibodies described herein may be of any isotype, e.g., IgGl, IgG2, IgG3 and IgG4, or combinations thereof and/or modifications thereof.
- An anti-GITR antibody may have effector function or may have reduced or no effector function.
- anti-GITR antibodies comprise a modified heavy chain constant region that provides enhanced properties to the antibody. As shown in the Examples, anti-GITR antibodies, having a modified heavy chain constant region comprising an IgG2 hinge are more potent agonists relative to antibodies having the same variable region but with a non-IgG2 hinge.
- an antibody comprising an IgG2 hinge, a CH2 and CH3 domain of the IgGl isotype, and whether with or without effector function, has enhanced agonist activity as measured by enhanced secretion of IFN- ⁇ and IL-2 from T cells incubated with the antibodies.
- anti-GITR antibodies having IgG2 hinges form larger antibody/antigen complexes and are more effectively internatlized, thereby resulting in increased agonist activity.
- the formation of large complexes is believed to result from a higher stiffness of the IgG2 hinge relative to hinges of other isotypes (e.g., IgGl, IgG3 and IgG4).
- an enhanced agonist activity does not appear to be associated with a higher or lower affinity of the antibody.
- anti-GITR antibodies having a modified heavy chain constant region wherein the anti-GITR antibodies have an enhanced agonist activity, and wherein, the affinity of the antibody with the modified heavy chain constant region binds to GITR with a similar affinity as the same variable regions, but with a different heavy chain constant region.
- anti-GITR antibodies comprising providing an anti-GITR antibody that has a non-IgG2 hinge, and replacing the non-IgG2 hinge with an IgG2 hinge.
- Antibodies that may benefit from such a modification includes any anti-GITR antibody, such as those known in the art, e.g., antibody 6C8 or a humanized antibody having the CDRs of 6C8, as described, e.g., in WO2006/ 105021; an antibody described in WO2011/028683, JP2008278814, KR20080105674, US20040072566, US2001472565, US20140065152 or in WO2015/031667.
- a modified heavy chain constant region comprises a hinge of the IgG2 isotype (an "IgG2 hinge") and a CHI, CH2 and CH3 domain.
- a modified heavy chain constant regin comprises an IgG2 hinge and a CHI, CH2 and CH3 domain, wherein at least one of the CHI, CH2 and CH3 domains is not of the IgG2 isotype.
- the IgG2 hinge may be a wildtype IgG2 hinge, e.g., a wildtype human IgG2 hinge (e.g., ERKCCVECPPCPAPPVAG; SEQ ID NO: 291) or a variant thereof, provided that the IgG2 hinge retains the ability to confer to the antibody an enhanced activity relative to the same antibody that comprises a non-IgG2 hinge.
- an IgG2 hinge variant retains similar rigidity or stiffness to that of a wildtype IgG2 hinge.
- the rigidity of a hinge can be determined, e.g., by computer modeling, electron microscopy, spectroscopy such as Nuclear Magnetic Resonance (NMR), X-ray crystallography (B-factors), or Sedimentation Velocity Analytical ultracentrifugation (AUC) to measure or compare the radius of gyration of antibodies comprising the hinge.
- a hinge may have similar or higher rigidity relative to another hinge if an antibody comprising the hinge has a value obtained from one of the tests described in the previous sentence that differs from the value of the same antibody with a different hinge, e.g., an IgGl hinge, in less than 5%, 10%, 25%, 50%, 75%, or 100%.
- An exemplary human IgG2 hinge variant is an IgG2 hinge that comprises a substitution of one or more of the four cysteine residues (i.e., C219, C220, C226 and C229) with another amino acid. A cysteine may be replaced by a serine.
- An exemplary IgG2 hinge is a human IgG2 hinge comprising a C219X mutation or a C220X mutation, wherein X is any amino acid except serine. In a certain embodiments, an IgG2 hinge does not comprise both a C219X and a C220X substitution. In certain embodimetns, an IgG2 hinge comprises C219S or C220S, but not both C219S and C220S (e.g.,
- IgG2 hinge variants that may be used include human IgG2 hinges comprising a C220, C226 and/or C229 substitution, e.g., a C220S, C226S or C229S mutation (which may be combined with a C219S mutation).
- An IgG2 hinge may also be an IgG2 hinge in which a portion of the hinge is that of another isotype (i.e., it is a chimeric or hybrid hinge), provided that the rigidity of the chimeric hinge is at least similar to that of a wildtype IgG2 hinge.
- an IgG2 hinge may be an IgG2 hinge in which the lower hinge (as defined in Table 2) is of an IgGl isotype, and is, e.g., a wildtype IgGl lower hinge.
- Additional IgG2 hinge mutations that may be used in an IgG2 hinge include the SE (S267E), SELF (S267E/L328F), SDIE (S239D/I332E), SEFF and GASDALIE
- a “hybrid” or “chimeric” hinge is referred to as being of a specific isotype if more than half of the consecutive amino acids of the hinge are from that isotype.
- a hinge having an upper and middle hinge of IgG2 and the lower hinge of IgGl is considered to be an IgG2 hybrid hinge.
- an anti-GITR antibody comprises a modified heavy chain constant region that comprises an IgG2 hinge comprising one of the following sequences:
- ERKSCVECPPCPAPPVAG (SEQ ID NO: 448);
- ERKCSVECPPCPAPPVAG (SEQ ID NO: 449);
- ERKXCVECPPCPAPPVAG (SEQ ID NO: 450);
- ERKXCVECPPCPAPELLGG (SEQ ID NO: 460);
- ERKCCVECPPCPAP (SEQ ID NO: 467);
- ERKSCVECPPCPAP (SEQ ID NO: 468);
- ERKCSVECPPCPAP (SEQ ID NO: 469);
- ERKXCVECPPCPAP (SEQ ID NO: 470); or
- ERKCXVECPPCPAP (SEQ ID NO: 471), wherein X is any amino acid, except a cysteine, or any of the above sequences, in which 1-5, 1-3, 1-2 or 1 amino acid is inserted between amino acid residues CVE and CPP.
- THT or GGG is inserted.
- 1, 1-2, or 1-3 amino acids are inserted between the hinge and CH2 domain.
- a glycine may be inserted between the hinge and CH2 domain.
- the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein 1, 2, 3 or all 4 amino acids P233,V234, A235 and G237 (corresponding to the C- terminal 4 amino acids "PVAG" (SEQ ID NO: 472) are deleted or substituted with another amino acid, e.g., the amino acids of the C-terminus of the IgGl hinge (ELLG (SEQ ID NO: 473) or ELLGG (SEQ ID NO: 474).
- the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein V234, A235 and G237 are deleted or substituted with another amino acid.
- the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein A235 and G237 are deleted or substituted with another amino acid. In certain embodiments, the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein G237 is deleted or substituted with another amino acid. In certain embodiments, the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein V234 and A235 are deleted or substituted with another amino acid. Substitution of PVAG (SEQ ID NO: 472) in an IgG2 with the
- an IgGl hinge i.e., (ELLG (SEQ ID NO: 473) or ELLGG (SEQ ID NO: 474)
- a hybrid hinge e.g., shown above, that provides a hinge having the advantages of an IgG2 hinge and the effector function of IgGl hinges.
- a modified heavy chain constant region comprises a hinge that consists of or consists essentially of one of the sequences shown above, e.g., any one of SEQ ID NOs: 447-471, and in certain embodiments, does not comprise additional hinge amino acid residues.
- an anti-CD73 antibody comprises a modified heavy chain constant region comprising an IgGl or IgG2 constant region, wherein the hinge comprises a deletion of 1-10 amino acids.
- an IgGl antibody lacking amino acid residues SCDKTHT (S219, C220, D221, K222, T223, H224 and T225; SEQ ID NO: 475) conferred antibody mediated CD73 internalization more effectively than the same antibody having a wildtype IgGl constant region.
- an IgG2 antibody lacking amino acid residues CCVE conferred antibody mediated CD73 internalization more effectively than the same antibody having a wildtype IgGl constant region.
- a modified heavy chain constant region comprises a CHI domain that is a wildtype CHI domain of the IgGl or IgG2 isotype ("IgGl CHI domain” or "IgG2 CHI domain,” respectively).
- CHI domains of the isotypes IgG3 and IgG4 ("IgG3 CHI domain and "IgG2 CHI domain,” respectively) may also be used.
- a CHI domain may also be a variant of a wildtype CHI domain, e.g., a variant of a wildtype IgGl, IgG2, IgG3 or IgG4 CHI domain.
- Exemplary variants of CHI domains include A114C and T173C and/or C131, e.g., C131S.
- a CHI domain e.g., an IgG2 CHI domain, may comprise the substitution C131S, which substitution confers onto an IgG2 antibody or antibody having an IgG2 CHI and hinge the B form (or conformation).
- a modified heavy chain constant region comprises a CHI domain that is of the IgG2 isotype.
- the CHI domain is wildtype IgG2 CHI domain, e.g., having the amino acid sequence:
- the CHI domain is a variant of SEQ ID NO: 477 and comprises 1-10, 1-5, 1-2 or 1 amino acid substitutions or deletions relative to SEQ ID NO: 477.
- an IgG2 CHI domain or variants thereof confer enhanced or altered internalization properties to anti-GITR antibodies relative to IgGl antibodies and even more enhanced or atered internalization when the antibodies also comprise an IgG2 hinge.
- IgG2 CHI variants do not comprise an amino acid substitution or deletion at one or more of the following amino acid residues: C131, R133, E137 and S 138, which amino acid residues are shown in bold and underlined in SEQ ID NO: 477 shown above.
- a modified heavy chain constant region may comprise an IgG2 CHI domain in which neither of R133, E137 and S 138 are substituted with another amino acid or are deteled or in which neither of C131, R133, E137 and S 138 are substituted with another amino acid or are deteled.
- C131 is substituted with another amino acid, e.g., C131S, which substitution triggers the antibody to adopt conformation B.
- Both conformation A and conformation B antibodies having modified heavy chain constant regions have been shown herein to have enhanced activities relative to the same antibody with an IgGl constant region.
- N192 and/or F193 are substituted with another amino acid, e.g., with the corresponding amino acids in IgGl, i.e., N192S and/or F193L.
- one or more amino acid residues of an IgG2 CHI domain are substituted with the corresponding amino acid residues in IgG4.
- N192 may be N192S; F193 may be F193L; C131 may be C131K; and/or T214 may be T214R.
- An antibody may comprise a modified heavy chain constant region comprising an IgG2 CHI domain or variant thereof and IgG2 hinge or variant thereof.
- the hinge and CHI domain may be a combination of any IgG2 hinge and IgG2 CHI domain described herein.
- the IgG2 CHI and hinge comprise the following amino acid sequence
- amino acid variants are as described for the hinge and CHI domains above.
- antibodies comprise at least an IgG2 hinge, and optionally also an IgG2 CHI domain or fragment or derivative of the hinge and/or CHI domain and the antibody has adopted form (of conformation) A (see, e.g., Allen et al. (2009) Biochemistry 48:3755).
- anti-CD73 antibodies comprise at least an IgG2 hinge, and optionally also an IgG2 CHI domain or fragment or derivative of the hinge and/or CHI domain and the antibody has adopted form B (see, e.g., Allen et al. (2009) Biochemistry 48:3755).
- a modified heavy chain constant region comprises a CH2 domain that is a wildtype CH2 domain of the IgGl, IgG2, IgG3 or IgG4 isotype ("IgGl CH2 domain,” “IgG2 CH2 domain,” “IgG3 CH2 domain,” or "IgG4 CH2 domain,” respectively).
- a CH2 domain may also be a variant of a wildtype CH2 domain, e.g., a variant of a wildtype IgGl, IgG2, IgG3 or IgG4 CH2 domain.
- CH2 domains include variants that modulate a biological activity of the Fc region of an antibody, such as ADCC or CDC or modulate the half-life of the antibody or its stability.
- the CH2 domain is a human IgGl CH2 domain with an A330S and P331S mutation, wherein the CH2 domain has reduced effector function relative to the same CH2 mutation without the mutations.
- a CH2 domain may have enhanced effector function.
- CH2 domains may comprise one or more of the following mutations: SE (S267E), SELF (S267E/L328F), SDIE (S239D/I332E), SEFF and GASDALIE (G236A/S239D/A330L/I332E) and/or one or more mutations at the following amino acids: E233, G237, P238, H268, P271L328 and A330. Other mutations are further set forth herein elsewhere.
- a modified heavy chain constant region comprises a CH3 domain that is a wildtype CH3 domain of the IgGl, IgG2, IgG3 or IgG4 isotype ("IgGl CH3 domain,” “IgG2 CH3 domain,” “IgG3 CH3 domain,” or “IgG4 CH3 domain,” respectively).
- a CH3 domain may also be a variant of a wildtype CH3 domain, e.g., a variant of a wildtype IgGl, IgG2, IgG3 or IgG4 CH3 domain.
- Exemplary variants of CH3 domains include variants that modulate a biological activity of the Fc region of an antibody, such as ADCC or CDC or modulate the half-life of the antibody or its stability.
- variants of the CHI, hinge, CH2 or CH3 domains may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations, and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation, or 1-10 or 1-5 mutations, or comprise an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to that of the corresponding wildtype domain (CHI, hinge, CH2, or CH3 domain, respectively), provided that the heavy chain constant region comprising the specific variant retains the necessary biological activity.
- Table 3 sets forth exemplary human heavy chain constant regions comprising a human CHI, hinge, CH2 and/or CH3 domains, wherein each domain is either a wildtype domain or a variant thereof that provides the desired biological activity to the heavy chain constant region.
- An unfilled cell in Table 3 indicates that the domain is present or not, and if present can be of any isotype, e.g., IgGl, IgG2, IgG3 or IgG4.
- an antibody comprising the heavy chain constant region 1 in Table 3 is an antibody that comprises a heavy chain constant region comprising at least an IgG2 hinge, and which may also comprise a CHI, CH2 and/or CH3 domain, and if present, which CHI, CH2 and/or CH3 domain is of an IgGl, IgG2, IgG3 or IgG4 isotype.
- an antibody comprising a heavy chain constant region 8 is an antibody comprising a heavy chain constant region comprising an IgGl CHI domain, and IgG2 hinge, an IgGl CH2 domain, and which may or may not also comprise a CH3 domain, which if present, may be of an IgGl, IgG2, IgG3 or IgG4 isotype.
- an antibody comprising a heavy chain constant region shown in Table 3 has an enhanced biological activity relative to the same antibody comprising a heavy chain constant region that does not comprise that specific heavy chain constant region or relative to the same antibody that comprises an IgGl constant region.
- a method for improving the biological activity of a GITR antibody that comprises a non-IgG2 hinge and/or non-IgG2 CHI domain comprises providing an anti-GITR antibody that comprises a non-IgG2 hinge and/or a non-IgG2 CHI domain, and replacing the non-IgG2 hinge and the non-IgG2 CHI domain with an IgG2 hinge and an IgG2 CHI domain, respectively.
- a method for improving the biological activity of a GITR antibody that does not comprise a modified heavy chain constant region may comprise providing an anti- GITR antibody that does not comprise a modified heavy chain constant region, and replacing heavy chain constant region with a modified heavy chain constant region.
- modified heavy chain constant regions that may be linked to anti-GITR variable regions, e.g., those described herein, are provided in Table 4, which sets forth the identity of each of the domains.
- an anti-GITR antibody comprises a modified heavy chain constant region comprising an IgG2 hinge comprising any one of SEQ ID NO: 291, 292, 293, 294, and 447-471 or a variant thereof, such as an IgG2 hinge comprising an amino acid sequence that (i) differs from any one of SEQ ID NO: 291, 292, 293, 294, and 447-471 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from any one of SEQ ID NO: 291, 292, 293, 294, or 447-471 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from any one of SEQ ID NO: 291, 292, 293, 294, or 447-471 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- an anti-GITR antibody comprises a modified heavy chain constant region comprising an IgGl CHI domain comprising SEQ ID NO: 278 or an IgG2 CHI domain comprising SEQ ID NO: 279, or a variant of SEQ ID NO: 278 or 279, which variant (i) differs from SEQ ID NO: 278 or 279 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from SEQ ID NO: 278 or 279 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from SEQ ID NO: 278 or 279 in 1-5, 1-3, 1-2, 2- 5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 278 or 279, wherein in any of (i)-(i
- an anti-GITR antibody comprises a modified heavy chain constant region comprising an IgGl CH2 domain comprising SEQ ID NO: 280 or 281, or a variant of SEQ ID NO: 280 or 281, which variant (i) differs from SEQ ID NO: 280 or 281 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from SEQ ID NO: 280 or 281 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from SEQ ID NO: 280 or 281 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 280 or 281, wherein in any of (i)- (iv), an amino acid substitution may be a conservative amino acid substitution or a non
- an anti-GITR antibody comprises a modified heavy chain constant region comprising an IgGl CH3 domain comprising SEQ ID NO: 282, or a variant of SEQ ID NO: 282, which variant (i) differs from SEQ ID NO: 282 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from SEQ ID NO: 282 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from SEQ ID NO: 282 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 282, wherein in any of (i)-(iv), an amino acid substitution may be a conservative amino acid substitution or a non-conservative amino acid substitution; and wherein the modified heavy chain constant region provides
- Modified heavy chain constant regions may also comprise a combination of the CHI, hinge, CH2 and CH3 domains described above.
- an anti-GITR antibody comprises a modified heavy chain constant region comprising any one of SEQ ID NOs: 223, 224, 225, 226, 283, 284, 285 286, 287, 288, 289, 290, 383-446 and 480-543 or a variant of any one of SEQ ID NOs: 223, 224, 225, 226, 283, 284, 285 286, 287, 288, 289, 290, 383-446 and 480-543, which variant (i) differs from any one of SEQ ID NOs: 223, 224, 225, 226, 283, 284, 285 286, 287, 288, 289, 290, 383-446 and 480-543 in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids substitutions, additions or deletions; (ii) differs from any one of SEQ ID NOs: 223, 224, 225, 226, 283, 284, 285 286, 287, 288, 289, 290, 383-446 and 480-543 in 1, 2, 3, 4,
- Modified heavy chain constant regions may have (i) similar, reduced or increased effector function (e.g., binding to an FcyR) relative to a wildtype heavy chain constant region and or (ii) similar, reduced or increased half-life (or binding to the FcRn receptor) relative to a wildtype heavy chain constant region.
- effector function e.g., binding to an FcyR
- half-life or binding to the FcRn receptor
- an anti-GITR antibody comprises a heavy chain variable region from a particular germline heavy chain immunoglobulin gene and/or a light chain variable region from a particular germline light chain immunoglobulin gene.
- human antibodies specific for GITR have been prepared that comprise a heavy chain variable region that is the product of or derived from a human germline VH 3-33 gene, VH 3-10 gene, VH 3-15 gene, VH 3-16, VH JH6b gene, VH 6-19 gene, VH 4-34 gene, and/or VH JH3b gene.
- isolated monoclonal antibodies, or antigen-binding portions thereof comprising a heavy chain variable region that is the product of or derived from a human VH germline gene selected from the group consisting of: VH 3-33, VH 3- 10, VH 3-15, VH 3- 16, VH JH6b, VH 6-19, VH 4-34, and/or VH JH3b.
- Human antibodies specific for GITR have been prepared that comprise a light chain variable region that is the product of or derived from a human germline VK L6 gene, VK LI 8 gene, VK L15 gene, VK L20 gene, VK A27 gene, VK JK5 gene, VK JK4 gene, VK JK2 gene, and VK JK1 gene. Accordingly, provide herein are isolated monoclonal antibodies, or antigen- binding portions thereof, comprising a light chain variable region that is the product of or derived from a human VK germline gene selected from the group consisting of: VK L6, VK LI 8, VK L15, VK L20, VK A27, VK JK5, VK JK4, VK JK2, and VK JK1.
- Preferred antibodies described herein are those comprising a heavy chain variable region that is the product of or derived from one of the above-listed human germline VH genes and also comprising a light chain variable region that is the product of or derived from one of the above- listed human germline VK genes, as shown in Figures 2- 11.
- a human antibody comprises heavy or light chain variable regions that is "the product of or "derived from” a particular germline sequence if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
- Such systems include immunizing a transgenic mouse carrying human immunoglobulin genes with the antigen of interest or screening a human immunoglobulin gene library displayed on phage with the antigen of interest.
- a human antibody that is "the product of or "derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequences of human germline
- a human antibody that is "the product of or "derived from” a particular human germline immunoglobulin sequence may contain amino acid differences as compared to the germline sequence, due to, for example, naturally-occurring somatic mutations or intentional introduction of site-directed mutation.
- a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g. , murine germline sequences).
- a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene.
- the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- antibodies having heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the preferred antibodies described herein, and wherein the antibodies retain the desired functional properties of the anti-GITR antibodies described herein.
- an isolated anti-GITR antibody, or antigen binding portion thereof may comprise a heavy chain variable region and a light chain variable region, wherein:
- the heavy chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 26, 39, 52, 71, 84, 97, 115, 128, and 335, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 26, 39, 52, 71, 84, 97, 115, 128, and 335;
- the light chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 27, 40, 53, 54, 72, 85, 98, 99, 116, 129, 130, and 336, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 27, 40, 53, 54, 72, 85, 98, 99, 116, 129, 130, and 336;
- the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the following functional properties: (1) binding to soluble human GITR, e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced, by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- the antibody may exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine, ten, eleven, or all of the functional properties listed as (1) through (12) above.
- the antibody can be, for example, a human antibody, a humanized antibody or a chimeric antibody.
- An isolated anti-GITR antibody, or antigen binding portion thereof, may comprise a heavy chain and a light chain, wherein:
- the heavy chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227-275, 337, 339, 340, 348-352, 361, and 362, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102
- the light chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1- 15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371;
- the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the following functional properties:
- binding to soluble human GITR e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with a K D of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by Scatchard;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced, by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- anti-GITR antibodies comprising a VHCDR1, VHCDR2, VHCDR3, VLCDRl, VLCDR2, and/or VLCDR3 that differs from the corresponding CDR of 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10, in 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, or 1-5 amino acid changes (i.e., amino acid substitutions, additions or deletions).
- an anti-GITR antibody comprises 1-5 amino acid changes in each of 1, 2, 3, 4, 5 or 6 of the CDRs relative to the corresponding sequence in 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10. In certain embodiments, an anti-GITR antibody comprises at total of 1-5 amino acid changes across all CDRs relative to the CDRs in 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10.
- an anti-GITR antibody comprises VH and VL CDRs consisting of those of 28F3, wherein one or more of the amino acids in one or more CDRs are those of one of the other anti-GITR antibodies disclosed herein.
- an anti-GITR antibody comprises a VHCDR1 comprising one or more amino acid modifications relative to SYGMH (SEQ ID NO: 20), and may comprise, e.g., one of the following degenerate sequences:
- SYGXH (SEQ ID NO: 372), wherein X is any amino acid, e.g., M or F;
- Xi is any amino acid, e.g., S,N or D
- X 2 is any amino acid, e.g., M or F
- Xi is any amino acid, e.g., S,N or D
- X 2 is any amino acid, e.g., M or F
- X 3 is any amino acid, e.g., H or Q.
- an anti-GITR antibody comprises a VHCDR2 comprising one or more amino acid modifications relative to VIWYEGSNKYYADSVKG (SEQ ID NO: 21), and may comprise one of the following degenerate sequences:
- VIWYX 1 GSNKX 2 YADSVKG (SEQ ID NO: 373), wherein Xi is any amino acid, e.g., E or A; and X 2 is any amino acid, e.g., Y or F; and
- VIWYXiGSNKX 2 YX 3 DSVKG (SEQ ID NO: 374), wherein Xi is any amino acid, e.g., E, A, G or D; X 2 is any amino acid, e.g., Y or F; and X 3 is any amino acid, e.g., A or V.
- an anti-GITR antibody comprises a VHCDR3 comprising one or more amino acid modifications relative to GGSMVRGDYYYGMDV(SEQ ID NO: 22), and may comprise, e.g., one of the following degenerate sequences:
- GGS X 1 VRGD Y Y YGMD V (SEQ ID NO: 375), wherein Xi is any amino acid, e.g., M or V, L, I or A.
- GGS X l VRGX 2 YY YGMD V (SEQ ID NO: 376), wherein Xi is any amino acid, e.g., M or V, L, I or A; and X 2 is any amino acid, e.g., D or E.
- Particular combinations of Xi and X 2 are set forth in the Examples.
- GG (6-7aa) MDVWYYXiMDVW (SEQ ID NO: 377), wherein Xi is any amino acid, e.g., G, S or V.
- Xi is any amino acid, e.g., G, S or V.
- the 6-7 amino acids correspond to the amino acids at that position in a VHCDR3 sequence of an anti-GITR antibody disclosed herein.
- an anti-GITR antibody comprises a VLCDR1 comprising one or more amino acid modifications relative to RASQGISSALA (SEQ ID NO: 23), and may comprise, e.g., one of the following degenerate sequences:
- RASQGISSXLA (SEQ ID NO: 378), wherein X is any amino acid, e.g., A or W (or A, W or Y); and
- RASQG (2-3 aa) SXiLA (SEQ ID NO: 379), wherein Xi is any amino acid, e.g., W, Y or A and the 2-3 amino acids are any amino acids, e.g., GI, SVS or SVT.
- an anti-GITR antibody comprises a VLCDR2 comprising one or more amino acid modifications relative to DASSLES (SEQ ID NO: 24), and may comprise, e.g., one of the following degenerate sequences:
- DASSLXS (SEQ ID NO: 380), wherein X is any amino acid, e.g., E or Q; and
- Xi is any amino acid, e.g., A, D or G
- X 4 is any amino acid, e.g., L or R
- X 3 is any amino acid, e.g., Q, E or A
- X 4 is any amino acid, e.g., S or T.
- an anti-GITR antibody comprises a VLCDR3 comprising one or more amino acid modifications relative to QQFNSYPYT (SEQ ID NO: 25), and may comprise, e.g., one of the following degenerate sequences:
- QQXNSYPYT (SEQ ID NO: 381), wherein X is any amino acid, e.g., F or Y;
- Xi is any amino acid, e.g., F or Y
- X 2 is any amino acid, e.g., N or G
- X 3 is any amino acid, e.g., Y or S
- X 4 is any amino acid, e.g., Y, W, I, P or Q.
- Antibodies having sequences with homology to those of 28F3, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, 19D3, 18E10, and/or 6G10 e.g., the V H and V L regions of SEQ ID NOs: 13, 26, 39, 52, 71, 84, 97, 115, 128, and 335, and SEQ ID NOs: 14, 27, 40, 53, 54, 72, 85, 98, 99, 116, 129, 130, and 336, respectively, or heavy and light chains of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, and 337, and SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132,
- Anti-GITR antibodies may comprise a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the preferred antibodies described herein (e.g. , 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10), or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-GITR antibodies described herein.
- an isolated anti-GITR antibody, or antigen binding portion thereof may comprise a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
- the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 22, 35, 48, 64, 80, 93, 108, 124, 140, and 344, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions;
- the light chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequence of SEQ ID NOs: 25, 38, 51, 67, 70, 83, 96, 111, 114, 127, 143, 146, and 347, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions;
- the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the following functional properties: (1) binding to soluble human GITR, e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced, by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions; and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 24, 37, 50, 66, 69, 82, 95, 110, 113, 126, 142, 145, and 346, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the heavy chain variable region CDRl sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions; and the light chain variable region CDRl sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 23, 36, 49, 65, 68, 81, 94, 109, 112, 125, 141, 144, and 345, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the antibody may exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine, or all of the functional properties listed as (1) through (12) above.
- Such antibodies can be, for example, human antibodies, humanized antibodies or chimeric antibodies.
- amino acid substitutions may also be made in portions of the antibodies other than, or in addition to, the CDRs.
- conservative amino acid modifications may be made in a framework region or in the Fc region.
- a variable region or a heavy or light chain may comprise 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 conservative amino acid substitutions relative to the anti-GITR antibody sequences provided herein.
- an anti-GITR antibody comprises a combination of conservative and non- conservative amino acid modification.
- antibodies that compete for binding to GITR with the particular anti- GITR antibodies described herein e.g., antibodies 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10).
- Such competing antibodies can be identified based on their ability to competitively inhibit binding to GITR of one or more of monoclonal antibodies 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 in standard GITR binding assays.
- standard ELISA assays or competitive ELISA assays can be used in which a recombinant human GITR protein is immobilized on the plate, various concentrations of unlabeled first antibody is added, the plate is washed, labeled second antibody is added, and the amount of label is measured. If the increasing concentration of the unlabeled (first) antibody (also referred to as the "blocking antibody") inhibits the binding of the labeled (second) antibody, the first antibody is said to inhibit the binding of the second antibody to the target on the plate, or is said to compete with the binding of the second antibody.
- BIAcore analysis can be used to assess the ability of the antibodies to compete. The ability of a test antibody to inhibit the binding of an anti-GITR antibody described herein to GITR demonstrates that the test antibody can compete with the antibody for binding to GITR.
- anti-GITR antibodies that inhibit the binding of an anti- GITR antibodies described herein to GITR on cells, e.g., activated T cells, by at least 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% and/or whose binding to GITR on cells, e.g., activated T cells, is inhibited by at least 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% , e.g., as measured by ELISA or FACS, such as by using the assay described in the following paragraph.
- activated human T cells are prepared as follows: Peripheral Blood Mononuclear Cells (PBMCs) are isolated from human whole blood using Ficoll gradient and activated with 10 ⁇ g/mL
- PHA-L phytohaemagglutinin
- the activated T cells are resuspended in FACS buffer (PBS with 5% Fetal Bovine Serum) and seeded at 10 5 cells per sample well in a 96 well plate.
- FACS buffer PBS with 5% Fetal Bovine Serum
- the plate is set on ice followed by the addition of unconjugated first antibody at concentrations ranging from 0 to 50 ⁇ g/mL (three-fold titration starting from a highest concentration of 50 ⁇ g/mL).
- An unrelated IgG may be used as an isotype control for the first antibody and added at the same concentrations (three-fold titration starting from a highest concentration of 50 ⁇ g/mL).
- a sample pre-incubated with 5(Vg/mL unlabeled second antibody may be included as a positive control for complete blocking (100% inhibition) and a sample without antibody in the primary incubation may be used as a negative control (no competition; 0% inhibition).
- labeled e.g., biotinylated
- second antibody is added at a concentration of 2 ⁇ g/mL per well without washing. Samples are incubated for another 30 minutes on ice. Unbound antibodies are removed by washing the cells with FACS buffer. Cell-bound labeled second antibody is detected with an agent that detects the label, e.g., PE conjugated streptavidin
- the samples are acquired on a FACS Calibur Flow Cytometer (BD, San Jose) and analyzed with Flowjo software (Tree Star, Inc, Ashland, OR).
- the results may be represented as the % inhibition (i.e., subtracting from 100% the amount of label at each concentration divided by the amount of label obtained with no blocking antibody).
- the same experiment is then conducted in the reverse, i.e., the first antibody is the second antibody and the second antibody is the first antibody.
- an antibody at least partially (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) or completely (100%) blocks the binding of the other antibody to the target, e.g. human GITR or portion thereof, and regardless of whether inhibition occurs when one or the other antibody is the first antibody.
- a first and a second antibody "cross-block" binding of each other to the target, when the antibodies compete with each other both ways, i.e., in competition experiments in which the first antibody is added first and in competition experiments in which the second antibody is added first.
- anti-GITR antibodies bind to the same epitope as that of the anti-GITR antibodies described herein (e.g., antibodies 28F3, 19D3, 18E10, 3C3-1 , 3C3-2, 2G6, 8A6, 9G7-1 , 9G7-2, 14E3, 19H8-1 , 19H8-2, and 6G10), e.g., as determined by a given epitope mapping technique.
- the 28F3 antibody binds within a region in human GITR within
- QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGE SEQ ID NO: 215.
- an anti-GITR antibody binds to amino acid residues within the region QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGE (SEQ ID NO: 215), corresponding to amino acid residues 1-39 of mature human GITR (SEQ ID NO: 4). In one embodiment, the anti-GITR antibody binds to amino acid residues within the region QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGE (SEQ ID NO: 215), corresponding to amino acid residues 1-39 of mature human GITR (SEQ ID NO: 4). In one embodiment, the anti-GITR antibody binds to amino acid residues within the region QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGE (SEQ ID NO: 215), corresponding to amino acid residues 1-39 of mature human GITR (SEQ ID NO: 4). In one embodiment, the anti-GITR antibody binds to amino acid residues within the region QRPTGGPGCGPGRLLLGTGTDARCCRVHT
- QRPTGGPGCGPGRLLLGTGT SEQ ID NO: 216 of mature human GITR.
- the anti-GITR antibodies described herein binds to amino acid residues within the region PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218) of mature human GITR.
- anti-GITR antibodies bind to amino acid sequences PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218), as determined by HDX, e.g., using the protocol set forth in the Examples.
- Techniques for determining antibodies that bind to the "same epitope on GITR" with the antibodies described herein include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigen: antibody complexes which provides atomic resolution of the epitope. Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component. In addition, computational combinatorial methods for epitope mapping can also be used.
- Methods may also rely on the ability of an antibody of interest to affinity isolate specific short peptides (either in native three dimensional form or in denatured form) from combinatorial phage display peptide libraries.
- the peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library.
- epitope mapping computational algorithms have also been developed which have been shown to map
- Antibodies that compete for binding with, or bind to the same epitope as, the anti-GITR antibodies described herein may be identified by using art-known methods. For example, mice may be immunized with human GITR as described herein, hybridomas produced, and the resulting monoclonal antibodies screened for the ability to compete with an antibody described herein for binding to GITR. Mice can also be immunized with a smaller fragment of GITR containing the epitope to which the antibody binds. The epitope or region comprising the epitope can be localized by, e.g., screening for binding to a series of overlapping peptides spanning GITR.
- the method of Jespers et al., Biotechnology 12:899, 1994 may be used to guide the selection of antibodies having the same epitope and therefore similar properties to the an anti-GITR antibody described herein.
- phage display first the heavy chain of the anti- GITR antibody is paired with a repertoire of (preferably human) light chains to select a GITR- binding antibody, and then the new light chain is paired with a repertoire of (preferably human) heavy chains to select a (preferably human) GITR-binding antibody having the same epitope or epitope region as an anti-GITR antibody described herein.
- variants of an antibody described herein can be obtained by mutagenesis of cDNA encoding the heavy and light chains of the antibody.
- epitope or epitope region is a region comprising the epitope or overlapping with the epitope bound by a specific antibody may also be determined by assessing binding of the antibody to peptides comprising fragments of GITR, e.g., non-denatured or denatured fragments.
- a series of overlapping peptides encompassing the sequence of GITR e.g., human GITR
- Such peptide screening methods may not be capable of detecting some discontinuous functional epitopes, i.e. functional epitopes that involve amino acid residues that are not contiguous along the primary sequence of the GITR polypeptide chain.
- An epitope may also be identified by MS-based protein footprinting, such as
- HDX-MS Hydrogen/deuterium exchange mass spectrometry
- FPOP Fast Photochemical Oxidation of Proteins
- the epitope bound by anti-GITR antibodies may also be determined by structural methods, such as X-ray crystal structure determination (e.g., WO2005/044853), molecular modeling and nuclear magnetic resonance (NMR) spectroscopy, including NMR determination of the H-D exchange rates of labile amide hydrogens in GITR when free and when bound in a complex with an antibody of interest (Zinn-Justin et al. (1992) Biochemistry 31, 11335-11347; Zinn-Justin et al. (1993) Biochemistry 32, 6884-6891).
- X-ray crystallography crystallization may be accomplished using any of the known methods in the art (e.g. Giege et al. (1994) Acta Crystallogr. D50:339-350;
- Crystallization may be best achieved in a precipitant solution containing polyethylene glycol 1000-20,000 (PEG; average molecular weight ranging from about 1000 to about 20,000 Da), preferably about 5000 to about 7000 Da, more preferably about 6000 Da, with concentrations ranging from about 10% to about 30% (w/v). It may also be desirable to include a protein stabilizing agent, e.g. glycerol at a concentration ranging from about 0.5% to about 20%. A suitable salt, such as sodium chloride, lithium chloride or sodium citrate may also be desirable in the precipitant solution, preferably in a concentration ranging from about 1 mM to about 1000 mM.
- the precipitant is preferably buffered to a pH of from about 3.0 to about 5.0, preferably about 4.0.
- Specific buffers useful in the precipitant solution may vary and are well-known in the art (Scopes, Protein Purification: Principles and Practice, Third ed., (1994) Springer- Verlag, New York).
- Examples of useful buffers include, but are not limited to, HEPES, Tris, MES and acetate. Crystals may be grow at a wide range of temperatures, including 2° C, 4° C, 8° C and 26° C.
- Antibody antigen crystals may be studied using well-known X-ray diffraction techniques and may be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Blundell & Johnson (1985) Meth. Enzymol. 114 & 115, H. W. Wyckoff et al., eds., Academic Press; U.S. Patent Application Publication No. 2004/0014194), and BUSTER (Bricogne (1993) Acta Cryst. D49:37-60; Bricogne (1997) Meth. Enzymol. 276A:361-423, Carter & Sweet, eds.; Roversi et al. (2000) Acta Cryst. D56: 1313- 1323), the disclosures of which are hereby incorporated by reference in their entireties.
- X-PLOR Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Blundell
- Anti-GITR antibodies may bind to the same epitope as any of the anti-GITR antibodies having amino acid sequences described herein, as determined by an epitope mapping technique, such as a technique described herein. VII. Engineered and Modified Antibodies
- engineered and modified antibodies that can be prepared using an antibody having one or more of the V H and/or V L sequences disclosed herein as starting material to engineer a modified antibody, which modified antibody may have altered properties from the starting antibody.
- An antibody can be engineered by modifying one or more residues within one or both variable regions (i.e., V H and/or V L ), for example within one or more CDR regions and/or within one or more framework regions. Additionally or alternatively, an antibody can be engineered by modifying residues within the constant region(s), for example to alter the effector function(s) of the antibody.
- variable region engineering One type of variable region engineering that can be performed is CDR grafting.
- Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody- antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. (1998) Nature 332:323-327; Jones, P. et al. (1986) Nature 321 :522-525; Queen, C.
- another embodiment described herein pertains to an isolated monoclonal antibody, or antigen binding portion thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342, SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343, and SEQ ID NOs: 22, 35, 48, 64, 80, 93, 108, 124, 140, and 344, respectively, and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 23, 36, 49, 65, 68, 81, 94, 109, 112, 125, 141, 144, and 345, SEQ ID NOs: 24, 37, 50, 66, 69, 82, 95, 110
- such antibodies contain the V H and V L CDR sequences of monoclonal antibodies 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10, yet may contain different framework sequences from these antibodies.
- Such framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
- germline DNA sequences for human heavy and light chain variable region genes can be found in the "VBase" human germline sequence database (available on the Internet at www.mrc-cpe.cam.ac.uk/vbase), as well as in Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242;
- V H CDR1, 2 and 3 sequences, and the V L CDRl, 2 and 3 sequences can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
- the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
- it has been found that in certain instances it is beneficial to mutate residues within the framework regions to maintain or enhance the antigen binding ability of the antibody see e.g., U.S. Patent Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al).
- Engineered antibodies described herein include those in which modifications have been made to framework residues within V H and/or V L , e.g. to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to "backmutate" one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
- the somatic mutations can be "backmutated” to the germline sequence by, for example, site-directed mutagenesis or PCR- mediated mutagenesis. Such "backmutated” antibodies are also intended to be encompassed.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
- variable region modification is to mutate amino acid residues within the V H and/or V L CDR1, CDR2 and/or CDR3 regions to thereby improve one or more binding properties ⁇ e.g., affinity) of the antibody of interest.
- Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays as described herein and provided in the Examples.
- Preferably conservative modifications are introduced.
- the mutations may be amino acid substitutions, additions or deletions, but are preferably substitutions.
- typically no more than one, two, three, four or five residues within a CDR region are altered.
- isolated anti-GITR monoclonal antibodies, or antigen binding portions thereof comprising a heavy chain variable region comprising: (a) a V H CDR1 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342; (b) a V H CDR2 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 21, 34, 47, 63, 79,
- V L CDR3 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 25, 38,
- Methionine residues in CDRs of antibodies can be oxidized, resulting in potential chemical degradation and consequent reduction in potency of the antibody. Accordingly, also provided are anti-GITR antibodies which have one or more methionine residues in the heavy and/or light chain CDRs replaced with amino acid residues which do not undergo oxidative degradation. In one embodiment, the methionine residues in the CDRs of antibodies 28F3, 18E10, 19D3, and 6G10 are replaced with amino acid residues which do not undergo oxidative degradation.
- deamidation sites may be removed from anti-GITR antibodies, particularly in the CDRs.
- Anti-GITR variable regions described herein may be linked (e.g., covalently linked or fused) to an Fc, e.g., an IgGl, IgG2, IgG3 or IgG4 Fc, which may be of any allotype or isoallotype, e.g., for IgGl: Glm, Glml(a), Glm2(x), Glm3(f), Glml7(z); for IgG2: G2m, G2m23(n); for IgG3: G3m, G3m21(gl), G3m28(g5), G3ml l(b0), G3m5(bl), G3ml3(b3), G3ml4(b4), G3ml0(b5), G3ml5(s), G3ml6(t), G3m6(c3), G3m24(c5), G3m26(u), G3m27(v); and
- anti-GITR variable regions described herein are linked to an Fc that binds to one or more activating Fc receptors (Fcyl, Fcylla or Fcyllla), and thereby stimulate ADCC and may cause T cell depletion.
- anti-GITR variable regions described herein are linked to an Fc that causes depletion.
- mouse IgG2a and rat IgG2b isotypes induced the greatest inhibition of tumor growth in several mouse tumor models.
- the anti-GITR mG2a, mG2b and rG2b isotypes had little effect on, or induced small increases in Treg populations in the periphery versus inducing significant Treg depletion in the tumor environment, which correlated with tumor growth inhibition.
- the mIgG2a isotype caused an increase in the percentage of CD8+ cells at the tumor site, whereas the mlgGl and rat IgG2b caused no, or only marginal increase in, the percentage of CD8+ cells.
- anti-GITR variable regions described herein are linked to a human IgGl or IgG3 Fc, i.e., the antibodies are of the IgGl or IgG3 isotype.
- anti-GITR antibodies are depleting antibodies, in particular, they deplete T reg cells that are in the tumor microenvironment (and thereby enhance anti-tumor activity), but do not significantly deplete T e ff cells that are in the tumor microenvironment and mediate the anti-tumor effect, and/or do not significantly deplete T reg and T e ff cells that are outside of the tumor, e.g., in the periphery.
- anti-GITR antibodies are of an isotype, (either naturally occurring or non-naturally occurring (e.g., incuding mutation(s)) isotype that stimulate T reg cell depletion or elimination at the tumor site and concomitant activation of T e ff cells.
- anti-GITR antibodies create an elevated T e ff to T reg ratio at the tumor site, which is indicative of potent anti-tumor activity, and preferably without significantly depleting T reg and T e ff cells that are outside of the tumor, e.g., in the periphery.
- anti-GITR antibodies block the immunosuppressive activity of Tregs.
- anti-GITR antibodies have an Fc receptor with no, or with reduced, FcR binding, e.g., reduced binding to activating FcRs. In certain embodiments, anti-GITR antibodies have an Fc that binds to or has enhanced binding to FcRIIb, which can provide enhanced agonism.
- the potency of an anti-GITR antibody to potentiate an endogenous immune response is enhanced, optimized or maximized by a method comprising selecting, designing or modifying the Fc region of the antibody so as to enhance the binding of said Fc region to an activating Fc receptor.
- the anti-GITR antibody is TRX- 518.
- anti-GITR variable regions described herein are linked to an effectorless or mostly effectorless Fc, e.g., IgG2 or IgG4.
- Anti-GITR variable regions described herein may be linked to a non-naturally occurring Fc region, e.g., an effectorless Fc or an Fc with enhanced binding to one or more activating Fc receptors (Fcyl, Fcylla or Fcyllla), such as to enhance T reg depletion in the tumor environment.
- Fcyl, Fcylla or Fcyllla activating Fc receptors
- variable regions described herein may be linked to an Fc comprising one or more modification, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- an antibody described herein may be chemically modified (e.g. , one or more chemical moieties can be attached to the antibody) or be modified to alter its
- glycosylation to alter one or more functional properties of the antibody.
- Each of these embodiments is described in further detail below.
- the numbering of residues in the Fc region is that of the EU index of Kabat.
- the Fc region encompasses domains derived from the constant region of an
- immunoglobulin preferably a human immunoglobulin, including a fragment, analog, variant, mutant or derivative of the constant region.
- Suitable immunoglobulins include IgGl , IgG2, IgG3, IgG4, and other classes such as IgA, IgD, IgE and IgM.
- the constant region of an immunoglobulin preferably a human immunoglobulin, including a fragment, analog, variant, mutant or derivative of the constant region.
- Suitable immunoglobulins include IgGl , IgG2, IgG3, IgG4, and other classes such as IgA, IgD, IgE and IgM.
- immunoglobulin is defined as a naturally-occurring or synthetically-produced polypeptide homologous to the immunoglobulin C -terminal region, and can include a CHI domain, a hinge, a CH2 domain, a CH3 domain, or a CH4 domain, separately or in combination.
- the constant region of an immunoglobulin is responsible for many important antibody functions including Fc receptor (FcR) binding and complement fixation.
- FcR Fc receptor
- IgG is separated into four subclasses known as IgG l, IgG2, IgG3, and IgG4.
- Ig molecules interact with multiple classes of cellular receptors.
- IgG molecules interact with three classes of Fey receptors (FcyR) specific for the IgG class of antibody, namely FcyRI, FcyRII, and FcyRIII.
- FcyR Fey receptors
- the important sequences for the binding of IgG to the FcyR receptors have been reported to be located in the CH2 and CHS domains.
- the serum half-life of an antibody is influenced by the ability of that antibody to bind to an Fc receptor (FcR).
- the Fc region is a variant Fc region, e.g., an Fc sequence that has been modified (e.g., by amino acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity.
- a variant Fc region e.g., an Fc sequence that has been modified (e.g., by amino acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity.
- Fc region variants will generally comprise at least one amino acid modification in the Fc region. Combining amino acid modifications is thought to be particularly desirable.
- the variant Fc region may include two, three, four, five, etc substitutions therein, e.g. of the specific Fc region positions identified herein.
- a valiant Fc region may also comprise a sequence alteration wherein amino acids involved in disulfide bond formation are removed or replaced with other amino acids. Such removal may avoid reaction with other cysteine-containing proteins present in the host cell used to produce the antibodies described herein. Even when cysteine residues are removed, single chain Fc domains can still form a dimeric Fc domain that is held together non-covalently.
- the Fc region may be modified to make it more compatible with a selected host cell. For example, one may remove the PA sequence near the N-terminus of a typical native Fc region, which may be recognized by a digestive enzyme in E. coli such as proline
- one or more glycosylation sites within the Fc domain may be removed. Residues that are typically glycosylated (e.g., asparagine) may confer cytolytic response. Such residues may be deleted or substituted with unglycosylated residues (e.g., alanine).
- sites involved in interaction with complement such as the Clq binding site, may be removed from the Fc region. For example, one may delete or substitute the EKK sequence of human IgGl .
- sites that affect binding to Fc receptors may be removed, preferably sites other than salvage receptor binding sites. In other
- an Fc region may be modified to remove an ADCC site.
- ADCC sites are known in the art; see, for example, Molec. Immunol. 29 (5): 633-9 (1992) with regard to ADCC sites in IgGl. Specific examples of variant Fc domains are disclosed for example, in WO 97/34631 and WO 96/32478.
- the hinge region of Fc is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Patent No. 5,677,425 by Bodmer et al.
- the number of cysteine residues in the hinge region of Fc is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc -hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
- SpA Staphylococcyl protein A
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the CI component of complement. This approach is described in further detail in U.S. Patent Nos. 5,624,821 and 5,648,260, both by Winter et al.
- one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
- the Fc region may be modified to increase antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity for an Fey receptor by modifying one or more amino acids at the following positions: 234, 235, 236, 238, 239, 240, 241, 243, 244, 245, 247, 248, 249, 252, 254, 255, 256, 258, 262, 263, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 299, 301, 303, 305, 307, 309, 312, 313, 315, 320, 322, 324, 325, 326, 327, 329, 330, 331, 332, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416, 419, 430, 433, 4
- ADCC
- Exemplary substitutions include 236A, 239D, 239E, 268D, 267E, 268E, 268F, 324T, 332D, and 332E
- Exemplary variants include 239D/332E, 236A/332E, 236A/239D/332E, 268F/324T, 267E/268F, 267E/324T, and 267E/268F/324T.
- Fc modifications that increase binding to an Fey receptor include amino acid
- Fc modifications that can be made to Fes are those for reducing or ablating binding to FcyR and/or complement proteins, thereby reducing or ablating Fe-mediated effector functions such as ADCC, ADCP, and CDC.
- Exemplary modifications include but are not limited substitutions, insertions, and deletions at positions 234, 235, 236, 237, 267, 269, 325, and 328, wherein numbering is according to the EU index.
- Exemplary substitutions include but are not limited to 234G, 235G, 236R, 237K, 267R, 269R, 325L, and 328R, wherein numbering is according to the EU index.
- An Fc variant may comprise 236R/328R.
- the Fc region may comprise a non-naturally occurring amino acid residue at additional and/or alternative positions known to one skilled in the ait (see, e.g., U.S. Pat. Nos. 5,624,821; 6,277,375; 6,737,056; 6,194,551; 7,317,091; 8,101,720; PCT Patent Publications WO 00/42072; WO 01/58957; WO 02/06919; WO 04/016750; WO 04/029207; WO 04/035752; WO 04/074455; WO 04/099249; WO 04/063351; WO 05/070963; WO 05/040217, WO 05/092925 and WO 06/020114).
- Fc variants that enhance affinity for an inhibitory receptor FcyRllb may also be used. Such variants may provide an Fc fusion protein with immunomodulatory activities related to FcyRllb '*' cells, including for example B cells and monocytes. In one embodiment, the Fc variants provide selectively enhanced affinity to FcyRllb relative to one or more activating receptors. Modifications for altering binding to FcyRllb include one or more modifications at a position selected from the group consisting of 234, 235, 236, 237, 239, 266, 267, 268, 325, 326, 327, 328, and 332, according to the EU index.
- Exemplary substitutions for enhancing FcyRllb affinity include but are not limited to 234D, 234E, 234F, 234W, 235D, 235F, 235R, 235Y, 236D, 236N, 237D, 237N, 239D, 239E, 266M, 267D, 267E, 268D, 268E, 327D, 327E, 328F, 328W, 328Y, and 332E.
- Exemplary substitutions include 235Y, 236D, 239D, 266M, 267E, 268D, 268E, 328F, 328W, and 328Y.
- Fc variants for enhancing binding to FcyRllb include 235Y/267E, 236D/267E, 239D/268D, 239D/267E, 267E/268D, 267E/268E, and 267E/328F.
- the affinities and binding properties of an Fc region for its ligand may be determined by a variety of in vitro assay methods (biochemical or immunological based assay s) known in the ait including but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA), or radioimmunoassay (RIA)), or kinetics (e.g., BIACORE analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- in vitro assay methods biochemical or immunological based assay s
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA), or radioimmunoassay (RIA)
- kinetics e.g., BIACORE analysis
- indirect binding assays e.g., competitive inhibition assays, fluorescence resonance energy transfer (FRET),
- These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- the antibody is modified to increase its biological half-life.
- this may be done by increasing the binding affinity of the Fc region for FcRn.
- one or more of more of following residues can be mutated: 252, 254, 256, 433, 435, 436, as described in U.S. Pat. No. 6,277,375.
- Specific exemplary substitutions include one or more of the following: T252L, T254S, and/or T256F.
- the antibody can be altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos.
- exemplary variants that increase binding to FcRn and/or improve pharmacokinetic properties include substitutions at positions 259, 308, 428, and 434, including for example 2591, 308F, 428L, 428M, 434S, 434H, 434F, 434Y, and 434M.
- Other variants that increase Fc binding to FcRn include: 250E, 250Q, 428L, 428F, 250Q/428L (Hinton et al., 2004, J. Biol. Chem.
- hybrid IgG isotypes with particular biological characteristics may be used.
- an IgGl/IgG3 hybrid variant may be constructed by substituting IgG! positions in the CH2 and/or CH3 region with the amino acids from IgG3 at positions where the two isotypes differ.
- hybrid variant IgG antibody- may be constructed that comprises one or more substitutions, e.g., 274Q, 276 , 300F, 339T, 356E, 358M, 384S, 392N, 397M, 4221, 435R, and 436F.
- an IgGl/IgCi2 hybrid variant may be constructed by substituting IgG2 positions in the CH2 and/or CH3 region with amino acids from IgG! at positions where the two isotypes differ.
- hybrid variant IgG antibody may be constructed that comprises one or more substitutions, e.g., one or more of the following amino acid substitutions: 233E, 234L, 235 L, -236G (referring to an insertion of a glycine at position 236), and 327A.
- Fc mutants include: S298A/E333A/L334A, S239D/I332E, S239D/I332E/A330L, L235V/F243L/R292P/Y300L/ P396L, and M428L/N434S.
- an Fc is chosen that has reduced binding to FcyRs.
- An exemplary Fc, e.g., IgGl Fc, with reduced FcyR binding comprises the following three amino acid substitutions: L234A, L235E and G237A.
- an Fc is chosen that has reduced complement fixation.
- An exemplary Fc e.g., IgGl Fc, with reduced complement fixation has the following two amino acid substitutions: A330S and P331S.
- an Fc is chosen that has essentially no effector function, i.e., it has reduced binding to FcyRs and reduced complement fixation.
- An exemplary Fc, e.g., IgGl Fc, that is effectorless comprises the following five mutations: L234A, L235E, G237A, A330S and P331S. Exemplary heavy chains comprising these mutations are set forth in Table 15.
- the glycosylation of an antibody is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen.
- carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such aglycosylation may increase the affinity of the antibody for antigen.
- Glycosylation of the constant region on N297 may be prevented by mutating the N297 residue to another residue, e.g., N297A, and/or by mutating an adjacent amino acid, e.g., 298 to thereby reduce glycosylation on N297.
- an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
- altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies.
- carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies described herein to thereby produce an antibody with altered glycosylation.
- glycoprotein-modifying glycosyl transferases ⁇ e.g., beta(l,4)-N-acetylglucosaminyltransferase III (GnTIII)
- GnTIII glycoprotein-modifying glycosyl transferases
- An antibody can be pegylated to, for example, increase the biological ⁇ e.g., serum) half-life of the antibody.
- the antibody, or fragment thereof typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated is an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies described herein. See for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
- Antibodies described herein can contain one or more glycosylation sites in either the light or heavy chain variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or an alteration of the pK of the antibody due to altered antigen binding
- Glycosylation has been known to occur at motifs containing an N-X-S/T sequence. In some instances, it is preferred to have an anti-GITR antibody that does not contain variable region glycosylation. This can be achieved either by selecting antibodies that do not contain the glycosylation motif in the variable region or by mutating residues within the glycosylation region.
- the antibodies described herein do not contain asparagine isomerism sites.
- the deamidation of asparagine may occur on N-G or D-G sequences and result in the creation of an isoaspartic acid residue that introduces a kink into the polypeptide chain and decreases its stability (isoaspartic acid effect).
- Each antibody will have a unique isoelectric point (pi), which generally falls in the pH range between 6 and 9.5.
- the pi for an IgGl antibody typically falls within the pH range of 7-9.5 and the pi for an IgG4 antibody typically falls within the pH range of 6-8.
- an anti-GITR antibody that contains a pi value that falls in the normal range. This can be achieved either by selecting antibodies with a pi in the normal range or by mutating charged surface residues.
- each antibody will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71).
- T M I the temperature of initial unfolding
- the melting point of an antibody can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20: 1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- antibodies are selected that do not degrade rapidly. Degradation of an antibody can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- CE capillary electrophoresis
- MALDI-MS Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- antibodies are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
- antibodies are acceptable with aggregation of 25% or less, preferably 20% or less, even more preferably 15% or less, even more preferably 10% or less and even more preferably 5% or less.
- Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
- the anti-GITR antibodies having V H and V L sequences disclosed herein can be used to create new anti-GITR antibodies by modifying the VH and/or VL sequences, or the constant region(s) attached thereto.
- the structural features of an anti-GITR antibody described herein e.g. 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10 are used to create structurally related anti-GITR antibodies that retain at least one functional property of the antibodies described herein, such as binding to human GITR and cynomolgus GITR.
- one or more CDR regions of 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10, or mutations thereof can be combined recombinantly with known framework regions and/or other CDRs to create additional, recombinantly-engineered, anti-GITR antibodies described herein, as discussed above.
- Other types of modifications include those described in the previous section.
- the starting material for the engineering method is one or more of the V H and/or V L sequences provided herein, or one or more CDR regions thereof.
- the engineered antibody it is not necessary to actually prepare ⁇ i.e., express as a protein) an antibody having one or more of the V H and/or V L sequences provided herein, or one or more CDR regions thereof. Rather, the information contained in the sequence(s) is used as the starting material to create a "second generation" sequence(s) derived from the original sequence(s) and then the "second generation" sequence(s) is prepared and expressed as a protein.
- an anti-GITR antibody comprising:
- a heavy chain variable region antibody sequence comprising a CDR1 sequence selected from the group consisting of SEQ ID NOs: 20, 33, 46, 62, 78, 91, 106, 122, 138, and 342, a CDR2 sequence selected from the group consisting of SEQ ID NOs: 21, 34, 47, 63, 79, 92, 107, 123, 139, and 343, and/or a CDR3 sequence selected from the group consisting of SEQ ID NOs: 22, 35, 48, 64, 80, 93, 108, 124, 140, and 344; and (ii) a light chain variable region antibody sequence comprising a CDR1 sequence selected from the group consisting of SEQ ID NOs: 23, 36, 49, 65, 68, 81, 94, 109, 112, 125, 141, 144, and 345, a CDR2 sequence selected from the group consisting of SEQ ID NOs: 24, 37, 50, 66, 69, 82,
- Standard molecular biology techniques can be used to prepare and express the altered antibody sequence.
- the antibody encoded by the altered antibody sequence(s) is one that retains one, some or all of the functional properties of the anti-GITR antibodies described herein, which include,
- soluble human GITR e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to membrane bound human GITR e.g., with an EC 50 of 1 nM or less (e.g., 0.01 nM to 1 nM), e.g., as measured by FACS;
- binding to cynomolgus GITR e.g., bind to membrane bound cynomolgus GITR, e.g, with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by FACS;
- inducing or enhancing T cell activation such as in the presence of CD3 engagement (e.g., in the presence of suboptimal anti-CD3 concentrations), as evidenced, by (i) increased IL-2 and/or IFN- ⁇ production in GITR-expressing T cells and/or (ii) enhanced T cell proliferation;
- the altered antibody may exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, eleven, or all of the functional properties set forth as (1) through (12) above.
- the functional properties of the altered antibodies can be assessed using standard assays available in the art and/or described herein, such as those set forth in the Examples (e.g. , ELISAs, FACS).
- mutations can be introduced randomly or selectively along all or part of an anti-GITR antibody coding sequence and the resulting modified anti-GITR antibodies can be screened for binding activity and/or other functional properties as described herein.
- Mutational methods have been described in the art.
- PCT Publication WO 02/092780 by Short describes methods for creating and screening antibody mutations using saturation mutagenesis, synthetic ligation assembly, or a combination thereof.
- PCT Publication WO 03/074679 by Lazar et al. describes methods of using computational screening methods to optimize physiochemical properties of antibodies.
- nucleic acid molecules that encode the antibodies described herein.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g. , other cellular nucleic acids (e.g., other chromosomal DNA, e.g., the chromosomal DNA that is linked to the isolated DNA in nature) or proteins, by standard techniques, including
- a nucleic acid described herein can be, for example, DNA or RNA and may or may not contain intronic sequences. In a certain embodiments, the nucleic acid is a cDNA molecule.
- Nucleic acids described herein can be obtained using standard molecular biology techniques.
- hybridomas e.g. , hybridomas prepared from transgenic mice carrying human immunoglobulin genes as described further below
- cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by standard PCR amplification or cDNA cloning techniques.
- nucleic acid encoding the antibody can be recovered from the library.
- Preferred nucleic acids molecules described herein are those encoding the VH and VL sequences of the 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7- 1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 monoclonal antibodies.
- Exemplary DNA sequences encoding the VH sequences of 28F3, 19D3, 18E10, 3C3, 2G6, 8A6, 9G7, 14E3, 19H8, and 6G10 are set forth in SEQ ID NOs: 147, 154, 158, 162, 168, 172, 176, 182, 186, and 353, respectively.
- Exemplary DNA sequences encoding the VL sequences of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are set forth in SEQ ID NOs: 148, 155, 163, 164, 169, 173, 177, 178, 183, 187, 188, and 354, respectively.
- Exemplary DNA sequences encoding the heavy chain sequences of 28F3, 19D3, 18E10, 3C3 (3C3-1 and 3C3-2), 2G6, 8A6, 9G7 (9G7-1 and 9G7-2), 14E3, 19H8 (19H8-1 and 19H8-2), and 6G10 are set forth in SEQ ID NOs: 149, 156, 160, 165, 170, 174, 179, 184, 189, and 355, respectively.
- Exemplary DNA sequences encoding the light chain sequences of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 are set forth in SEQ ID NOs: 150, 157, 161, 166, 167, 171, 175, 181, 180, 185, 190, 191, and 356, respectively.
- Exemplary nucleic acids encoding the mature VH and VL domains of 28F3.IgGl and 28F3.IgGl. l (same variable region) antibodies are set forth as SEQ ID NOs: 147 and 148, respectively.
- Exemplary nucleic acids encoding the mature heavy chains of 28F3.IgGl and 28F3.IgGl. l antibodies are set forth as SEQ ID NOs: 151 and 152, respectively, and an exemplary nucleic acid encoding the mature light chain of 28F3.IgGl and 28F3.IgGl. l antibodies is set forth as SEQ ID NO: 153.
- VH and VL domains of 28F3.IgGl and 28F3.IgGl. l (same variable region) antibodies with a signal peptide are set forth as SEQ ID NOs: 357 and 358, respectively, and the nucleotide sequences encoding these are set forth as SEQ ID NOs: 359 and 360, respectively.
- Exemplary heavy chains of 28F3.IgGl and 28F3.IgGl.l antibodies with a signal peptide are set forth as SEQ ID NOs: 361 and 362, respectively, and exemplary nucleotide sequences encoding these are set forth as SEQ ID NOs: 363 and 364, respectively.
- An exemplary light chain of 28F3.IgGl and 28F3.IgGl. l antibodies with a signal peptide is set forth as SEQ ID NO: 365, and an exemplary nucleotide sequence encoding it is set forth as SEQ ID NOs: 366.
- a method for making 28F3.IgGl may comprise expressing the heavy chain and the light chains in a cell line comprising the nucleotide sequences encoding the heavy and light chains with a signal peptide, e.g., SEQ ID NO: 363 and 365, respectively.
- a method for making 28F3.IgGl. l may comprise expressing the heavy chain and the light chains in a cell line comprising the nucleotide sequences encoding the heavy and light chains with a signal peptide, e.g., SEQ ID NO: 364 and 366, respectively.
- Host cells comprising these nucleotide sequences are encompassed herein.
- VH and VL segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene.
- a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker.
- the term "operatively linked”, as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
- the isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (hinge, CHI, CH2 and/or CH3).
- heavy chain constant regions hinge, CHI, CH2 and/or CH3.
- the sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat, E. A., el al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the heavy chain constant region can be an IgGl, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region, for example, an IgGl region.
- the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CHI constant region.
- the isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL.
- the sequences of human light chain constant region genes are known in the art (see e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the light chain constant region can be a kappa or lambda constant region.
- the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly 4 - Ser) 3 , such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH regions joined by the flexible linker (see e.g., Bird et al. (1988) Science 242:423-426; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al, (1990) Nature 348:552-554).
- a flexible linker e.g., encoding the amino acid sequence (Gly 4 - Ser) 3
- nucleic acid molecules encoding VH and VL sequences that are homologous to those of the 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 monoclonal antibodies.
- nucleic acid molecules encode VH and VL sequences that are at least 70% identical, for example, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical, to nucleic acid molecules encoding the VH and VL sequences of the 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and 6G10 monoclonal antibodies.
- nucleic acid molecules with conservative substitutions i.e., substitutions that do not alter the resulting amino acid sequence upon translation of nucleic acid molecule, e.g., for codon optimization.
- Monoclonal antibodies described herein can be produced using a variety of known techniques, such as the standard somatic cell hybridization technique described by Kohler and Milstein, Nature 256: 495 (1975). Although somatic cell hybridization procedures are preferred, in principle, other techniques for producing monoclonal antibodies also can be employed, e.g., viral or oncogenic transformation of B lymphocytes, phage display technique using libraries of human antibody genes.
- the preferred animal system for preparing hybridomas is the murine system.
- Hybridoma production in the mouse is a very well-established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners ⁇ e.g., murine myeloma cells) and fusion procedures are also known.
- Chimeric or humanized antibodies described herein can be prepared based on the sequence of a murine monoclonal antibody prepared as described above.
- DNA encoding the heavy and light chain immunoglobulins can be obtained from the murine hybridoma of interest and engineered to contain non-murine ⁇ e.g.,. human) immunoglobulin sequences using standard molecular biology techniques.
- the murine variable regions can be linked to human constant regions using methods known in the art (see e.g., U.S. Patent No. 4,816,567 to Cabilly et ah).
- the murine CDR regions can be inserted into a human framework using methods known in the art (see e.g., U.S. Patent No. 5,225,539 to Winter, and U.S. Patent Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al).
- the antibodies described herein are human monoclonal antibodies.
- Such human monoclonal antibodies directed against GITR can be generated using transgenic or transchromosomic mice carrying parts of the human immune system rather than the mouse system.
- transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as "human Ig mice.”
- the HuMAb mouse® (Medarex, Inc.) contains human immunoglobulin gene miniloci that encode unrearranged human heavy ( ⁇ and ⁇ ) and ⁇ light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and ⁇ chain loci (see e.g., Lonberg, et al. (1994) Nature 368(6474): 856-859). Accordingly, the mice exhibit reduced expression of mouse IgM or ⁇ , and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgGK monoclonal (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N.
- antibodies described herein are raised using a mouse that carries human immunoglobulin sequences on transgenes and transchomosomes, such as a mouse that carries a human heavy chain transgene and a human light chain transchromosome.
- KM mice a mouse that carries a human heavy chain transgene and a human light chain transchromosome.
- transgenic animal systems expressing human immunoglobulin genes are available in the art and can be used to raise anti-GITR antibodies described herein.
- an alternative transgenic system referred to as the Xenomouse (Abgenix, Inc.) can be used; such mice are described in, for example, U.S. Patent Nos. 5,939,598; 6,075,181; 6,114,598; 6, 150,584 and 6,162,963 to Kucherlapati et al.
- mice carrying both a human heavy chain transchromosome and a human light chain tranchromosome referred to as "TC mice” can be used; such mice are described in Tomizuka et al. (2000) Proc. Natl. Acad. Sci. USA 97:722-727.
- cows carrying human heavy and light chain transchromosomes have been described in the art
- Additional mouse systems described in the art for raising human antibodies include (i) the Veloclmmune® mouse (Regeneron Pharmaceuticals, Inc.), in which the endogenous mouse heavy and light chain variable regions have been replaced, via homologous recombination, with human heavy and light chain variable regions, operatively linked to the endogenous mouse constant regions, such that chimeric antibodies (human
- V/mouse C V/mouse C
- mice V/mouse C
- MeMo® mouse MeMo® mouse
- mice in which the mouse contains unrearranged human heavy chain variable regions but a single rearranged human common light chain variable region.
- Such mice, and use thereof to raise antibodies, are described in, for example, WO 2009/15777, US
- Human monoclonal antibodies described herein can also be prepared using phage display methods for screening libraries of human immunoglobulin genes. Such phage display methods for isolating human antibodies are established in the art. See for example: U.S. Patent Nos. 5,223,409; 5,403,484; and 5,571,698 to Ladner et al ; U.S. Patent Nos. 5,427,908 and 5,580,717 to Dower et al ; U.S. Patent Nos.
- Human monoclonal antibodies described herein can also be prepared using SCID mice into which human immune cells have been reconstituted such that a human antibody response can be generated upon immunization.
- SCID mice into which human immune cells have been reconstituted such that a human antibody response can be generated upon immunization.
- Such mice are described in, for example, U.S. Patent Nos. 5,476,996 and 5,698,767 to Wilson et al
- transgenic or transchromosomal mice containing human immunoglobulin genes can be immunized with a purified or enriched preparation of the GITR antigen and/or cells expressing GITR or fragment thereof, as described for other antigens, for example, by Lonberg et al. (1994) Nature 368(6474): 856-859; Fishwild et al. (1996) Nature Biotechnology 14: 845-851 and WO
- mice can be immunized with DNA encoding human GITR or fragment thereof. Preferably, the mice will be 6-16 weeks of age upon the first infusion.
- a purified or enriched preparation (5-50 ⁇ g) of the recombinant GITR antigen can be used to immunize the HuMAb mice intraperitoneally.
- mice can also be immunized with cells expressing GITR, e.g., a cell line, to promote immune responses.
- Exemplary cell lines include GITR-overexpressing stable CHO and Raji cell lines.
- the HuMAb transgenic mice respond best when initially immunized intraperitoneally (IP) or subcutaneously (SC) with antigen in Ribi's adjuvant, followed by every other week IP/SC immunizations (up to a total of 10) with antigen in Ribi's adjuvant.
- IP intraperitoneally
- SC subcutaneously
- the immune response can be monitored over the course of the immunization protocol with plasma samples being obtained by retroorbital bleeds.
- the plasma can be screened by ELISA and FACS (as described below), and mice with sufficient titers of anti-GITR human immunoglobulin can be used for fusions.
- Mice can be boosted intravenously with antigen 3 days before sacrifice and removal of the spleen and lymph nodes.
- mice are typically immunized for each antigen.
- HCo7, HCol2, and KM strains are used.
- both HCo7 and HCol2 transgene can be bred together into a single mouse having two different human heavy chain transgenes (HCo7/HCol2).
- splenocytes and/or lymph node cells from immunized mice can be isolated and fused to an appropriate immortalized cell line, such as a mouse myeloma cell line.
- an appropriate immortalized cell line such as a mouse myeloma cell line.
- the resulting hybridomas can be screened for the production of antigen- specific antibodies.
- single cell suspensions of splenic lymphocytes from immunized mice can be fused to Sp2/0 nonsecreting mouse myeloma cells (ATCC, CRL 1581) with 50% PEG.
- Cells are plated at approximately 2 x 10 5 in flat bottom microtiter plate, followed by a two week incubation in selective medium containing 10% fetal Clone Serum, 18% "653" conditioned media, 5% origen (IGEN), 4 mM L- glutamine, 1 mM sodium pyruvate, 5mM HEPES, 0.055 mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin, 50 mg/ml gentamycin and IX HAT (Sigma). After approximately two weeks, cells can be cultured in medium in which the HAT is replaced with HT. Individual wells can then be screened by ELISA for human monoclonal IgM and IgG antibodies.
- the antibody secreting hybridomas can be replated, screened again, and if still positive for human IgG, the monoclonal antibodies can be subcloned at least twice by limiting dilution. The stable subclones can then be cultured in vitro to generate small amounts of antibody in tissue culture medium for characterization.
- selected hybridomas can be grown in two-liter spinner-flasks for monoclonal antibody purification. Supernatants can be filtered and
- the buffer solution can be exchanged into PBS, and the concentration can be determined by OD280 using 1.43 extinction coefficient.
- the monoclonal antibodies can be aliquoted and stored at -80° C. Generation of Transfectomas Producing Monoclonal Antibodies to GITR
- Antibodies can be produced in a host cell transfectoma using, for example, a combination of recombinant DNA techniques and gene transfection methods as is well known in the art (Morrison, S. (1985) Science 229: 1202).
- DNAs encoding partial or full-length light and heavy chains can be obtained by standard molecular biology techniques ⁇ e.g., PCR amplification or cDNA cloning using a hybridoma that expresses the antibody of interest) and the DNAs can be inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences.
- operatively linked is intended to mean that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody gene.
- the expression vector and expression control sequences are chosen to be compatible with the expression host cell used.
- the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vector or both genes are inserted into the same expression vector.
- the antibody genes are inserted into the expression vector(s) by standard methods ⁇ e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
- the light and heavy chain variable regions of the antibodies described herein can be used to create full-length antibody genes of any antibody isotype by inserting them into expression vectors already encoding heavy chain constant and light chain constant regions of the desired isotype such that the V H segment is operatively linked to the C H segment(s) within the vector and the V L segment is operatively linked to the C L segment within the vector.
- the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
- the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide ⁇ i.e., a signal peptide from a non-immunoglobulin protein).
- the following signal peptides from human antibody heavy and light chains may be used: MEFGLSWVFLVALLRGVQC (SEQ ID NO: 315);
- MKHLWFFLLLVAAPRWVLS (SEQ ID NO: 321); MEFGLNWVFLVALLRGVQC (SEQ ID NO: 327); MEFGLSWIFLAAILKGVQC (SEQ ID NO: 329); MKHLWFFLLLVAAPRWVLS (SEQ ID NO: 333); MDMRVLAQLLGLLLLCFPGARC (SEQ ID NO: 323);
- MEAPAQLLFLLLLWLPDTTG (SEQ ID NO: 325); MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 317); MRVLAQLLGLLLLCFPGARC (SEQ ID NO: 319); and
- Anti-GITR antibodies can be expressed with the respective signal sequence that was linked to each chain in the hybridoma from which they were cloned.
- signal sequences of various anti-GITR antibodies as present in the hybridoma from which they were cloned which signal sequences can be used to express the same antibody or another antibody:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Hospice & Palliative Care (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG11201803817PA SG11201803817PA (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| EP16805668.7A EP3377532B1 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| CN201680079209.9A CN108738324B (zh) | 2015-11-19 | 2016-11-17 | 抗糖皮质激素诱导的肿瘤坏死因子受体(gitr)抗体及其用途 |
| CA3005855A CA3005855A1 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| MX2018006072A MX2018006072A (es) | 2015-11-19 | 2016-11-17 | Anticuerpos contra receptor de factor de necrosis de tumor inducido por glucocorticoides (gitr) y usos de los mismos. |
| JP2018526125A JP6983776B2 (ja) | 2015-11-19 | 2016-11-17 | グルココルチコイド誘発腫瘍壊死因子受容体(gitr)に対する抗体およびその使用 |
| EA201891121A EA201891121A1 (ru) | 2015-11-19 | 2016-11-17 | Антитела к глюкокортикоид-индуцированному рецептору фактора некроза опухоли (gitr) и их применения |
| BR112018010172A BR112018010172A2 (pt) | 2015-11-19 | 2016-11-17 | anticorpos contra receptor de fator de necrose de tumor induzido por glicocorticoide (gitr) e usos dos mesmos |
| US15/776,591 US11213586B2 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) |
| KR1020187016781A KR20180082563A (ko) | 2015-11-19 | 2016-11-17 | 글루코코르티코이드-유도된 종양 괴사 인자 수용체 (gitr)에 대한 항체 및 그의 용도 |
| AU2016356780A AU2016356780A1 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof |
| ES16805668T ES2926969T3 (es) | 2015-11-19 | 2016-11-17 | Anticuerpos contra el receptor de factor de necrosis de tumor inducido por glucocorticoides (gitr) y usos de los mismos |
| IL259399A IL259399A (en) | 2015-11-19 | 2018-05-16 | Antibodies against glucocorticoid-induced tumor necrosis factor receptors (gitr) and their uses |
| US17/531,061 US20220175921A1 (en) | 2015-11-19 | 2021-11-19 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562257599P | 2015-11-19 | 2015-11-19 | |
| US62/257,599 | 2015-11-19 | ||
| US201662303990P | 2016-03-04 | 2016-03-04 | |
| US62/303,990 | 2016-03-04 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/776,591 A-371-Of-International US11213586B2 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) |
| US17/531,061 Division US20220175921A1 (en) | 2015-11-19 | 2021-11-19 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017087678A2 true WO2017087678A2 (en) | 2017-05-26 |
| WO2017087678A3 WO2017087678A3 (en) | 2017-08-03 |
Family
ID=57472080
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/062540 Ceased WO2017087678A2 (en) | 2015-11-19 | 2016-11-17 | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Country Status (14)
| Country | Link |
|---|---|
| US (2) | US11213586B2 (enExample) |
| EP (1) | EP3377532B1 (enExample) |
| JP (1) | JP6983776B2 (enExample) |
| KR (1) | KR20180082563A (enExample) |
| CN (1) | CN108738324B (enExample) |
| AU (1) | AU2016356780A1 (enExample) |
| BR (1) | BR112018010172A2 (enExample) |
| CA (1) | CA3005855A1 (enExample) |
| EA (1) | EA201891121A1 (enExample) |
| ES (1) | ES2926969T3 (enExample) |
| IL (1) | IL259399A (enExample) |
| MX (1) | MX2018006072A (enExample) |
| SG (1) | SG11201803817PA (enExample) |
| WO (1) | WO2017087678A2 (enExample) |
Cited By (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2018005950A1 (en) | 2016-07-01 | 2018-01-04 | Five Prime Therapeutics, Inc. | Combined anti tumor therapy with a gitr agonist and cpg |
| WO2018213297A1 (en) | 2017-05-16 | 2018-11-22 | Bristol-Myers Squibb Company | Treatment of cancer with anti-gitr agonist antibodies |
| WO2019001559A1 (zh) | 2017-06-30 | 2019-01-03 | 江苏恒瑞医药股份有限公司 | 抗gitr抗体、其抗原结合片段及其医药用途 |
| WO2019089921A1 (en) | 2017-11-01 | 2019-05-09 | Bristol-Myers Squibb Company | Immunostimulatory agonistic antibodies for use in treating cancer |
| WO2019165374A1 (en) | 2018-02-26 | 2019-08-29 | Gilead Sciences, Inc. | Substituted pyrrolizine compounds as hbv replication inhibitors |
| WO2019183040A1 (en) | 2018-03-21 | 2019-09-26 | Five Prime Therapeutics, Inc. | ANTIBODIES BINDING TO VISTA AT ACIDIC pH |
| WO2019195181A1 (en) | 2018-04-05 | 2019-10-10 | Gilead Sciences, Inc. | Antibodies and fragments thereof that bind hepatitis b virus protein x |
| WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
| WO2019195126A1 (en) | 2018-04-02 | 2019-10-10 | Bristol-Myers Squibb Company | Anti-trem-1 antibodies and uses thereof |
| WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
| WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
| WO2019200247A1 (en) | 2018-04-12 | 2019-10-17 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
| WO2020014327A2 (en) | 2018-07-11 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| WO2020014132A2 (en) | 2018-07-09 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to ilt4 |
| CN110719915A (zh) * | 2017-05-25 | 2020-01-21 | 百时美施贵宝公司 | 包含经修饰的重链恒定区的抗体 |
| WO2020028097A1 (en) | 2018-08-01 | 2020-02-06 | Gilead Sciences, Inc. | Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid |
| WO2020092528A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity |
| WO2020092621A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| US10662416B2 (en) | 2016-10-14 | 2020-05-26 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome |
| WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
| CN111732658A (zh) * | 2020-06-28 | 2020-10-02 | 东大生物技术(苏州)有限公司 | 一组gitr单克隆抗体及其医药用途 |
| WO2020214663A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020214652A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020237025A1 (en) | 2019-05-23 | 2020-11-26 | Gilead Sciences, Inc. | Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors |
| WO2021011681A1 (en) | 2019-07-15 | 2021-01-21 | Bristol-Myers Squibb Company | Antibodies against human trem-1 and uses thereof |
| WO2021011678A1 (en) | 2019-07-15 | 2021-01-21 | Bristol-Myers Squibb Company | Anti-trem-1 antibodies and uses thereof |
| WO2021034804A1 (en) | 2019-08-19 | 2021-02-25 | Gilead Sciences, Inc. | Pharmaceutical formulations of tenofovir alafenamide |
| WO2021055698A1 (en) | 2019-09-19 | 2021-03-25 | Bristol-Myers Squibb Company | Antibodies binding to vista at acidic ph |
| US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| WO2021067181A1 (en) | 2019-09-30 | 2021-04-08 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| WO2021113765A1 (en) | 2019-12-06 | 2021-06-10 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| WO2021188959A1 (en) | 2020-03-20 | 2021-09-23 | Gilead Sciences, Inc. | Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same |
| WO2021239935A1 (en) | 2020-05-29 | 2021-12-02 | Universität Zu Köln | Neutralizing antibodies against sars-related coronavirus |
| US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| WO2021262561A1 (en) * | 2020-06-22 | 2021-12-30 | Bristol-Myers Squibb Company | Treating rheumatoid arthritis |
| US11352440B2 (en) | 2014-11-21 | 2022-06-07 | Bristol-Myers Squibb Company | Antibodies against CD73 and uses thereof |
| WO2022241134A1 (en) | 2021-05-13 | 2022-11-17 | Gilead Sciences, Inc. | COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS |
| WO2022261310A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-body drug conjugates |
| WO2022261301A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-cancer agents |
| WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| US11542332B2 (en) | 2016-03-26 | 2023-01-03 | Bioatla, Inc. | Anti-CTLA4 antibodies, antibody fragments, their immunoconjugates and uses thereof |
| EP4190810A1 (en) | 2021-12-01 | 2023-06-07 | Universität zu Köln | Neutralizing antibodies against sars-related coronavirus |
| WO2023099688A1 (en) | 2021-12-01 | 2023-06-08 | Universität Zu Köln | Neutralizing antibodies against sars-related coronavirus |
| EP3999544A4 (en) * | 2019-07-19 | 2023-08-09 | Wuxi Xdc Singapore Private Limited | POLYPEPTIDE COMPLEX FOR CONJUGATION AND ITS USE |
| US11723975B2 (en) | 2017-05-30 | 2023-08-15 | Bristol-Myers Squibb Company | Compositions comprising an anti-LAG-3 antibody or an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody |
| US11807686B2 (en) * | 2017-05-30 | 2023-11-07 | Bristol-Myers Squibb Company | Treatment of LAG-3 positive tumors |
| WO2024020579A1 (en) | 2022-07-22 | 2024-01-25 | Bristol-Myers Squibb Company | Antibodies binding to human pad4 and uses thereof |
| WO2025024265A1 (en) | 2023-07-21 | 2025-01-30 | Bristol-Myers Squibb Company | Methods of assessing citrullination and activity of pad4 modulators |
| EP3470424B1 (en) * | 2016-06-08 | 2025-04-23 | Shanghai Jiao Tong University School of Medicine | Sequence of antibody heavy chain constant region for enhancing agonist antibody activity |
| WO2025085489A1 (en) | 2023-10-17 | 2025-04-24 | Bristol-Myers Squibb Company | Gspt1-degrading compounds, anti-cd33 antibodies and antibody-drug conjugates and uses thereof |
| EP4339209A4 (en) * | 2021-05-10 | 2025-05-28 | MediMabbio Inc. | ANTI-GITR ANTIBODIES AND THEIR USES |
| WO2025145207A1 (en) | 2023-12-29 | 2025-07-03 | Bristol-Myers Squibb Company | Combination therapy of kras inhibitor and treg-depleting agent |
| WO2025174974A1 (en) | 2024-02-14 | 2025-08-21 | Bristol-Myers Squibb Company | Anti-cd33 antibodies and uses thereof |
| WO2025240242A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240243A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus |
| WO2025240246A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240244A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2901705T3 (es) | 2014-06-06 | 2022-03-23 | Bristol Myers Squibb Co | Anticuerpos contra el receptor del factor de necrosis tumoral inducido por glucocorticoides (GITR) y usos de los mismos |
| US10690674B2 (en) | 2015-06-03 | 2020-06-23 | Bristol-Myers Squibb Company | Anti-GITR antibodies for cancer diagnostics |
| US11912766B2 (en) * | 2018-01-11 | 2024-02-27 | Allakos, Inc. | Anti-Siglec-7 antibodies having reduced effector function |
| CN113645996B (zh) * | 2019-02-01 | 2024-04-02 | 新石生物制药有限公司 | 抗claudin 18抗体及其使用方法 |
| WO2021141492A1 (en) * | 2020-01-10 | 2021-07-15 | Kling Biotherapeutics B.V. | Epithelial cadherin-specific antibodies |
| CN115398006A (zh) * | 2020-04-13 | 2022-11-25 | 麦登顾问有限责任公司 | 用于治疗covid-19的ace2靶向组合物和方法 |
Citations (177)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5620886A (en) | 1993-03-18 | 1997-04-15 | Ludwig Institute For Cancer Research | Isolated nucleic acid sequence coding for a tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5804381A (en) | 1996-10-03 | 1998-09-08 | Cornell Research Foundation | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6069233A (en) | 1996-10-03 | 2000-05-30 | Memorial Sloan-Kettering Cancer Center | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| EP1074563A1 (en) | 1999-08-02 | 2001-02-07 | F. Hoffmann-La Roche Ag | Chimeric polypeptides enhancing dimer formation through electrostatic interactions and disulfide bond, method for production and uses thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US6235525B1 (en) | 1991-05-23 | 2001-05-22 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules coding for tumor rejection antigen precursor MAGE-3 and uses thereof |
| WO2001058957A2 (en) | 2000-02-11 | 2001-08-16 | Lexigen Pharmaceuticals Corp. | Enhancing the circulating half-life of antibody-based fusion proteins |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2002006919A2 (en) | 2000-07-18 | 2002-01-24 | Aegis Analytical Corporation | System, method and computer program product for mapping data of multi-database origins |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002090986A1 (en) | 2001-05-04 | 2002-11-14 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| WO2002096910A1 (en) | 2001-05-31 | 2002-12-05 | Medarex, Inc. | Cytotoxins, prodrugs, linkers and stabilizers useful therefor |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US20040072566A1 (en) | 2002-10-15 | 2004-04-15 | Hitachi, Ltd. | Method and apparatus for wiresless position location |
| US20040072565A1 (en) | 2002-08-01 | 2004-04-15 | Nec Corporation | Best-cell amendment method for amending hysteresis margin according to the degree of congestion |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| US6774226B1 (en) | 1999-11-30 | 2004-08-10 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US20060004081A1 (en) | 2004-05-19 | 2006-01-05 | Medarex, Inc. | Cytotoxic compounds and conjugates |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006020114A2 (en) | 2004-08-04 | 2006-02-23 | Applied Molecular Evolution, Inc. | Variant fc regions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| US20060247295A1 (en) | 2005-04-08 | 2006-11-02 | Medarex, Inc. | Cytotoxic compounds and conjugates with cleavable substrates |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
| WO2007051081A1 (en) | 2005-10-26 | 2007-05-03 | Medarex, Inc. | Methods and compounds for preparing cc-1065 analogs |
| WO2007059404A2 (en) | 2005-11-10 | 2007-05-24 | Medarex, Inc. | Duocarmycin derivatives as novel cytotoxic compounds and conjugates |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008083312A2 (en) | 2006-12-28 | 2008-07-10 | Medarex, Inc. | Chemical linkers and cleavable substrates and conjugates thereof |
| WO2008103693A2 (en) | 2007-02-21 | 2008-08-28 | Medarex, Inc. | Chemical linkers with single amino acids and conjugates thereof |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (ja) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用 |
| KR20080105674A (ko) | 2007-05-31 | 2008-12-04 | 울산대학교 산학협력단 | 항-마우스 gitrl 단일클론 항체 또는 항-인간aitrl 단일클론 항체 및 이를 유효성분으로 함유하는염증성 장질환의 예방 및 치료용 조성물 |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009015777A1 (de) | 2007-08-02 | 2009-02-05 | Knorr-Bremse Systeme für Nutzfahrzeuge GmbH | Induktiver weg- oder drehwinkelsensor mit zwischen zwei spulen angeordnetem abschirmblech |
| WO2009045957A1 (en) | 2007-10-01 | 2009-04-09 | Medarex, Inc. | Human antibodies that bind mesothelin, and uses thereof |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009054863A2 (en) | 2006-12-13 | 2009-04-30 | Medarex, Inc. | Human antibodies that bind cd19 and uses thereof |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| WO2009073546A2 (en) | 2007-11-30 | 2009-06-11 | Medarex, Inc. | Monoclonal antibody partner molecule conjugates directed to protein tyrosine kinase 7 (ptk7) |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2009073533A2 (en) | 2007-11-30 | 2009-06-11 | Medarex, Inc. | Anti-b7h4 monoclonal antibody-drug conjugate and methods of use |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009115652A2 (fr) | 2008-01-03 | 2009-09-24 | Universite De La Mediterannee, Aix-Marseille Ii | Composition et procedes utilisables lors d'un traitement anti-vih |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011072204A1 (en) | 2009-12-10 | 2011-06-16 | Regeneron Pharmaceuticals, Inc. | Mice that make heavy chain antibodies |
| WO2011097603A1 (en) | 2010-02-08 | 2011-08-11 | Regeneron Pharmaceuticals, Inc. | Common light chain mouse |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2011107553A1 (en) | 2010-03-05 | 2011-09-09 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011131407A1 (en) | 2010-03-05 | 2011-10-27 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| WO2011163311A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Mice expressing alight chain with human lambda variable and mouse constant regions |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| US8101720B2 (en) | 2004-10-21 | 2012-01-24 | Xencor, Inc. | Immunoglobulin insertions, deletions and substitutions |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2012148873A2 (en) | 2011-04-25 | 2012-11-01 | Regeneron Pharmaceuticals, Inc. | Non-human animals expressing antibodies having a common light chain |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20140065152A1 (en) | 2012-06-08 | 2014-03-06 | National Cancer Center | Novel epitope for switching to th1 cell and use thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
Family Cites Families (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7247302B1 (en) | 1996-08-02 | 2007-07-24 | Bristol-Myers Squibb Company | Method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| JP4440344B2 (ja) | 1996-08-16 | 2010-03-24 | シェーリング コーポレイション | 哺乳動物細胞表面抗原;関連試薬 |
| US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
| WO2001040464A1 (en) | 1999-11-30 | 2001-06-07 | Genentech, Inc. | Interleukin-1-receptor associated kinase-3 (irak3) and its use in promotion or inhibition of angiogenesis and cardiovascularization |
| GB9625074D0 (en) | 1996-12-02 | 1997-01-22 | Pharmacia & Upjohn Spa | Receptor belonging to the TNF/NGF receptor family |
| CA2308114A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| JP4485049B2 (ja) | 1997-11-18 | 2010-06-16 | ジェネンテック, インコーポレイテッド | Dna19355ポリペプチドという腫瘍壊死因子相同体 |
| JP2002502607A (ja) | 1998-02-09 | 2002-01-29 | ジェネンテク・インコーポレイテッド | 新規な腫瘍壊死因子レセプター相同体及びそれをコードする核酸 |
| WO2000005374A2 (en) | 1998-07-22 | 2000-02-03 | Incyte Pharmaceuticals, Inc. | Molecules associated with cell proliferation |
| AU3107000A (en) | 1998-12-01 | 2000-06-19 | Genentech Inc. | Methods and compositions for inhibiting neoplastic cell growth |
| KR100529270B1 (ko) | 1998-12-01 | 2005-11-21 | 제넨테크, 인크. | 혈관신생 및 심혈관형성의 촉진 또는 억제 |
| WO2000050459A1 (en) | 1999-02-24 | 2000-08-31 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
| DK1196186T3 (da) | 1999-07-12 | 2008-03-03 | Genentech Inc | Stimulering eller inhibering af angiogenese og kardiovaskularisation med tumornekrosefaktorligand/receptorhomologer |
| DE60030769T2 (de) | 1999-12-23 | 2007-10-25 | Zymogenetics, Inc., Seattle | Verfahren zur behandlung von entzündungen |
| WO2001046232A2 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Soluble interleukin-20 receptor |
| IL151865A0 (en) | 2000-03-31 | 2003-04-10 | Genentech Inc | Compositions and methods for detecting and quantifying gene expression |
| AU2001274888A1 (en) | 2000-05-19 | 2001-12-03 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| EP1803733B1 (en) | 2000-09-15 | 2010-03-10 | ZymoGenetics, Inc. | Polypeptides comprising the extracellular domains of IL-20RA and/or IL-20RB |
| IL157726A0 (en) | 2001-03-09 | 2004-03-28 | Zymogenetics Inc | Soluble heterodimeric cytokine receptor |
| US20030133936A1 (en) | 2001-07-12 | 2003-07-17 | Byrne Michael Chapman | CD25markers and uses thereof |
| AUPS054702A0 (en) | 2002-02-14 | 2002-03-07 | Immunaid Pty Ltd | Cancer therapy |
| US20060281146A1 (en) | 2002-09-11 | 2006-12-14 | Genetech, Inc. | Novel compositions and methods for the treatment of immune related diseases |
| WO2004039956A2 (en) | 2002-10-29 | 2004-05-13 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| EP2311870A1 (en) | 2002-11-26 | 2011-04-20 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| MXPA05012475A (es) | 2003-05-23 | 2006-05-25 | Wyeth Corp | Anticuerpos y moleculas relacionadas con el ligando para el receptor tnf inducido por glucorticoides (gitr) y el ligando (gitr) y usos de los mismos. |
| WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
| GB0407315D0 (en) | 2003-07-15 | 2004-05-05 | Cambridge Antibody Tech | Human antibody molecules |
| WO2005019258A2 (en) | 2003-08-11 | 2005-03-03 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| WO2005052001A2 (en) | 2003-11-21 | 2005-06-09 | Zymogenetics, Inc. | Anti-il-20 receptor antibodies and binding partners and methods of using in inflammation |
| ES2403055T3 (es) | 2004-04-13 | 2013-05-13 | F. Hoffmann-La Roche Ag | Anticuerpos anti-P-selectina |
| CA2585776A1 (en) | 2004-10-29 | 2006-05-11 | University Of Southern California | Combination cancer immunotherapy with co-stimulatory molecules |
| US20060099171A1 (en) | 2004-11-05 | 2006-05-11 | Masahide Tone | Mouse glucocorticoid-induced TNF receptor ligand is costimulatory for T cells |
| BRPI0606685A2 (pt) | 2005-01-19 | 2009-07-14 | Genzyme Corp | anticorpos gitr para o diagnóstico de nsclc |
| WO2006124269A2 (en) | 2005-05-16 | 2006-11-23 | Amgen Fremont Inc. | Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders |
| WO2006132272A1 (ja) | 2005-06-07 | 2006-12-14 | The University Of Tokyo | 抗体の作製方法 |
| EP1899379B1 (en) | 2005-06-20 | 2018-04-11 | E. R. Squibb & Sons, L.L.C. | Cd19 antibodies and their uses |
| US20090081157A1 (en) | 2006-01-09 | 2009-03-26 | Richard Syd Kornbluth | Immunostimulatory Combinations for Vaccine Adjuvants |
| EP1981969A4 (en) | 2006-01-19 | 2009-06-03 | Genzyme Corp | ANTI-GITRANT ANTIBODIES FOR THE TREATMENT OF CANCER |
| EP2609932B1 (en) | 2006-12-01 | 2022-02-02 | Seagen Inc. | Variant target binding agents and uses thereof |
| PT2175884T (pt) | 2007-07-12 | 2016-09-21 | Gitr Inc | Terapias de combinação empregando moléculas de ligação a gitr |
| HRP20160855T1 (hr) | 2008-02-08 | 2016-09-23 | Medimmune, Llc | Anti-ifnar1 protutijela sa smanjenim afinitetom fc liganda |
| WO2009120922A2 (en) | 2008-03-27 | 2009-10-01 | Zymogenetics, Inc. | Compositions and methods for inhibiting pdgfrbeta and vegf-a |
| JP5837821B2 (ja) | 2009-09-24 | 2015-12-24 | 中外製薬株式会社 | 抗体定常領域改変体 |
| WO2011109789A2 (en) | 2010-03-05 | 2011-09-09 | The Johns Hopkins University | Compositions and methods for targeted immunomodulatory antibodies and fusion proteins |
| WO2011120134A1 (en) | 2010-03-29 | 2011-10-06 | Zymeworks, Inc. | Antibodies with enhanced or suppressed effector function |
| US8637641B2 (en) * | 2010-07-29 | 2014-01-28 | Xencor, Inc. | Antibodies with modified isoelectric points |
| CA2824278C (en) | 2010-12-20 | 2022-09-20 | The Rockefeller University | Modulating agonistic tnfr antibodies |
| EP2665750A1 (en) | 2011-01-17 | 2013-11-27 | Novo Nordisk A/S | Il-21 ligands |
| US9574002B2 (en) | 2011-06-06 | 2017-02-21 | Amgen Inc. | Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor |
| US20130108641A1 (en) | 2011-09-14 | 2013-05-02 | Sanofi | Anti-gitr antibodies |
| WO2013043569A1 (en) | 2011-09-20 | 2013-03-28 | Vical Incorporated | Synergistic anti-tumor efficacy using alloantigen combination immunotherapy |
| SI2852615T1 (sl) | 2012-05-22 | 2019-02-28 | Bristol-Myers Squibb Company | IL-17A/F IL-23 bispecifična protitelesa in njihova uporaba |
| LT2925350T (lt) | 2012-12-03 | 2019-04-10 | Bristol-Myers Squibb Company | Imunomoduliuojančių fc sulietų baltymų priešvėžinio aktyvumo stiprinimas |
| AR097306A1 (es) | 2013-08-20 | 2016-03-02 | Merck Sharp & Dohme | Modulación de la inmunidad tumoral |
| AU2015237864B2 (en) | 2014-03-24 | 2020-12-03 | Cancer Research Technology Limited | Modified antibodies containing modified IgG2 domains which elicit agonist or antagonistic properties and use thereof |
| PH12016502345B1 (en) | 2014-05-28 | 2023-03-01 | Agenus Inc | Anti-gitr antibodies and methods of use thereof |
| ES2901705T3 (es) | 2014-06-06 | 2022-03-23 | Bristol Myers Squibb Co | Anticuerpos contra el receptor del factor de necrosis tumoral inducido por glucocorticoides (GITR) y usos de los mismos |
| AU2015327781A1 (en) | 2014-10-03 | 2017-04-20 | Dana-Farber Cancer Institute, Inc. | Glucocorticoid-induced tumor necrosis factor receptor (GITR) antibodies and methods of use thereof |
| RS60998B1 (sr) * | 2014-11-21 | 2020-11-30 | Bristol Myers Squibb Co | Antitela koja sadrže modifikovane regione teškog lanca |
| US10690674B2 (en) | 2015-06-03 | 2020-06-23 | Bristol-Myers Squibb Company | Anti-GITR antibodies for cancer diagnostics |
-
2016
- 2016-11-17 BR BR112018010172A patent/BR112018010172A2/pt not_active Application Discontinuation
- 2016-11-17 US US15/776,591 patent/US11213586B2/en active Active
- 2016-11-17 CA CA3005855A patent/CA3005855A1/en not_active Abandoned
- 2016-11-17 KR KR1020187016781A patent/KR20180082563A/ko active Pending
- 2016-11-17 ES ES16805668T patent/ES2926969T3/es active Active
- 2016-11-17 AU AU2016356780A patent/AU2016356780A1/en not_active Abandoned
- 2016-11-17 EA EA201891121A patent/EA201891121A1/ru unknown
- 2016-11-17 EP EP16805668.7A patent/EP3377532B1/en active Active
- 2016-11-17 JP JP2018526125A patent/JP6983776B2/ja active Active
- 2016-11-17 SG SG11201803817PA patent/SG11201803817PA/en unknown
- 2016-11-17 CN CN201680079209.9A patent/CN108738324B/zh active Active
- 2016-11-17 MX MX2018006072A patent/MX2018006072A/es unknown
- 2016-11-17 WO PCT/US2016/062540 patent/WO2017087678A2/en not_active Ceased
-
2018
- 2018-05-16 IL IL259399A patent/IL259399A/en unknown
-
2021
- 2021-11-19 US US17/531,061 patent/US20220175921A1/en not_active Abandoned
Patent Citations (208)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5455030A (en) | 1986-09-02 | 1995-10-03 | Enzon Labs, Inc. | Immunotheraphy using single chain polypeptide binding molecules |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5482858A (en) | 1987-05-21 | 1996-01-09 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US5698767A (en) | 1988-06-14 | 1997-12-16 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US6235525B1 (en) | 1991-05-23 | 2001-05-22 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules coding for tumor rejection antigen precursor MAGE-3 and uses thereof |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5620886A (en) | 1993-03-18 | 1997-04-15 | Ludwig Institute For Cancer Research | Isolated nucleic acid sequence coding for a tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| US5854203A (en) | 1993-03-18 | 1998-12-29 | Ludwig Institute For Cancer Research | Tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US6069233A (en) | 1996-10-03 | 2000-05-30 | Memorial Sloan-Kettering Cancer Center | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| US5804381A (en) | 1996-10-03 | 1998-09-08 | Cornell Research Foundation | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6207156B1 (en) | 1997-03-21 | 2001-03-27 | Brigham And Women's Hospital, Inc. | Specific antibodies and antibody fragments |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| EP1074563A1 (en) | 1999-08-02 | 2001-02-07 | F. Hoffmann-La Roche Ag | Chimeric polypeptides enhancing dimer formation through electrostatic interactions and disulfide bond, method for production and uses thereof |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| US6774226B1 (en) | 1999-11-30 | 2004-08-10 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| US6911529B1 (en) | 1999-11-30 | 2005-06-28 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| WO2001058957A2 (en) | 2000-02-11 | 2001-08-16 | Lexigen Pharmaceuticals Corp. | Enhancing the circulating half-life of antibody-based fusion proteins |
| WO2002006919A2 (en) | 2000-07-18 | 2002-01-24 | Aegis Analytical Corporation | System, method and computer program product for mapping data of multi-database origins |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002090986A1 (en) | 2001-05-04 | 2002-11-14 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| US7129261B2 (en) | 2001-05-31 | 2006-10-31 | Medarex, Inc. | Cytotoxic agents |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| US7087600B2 (en) | 2001-05-31 | 2006-08-08 | Medarex, Inc. | Peptidyl prodrugs and linkers and stabilizers useful therefor |
| WO2002096910A1 (en) | 2001-05-31 | 2002-12-05 | Medarex, Inc. | Cytotoxins, prodrugs, linkers and stabilizers useful therefor |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US20040072565A1 (en) | 2002-08-01 | 2004-04-15 | Nec Corporation | Best-cell amendment method for amending hysteresis margin according to the degree of congestion |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US20040072566A1 (en) | 2002-10-15 | 2004-04-15 | Hitachi, Ltd. | Method and apparatus for wiresless position location |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| US20060004081A1 (en) | 2004-05-19 | 2006-01-05 | Medarex, Inc. | Cytotoxic compounds and conjugates |
| WO2006020114A2 (en) | 2004-08-04 | 2006-02-23 | Applied Molecular Evolution, Inc. | Variant fc regions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US8101720B2 (en) | 2004-10-21 | 2012-01-24 | Xencor, Inc. | Immunoglobulin insertions, deletions and substitutions |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| US20060247295A1 (en) | 2005-04-08 | 2006-11-02 | Medarex, Inc. | Cytotoxic compounds and conjugates with cleavable substrates |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
| WO2007051081A1 (en) | 2005-10-26 | 2007-05-03 | Medarex, Inc. | Methods and compounds for preparing cc-1065 analogs |
| WO2007059404A2 (en) | 2005-11-10 | 2007-05-24 | Medarex, Inc. | Duocarmycin derivatives as novel cytotoxic compounds and conjugates |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2009054863A2 (en) | 2006-12-13 | 2009-04-30 | Medarex, Inc. | Human antibodies that bind cd19 and uses thereof |
| WO2008083312A2 (en) | 2006-12-28 | 2008-07-10 | Medarex, Inc. | Chemical linkers and cleavable substrates and conjugates thereof |
| WO2008103693A2 (en) | 2007-02-21 | 2008-08-28 | Medarex, Inc. | Chemical linkers with single amino acids and conjugates thereof |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (ja) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用 |
| KR20080105674A (ko) | 2007-05-31 | 2008-12-04 | 울산대학교 산학협력단 | 항-마우스 gitrl 단일클론 항체 또는 항-인간aitrl 단일클론 항체 및 이를 유효성분으로 함유하는염증성 장질환의 예방 및 치료용 조성물 |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009015777A1 (de) | 2007-08-02 | 2009-02-05 | Knorr-Bremse Systeme für Nutzfahrzeuge GmbH | Induktiver weg- oder drehwinkelsensor mit zwischen zwei spulen angeordnetem abschirmblech |
| WO2009045957A1 (en) | 2007-10-01 | 2009-04-09 | Medarex, Inc. | Human antibodies that bind mesothelin, and uses thereof |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| WO2009073533A2 (en) | 2007-11-30 | 2009-06-11 | Medarex, Inc. | Anti-b7h4 monoclonal antibody-drug conjugate and methods of use |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009073546A2 (en) | 2007-11-30 | 2009-06-11 | Medarex, Inc. | Monoclonal antibody partner molecule conjugates directed to protein tyrosine kinase 7 (ptk7) |
| WO2009115652A2 (fr) | 2008-01-03 | 2009-09-24 | Universite De La Mediterannee, Aix-Marseille Ii | Composition et procedes utilisables lors d'un traitement anti-vih |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011072204A1 (en) | 2009-12-10 | 2011-06-16 | Regeneron Pharmaceuticals, Inc. | Mice that make heavy chain antibodies |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011097603A1 (en) | 2010-02-08 | 2011-08-11 | Regeneron Pharmaceuticals, Inc. | Common light chain mouse |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2011131407A1 (en) | 2010-03-05 | 2011-10-27 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011107553A1 (en) | 2010-03-05 | 2011-09-09 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| WO2011163311A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Mice expressing alight chain with human lambda variable and mouse constant regions |
| WO2011163314A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Hybrid light chain mice |
| US20120070861A1 (en) | 2010-06-22 | 2012-03-22 | Regeneron Pharmaceuticals, Inc. | Human Lambda Light Chain Mice |
| US20120073004A1 (en) | 2010-06-22 | 2012-03-22 | Regeneron Pharmaceuticals, Inc. | Hybrid Light Chain Mice |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2012148873A2 (en) | 2011-04-25 | 2012-11-01 | Regeneron Pharmaceuticals, Inc. | Non-human animals expressing antibodies having a common light chain |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| US20140065152A1 (en) | 2012-06-08 | 2014-03-06 | National Cancer Center | Novel epitope for switching to th1 cell and use thereof |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
Non-Patent Citations (157)
| Title |
|---|
| ALEXANDER A J; HUGHES D E, ANAL CHEM, vol. 67, 1995, pages 3626 - 32 |
| ALLEN ET AL., BIOCHEMISTRY, vol. 48, 2009, pages 3755 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLUNDELL; JOHNSON ET AL.: "Meth. Enzymol.", 1985, ACADEMIC PRESS, pages: 114,115 |
| BORDUSA, F., HIGHLIGHTS IN BIOORGANIC CHEMISTRY, 2004, pages 389 - 403 |
| BOSS, M. A.; WOOD, C. R, IMMUNOLOGY TODAY, vol. 6, 1985, pages 12 - 13 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83 |
| BRICOGNE, ACTA CRYST., vol. D49, 1993, pages 37 - 60 |
| BRICOGNE: "Meth. Enzymol.", vol. 276A, 1997, pages: 361 - 423 |
| BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134 |
| BRUMMELL ET AL., BIOCHEM., vol. 32, 1993, pages 1180 - 1187 |
| BURKS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 412 - 417 |
| CAMACHO ET AL., J. CLIN. ONCOLOGY, vol. 22, no. 145, 2004 |
| CHAYEN, STRUCTURE, vol. 5, 1997, pages 1269 - 1274 |
| CHEN ET AL., PHARM RES, vol. 20, 2003, pages 1952 - 60 |
| CHEN, J. ET AL., EMBO J., vol. 12, 1993, pages 821 - 830 |
| CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 |
| CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123 |
| COX, J. P. L. ET AL.: "A Directory of Human Germ-line V Segments Reveals a Strong Bias in their Usage", EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836, XP003004702, DOI: doi:10.1002/eji.1830240409 |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| DALL ACQUA ET AL., JOURNAL OF IMMUNOLOGY, vol. 169, 2002, pages 5171 - 5180 |
| DALL'ACQUA ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 281, 2006, pages 23514 - 23524 |
| DE GRAAF, A. J. ET AL., BIOCONJUG. CHEM., vol. 20, 2009, pages 1281 - 1295 |
| DRANOFF ET AL., PROC. NATL. ACAD. SCI U.S.A., vol. 90, 1993, pages 3539 - 43 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| ED HARLOW; DAVID LANE, COLD SPRING HARB PROTOC, 2006 |
| ED HARLOW; DAVID LANE: "Using Antibodies", 1999, COLD SPRING HARBOR LABORATORY PRESS |
| F. AUSUBEL, ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FOON, K.: "Cancer: Principles and Practice of Oncology", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 730 - 738 |
| FRESE, M. A.; DIERKS, T., CHEMBIOCHEM., vol. 10, 2009, pages 425 - 427 |
| FULDA ET AL., NAT MED, vol. 8, 2002, pages 808 - 15 |
| G. E. MORRIS: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| GALA; MORRISON, J. IMMUNOL, vol. 172, 2004, pages 5489 - 94 |
| GAUTIER, A. ET AL., CHEM. BIOL., vol. 15, 2008, pages 128 - 136 |
| GHIRLANDO ET AL., IMMUNOL LETT, vol. 68, 1999, pages 47 - 52 |
| GIEGE ET AL., ACTA CRYSTALLOGR, vol. D50, 1994, pages 339 - 350 |
| GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375 |
| GOEDDEL: "Gene Expression Technology. Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS |
| GREENBERG; RIDDELL, SCIENCE, vol. 285, 1999, pages 546 - 51 |
| HACKENBERGER, C. P. R.; SCHWARZER, D., ANGEW. CHEM. INT. ED. ENGL., vol. 47, 2008, pages 10030 - 10074 |
| HAHNE ET AL., SCIENCE, vol. 274, 1996, pages 1363 - 1365 |
| HARDING, F.; LONBERG, N., ANN. N.Y. ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HE ET AL., J. IMMUNOL., vol. 173, 2004, pages 4919 - 28 |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6216 |
| HINTON ET AL., JOURNAL OF IMMUNOLOGY, vol. 176, 2006, pages 346 - 356 |
| HOLLIGER, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOWARD; O'GARRA, IMMUNOLOGY TODAY, vol. 13, 1992, pages 198 - 200 |
| HURWITZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, no. 17, 1998, pages 10067 - 10071 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUTLOFF ET AL., NATURE, vol. 397, 1999, pages 262 - 266 |
| HYER ET AL., CANCER RESEARCH, vol. 65, 2005, pages 4799 - 808 |
| J.J. KILLION; I.J. FIDLER, IMMUNOMETHODS, vol. 4, 1994, pages 273 |
| J.R. ROBINSON: "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| JEFFERIS ET AL., MABS, vol. 1, 2009, pages 1 |
| JESPERS ET AL., BIOTECHNOLOGY, vol. 12, 1994, pages 899 |
| JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| K. KEINANEN; M.L. LAUKKANEN, FEBS LETT., vol. 346, 1994, pages 123 |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NIH PUBLICATION NO. 91-3242 |
| KABAT, E. A.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| KARPOVSKY ET AL., J. EXP. MED., vol. 160, 1984, pages 1686 |
| KEHRL ET AL., J. EXP. MED., vol. 163, 1986, pages 1037 - 1050 |
| KHAYAT, D.: "DEVELOPMENT OF CANCER VACCINES", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 414 - 428 |
| KIM ET AL., SCIENCE, vol. 266, 1994, pages 2011 - 2013 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 |
| KOBAYASHI ET AL., PROTEIN ENG., vol. 12, no. 10, 1999, pages 879 - 884 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KRISHNAMURTHY R; MANNING M C, CURR PHARM BIOTECHNOL, vol. 3, 2002, pages 361 - 71 |
| KUGLER ET AL., NATURE MEDICINE, vol. 6, 2000, pages 332 - 336 |
| KUROIWA ET AL., NATURE BIOTECHNOLOGY, vol. 20, 2002, pages 889 - 894 |
| LI ET AL., CELL CYCLE, vol. 11, 2012, pages 3343 - 3344 |
| LIU, MA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648 |
| LOGOTHETIS, C.: "DEVELOPMENT OF CANCER VACCINES", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 300 - 302 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, N.: "Handbook of Experimental Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LONBERG, N.; HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LONBERG, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1117 - 1125 |
| M. OWAIS ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 180 |
| MARSHALL ET AL., ANNU REV BIOCHEM, vol. 41, 1972, pages 673 - 702 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MCPHERSON, EUR. J. BIOCHEM., vol. 189, 1990, pages 1 - 23 |
| MCPHERSON, J. BIOL. CHEM., vol. 251, 1976, pages 6300 - 6303 |
| MELERO ET AL., NATURE MEDICINE, vol. 3, 1997, pages 682 - 685 |
| MIMURA ET AL., MOL IMMUNOL, vol. 37, 2000, pages 697 - 706 |
| MOKYR ET AL., CANCER RES., vol. 58, 1998, pages 5301 - 5304 |
| MOKYR ET AL., CANCER RESEARCH, vol. 58, 1998, pages 5301 - 5304 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOLEC. IMMUNOL., vol. 29, no. 5, 1992, pages 633 - 9 |
| MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MORRISON, S., SCIENCE, vol. 229, 1985, pages 1202 |
| MURRAY ET AL., J. CHROMATOGR SCI, vol. 40, 2002, pages 343 - 9 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., 1970, pages 444 - 453 |
| NESTLE ET AL., NATURE MEDICINE, vol. 4, 1998, pages 328 - 332 |
| NOCENTINI ET AL., PNAS, vol. 94, 1997, pages 6216 - 21 |
| OVERWIJK ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, 1999, pages 2982 - 2987 |
| P.G. BLOEMA ET AL., FEBS LETT., vol. 357, 1995, pages 140 |
| PAREKH ET AL., NATURE, vol. 316, 1985, pages 452 - 7 |
| PAULUS, BEHRING INS. MITT. NO., vol. 78, 1985, pages 118 - 132 |
| POLJAK, STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| QUEEN, C. ET AL., PROC. NATL. ACAD. SEE. U.S.A., vol. 86, 1989, pages 10029 - 10033 |
| R. J. KAUFMAN; P. A. SHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621 |
| REN, H. ET AL., ANGEW. CHEM. INT. ED. ENGL., vol. 48, 2009, pages 9658 - 9662 |
| RESTIFO, N.; SZNOL, M. ET AL.: "Cancer: Principles and Practice of Oncology, 5th ed.", 1997, article "Cancer Vaccines (Ch. 61)", pages: 3023 - 3043 |
| RIDGE ET AL., NATURE, vol. 393, 1998, pages 474 - 478 |
| RIECHMANN, L ET AL., NATURE, vol. 332, 1998, pages 323 - 327 |
| ROSENBERG, S A, IMMUNITY, vol. 10, 1999, pages 281 - 7 |
| ROSENBERG, S: "Development of Cancer Vaccines", 2000, ASCO EDUCATIONAL BOOK SPRING, pages: 60 - 62 |
| ROSENBERG; WHITE, J. IMMUNOTHER EMPHASIS TUMOR IMMUNOL, vol. 19, no. 1, 1996, pages 81 - 4 |
| ROUX ET AL., J IMMUNOL, vol. 161, 1998, pages 4083 |
| ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083 |
| ROVERSI ET AL., ACTA CRYST., vol. D56, 2000, pages 1313 - 1323 |
| SCHENK ET AL., NATURE, vol. 400, 1999, pages 173 - 177 |
| SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090 |
| SCOPES: "Protein Purification: Principles and Practice, 3rd ed.", 1994, SPRINGER-VERLAG |
| SENTER, P. D., CURR. OPIN. CHEM. BIOL., vol. 13, 2009, pages 235 - 244 |
| SHIELDS ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 276, no. 9, 2001, pages 6591 - 6604 |
| SHIELDS, R.L ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SHIMIZU ET AL., NATURE IMMUNOLOGY, vol. 3, 2002, pages 135 - 42 |
| SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SPIRO, GLYCOBIOLOGY, vol. 12, 2002, pages 43R - 56R |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| STEPHANS ET AL., JI, vol. 173, no. 8, 15 December 2003 (2003-12-15), pages 5008 - 20 |
| STROHL, CURRENT OPINION IN BIOTECHNOLOGY, vol. 20, 2009, pages 685 - 691 |
| SUNBUL, M.; YIN, J., ORG. BIOMOL. CHEM., vol. 7, 2009, pages 3361 - 3371 |
| SUOT; SRIVASTAVA, SCIENCE, vol. 269, 1995, pages 1585 - 1588 |
| SUVAS ET AL., J VIROL., vol. 79, 2005, pages 11935 - 42 |
| TAKEBE, Y. ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 466 - 472 |
| TAKI, M. ET AL., PROT. ENG. DES. SEL., vol. 17, 2004, pages 119 - 126 |
| TAMURA ET AL., SCIENCE, vol. 278, 1997, pages 117 - 120 |
| TAYLOR, E. VOGEL; IMPERIALI, B: "Nucleic Acids and Molecular Biology", PROTEIN ENGINEERING, vol. 22, 2009, pages 65 - 96 |
| TAYLOR, L ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591 |
| TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295 |
| TOMIZUKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 722 - 727 |
| TOMLINSON, I. M. ET AL.: "The Repertoire of Human Germline V Sequences Reveals about Fifty Groups of V Segments with Different Hypervariable Loops", J. MOL. BIOL., vol. 227, 1992, pages 776 - 798, XP024020607, DOI: doi:10.1016/0022-2836(92)90223-7 |
| TONE ET AL., PNAS, vol. 100, 2003, pages 15059 - 64 |
| TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
| TUAILLON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 3720 - 3724 |
| UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180 |
| UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN, vol. 153, 1988, pages 1038 |
| URLAUB; CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| V.V. RANADE, J. CLIN. PHARMACOL., vol. 29, 1989, pages 685 |
| VAN ELSAS ET AL., J. EXP. MED., vol. 194, 2001, pages 481 - 489 |
| WALLICK ET AL., J EXP MED, vol. 168, 1988, pages 1099 - 109 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WATTS, ANNUAL REVIEWS IN IMMUNOLOGY, vol. 23, 2005, pages 23 - 68 |
| WEINBERG ET AL., IMMUNOL, vol. 164, 2000, pages 2160 - 2169 |
| YEUNG ET AL., J IMMUNOL, vol. 182, 2010, pages 7663 - 7671 |
| ZINN-JUSTIN ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 11335 - 11347 |
| ZINN-JUSTIN ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 6884 - 6891 |
Cited By (84)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11352440B2 (en) | 2014-11-21 | 2022-06-07 | Bristol-Myers Squibb Company | Antibodies against CD73 and uses thereof |
| US11542332B2 (en) | 2016-03-26 | 2023-01-03 | Bioatla, Inc. | Anti-CTLA4 antibodies, antibody fragments, their immunoconjugates and uses thereof |
| EP3470424B1 (en) * | 2016-06-08 | 2025-04-23 | Shanghai Jiao Tong University School of Medicine | Sequence of antibody heavy chain constant region for enhancing agonist antibody activity |
| WO2017220989A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 and il-2 cytokines |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2017220988A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Multispecific antibodies for immuno-oncology |
| WO2018005950A1 (en) | 2016-07-01 | 2018-01-04 | Five Prime Therapeutics, Inc. | Combined anti tumor therapy with a gitr agonist and cpg |
| US11274285B2 (en) | 2016-10-14 | 2022-03-15 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the Hepatitis B virus genome |
| US10662416B2 (en) | 2016-10-14 | 2020-05-26 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome |
| WO2018213297A1 (en) | 2017-05-16 | 2018-11-22 | Bristol-Myers Squibb Company | Treatment of cancer with anti-gitr agonist antibodies |
| EP3630833A1 (en) * | 2017-05-25 | 2020-04-08 | Bristol-Myers Squibb Company | Antibodies comprising modified heavy constant regions |
| CN110719915A (zh) * | 2017-05-25 | 2020-01-21 | 百时美施贵宝公司 | 包含经修饰的重链恒定区的抗体 |
| US12049503B2 (en) | 2017-05-30 | 2024-07-30 | Bristol-Myers Squibb Company | Treatment of LAG-3 positive tumors |
| US11807686B2 (en) * | 2017-05-30 | 2023-11-07 | Bristol-Myers Squibb Company | Treatment of LAG-3 positive tumors |
| US11723975B2 (en) | 2017-05-30 | 2023-08-15 | Bristol-Myers Squibb Company | Compositions comprising an anti-LAG-3 antibody or an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody |
| WO2019001559A1 (zh) | 2017-06-30 | 2019-01-03 | 江苏恒瑞医药股份有限公司 | 抗gitr抗体、其抗原结合片段及其医药用途 |
| WO2019089921A1 (en) | 2017-11-01 | 2019-05-09 | Bristol-Myers Squibb Company | Immunostimulatory agonistic antibodies for use in treating cancer |
| US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| WO2019165374A1 (en) | 2018-02-26 | 2019-08-29 | Gilead Sciences, Inc. | Substituted pyrrolizine compounds as hbv replication inhibitors |
| WO2019183040A1 (en) | 2018-03-21 | 2019-09-26 | Five Prime Therapeutics, Inc. | ANTIBODIES BINDING TO VISTA AT ACIDIC pH |
| WO2019195126A1 (en) | 2018-04-02 | 2019-10-10 | Bristol-Myers Squibb Company | Anti-trem-1 antibodies and uses thereof |
| US11155618B2 (en) | 2018-04-02 | 2021-10-26 | Bristol-Myers Squibb Company | Anti-TREM-1 antibodies and uses thereof |
| WO2019195181A1 (en) | 2018-04-05 | 2019-10-10 | Gilead Sciences, Inc. | Antibodies and fragments thereof that bind hepatitis b virus protein x |
| WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
| WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
| WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
| US11292812B2 (en) | 2018-04-06 | 2022-04-05 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotides |
| US11149052B2 (en) | 2018-04-06 | 2021-10-19 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′-cyclic dinucleotides |
| US11788077B2 (en) | 2018-04-12 | 2023-10-17 | Precision Biosciences, Inc. | Polynucleotides encoding optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2019200247A1 (en) | 2018-04-12 | 2019-10-17 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| US11142750B2 (en) | 2018-04-12 | 2021-10-12 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
| WO2020014132A2 (en) | 2018-07-09 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to ilt4 |
| WO2020014327A2 (en) | 2018-07-11 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| WO2020028097A1 (en) | 2018-08-01 | 2020-02-06 | Gilead Sciences, Inc. | Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid |
| WO2020092528A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity |
| WO2020092621A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| EP4371987A1 (en) | 2018-10-31 | 2024-05-22 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| US12318403B2 (en) | 2019-03-07 | 2025-06-03 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′-cyclic dinucleotides and prodrugs thereof |
| US11766447B2 (en) | 2019-03-07 | 2023-09-26 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020214652A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| EP4458416A2 (en) | 2019-04-17 | 2024-11-06 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020214663A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020237025A1 (en) | 2019-05-23 | 2020-11-26 | Gilead Sciences, Inc. | Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors |
| WO2021011678A1 (en) | 2019-07-15 | 2021-01-21 | Bristol-Myers Squibb Company | Anti-trem-1 antibodies and uses thereof |
| WO2021011681A1 (en) | 2019-07-15 | 2021-01-21 | Bristol-Myers Squibb Company | Antibodies against human trem-1 and uses thereof |
| EP3999544A4 (en) * | 2019-07-19 | 2023-08-09 | Wuxi Xdc Singapore Private Limited | POLYPEPTIDE COMPLEX FOR CONJUGATION AND ITS USE |
| WO2021034804A1 (en) | 2019-08-19 | 2021-02-25 | Gilead Sciences, Inc. | Pharmaceutical formulations of tenofovir alafenamide |
| WO2021055698A1 (en) | 2019-09-19 | 2021-03-25 | Bristol-Myers Squibb Company | Antibodies binding to vista at acidic ph |
| WO2021067181A1 (en) | 2019-09-30 | 2021-04-08 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| EP4458975A2 (en) | 2019-09-30 | 2024-11-06 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| WO2021113765A1 (en) | 2019-12-06 | 2021-06-10 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| EP4567109A2 (en) | 2019-12-06 | 2025-06-11 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| US12410418B2 (en) | 2019-12-06 | 2025-09-09 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2021188959A1 (en) | 2020-03-20 | 2021-09-23 | Gilead Sciences, Inc. | Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same |
| WO2021239935A1 (en) | 2020-05-29 | 2021-12-02 | Universität Zu Köln | Neutralizing antibodies against sars-related coronavirus |
| CN115768479A (zh) * | 2020-06-22 | 2023-03-07 | 百时美施贵宝公司 | 治疗类风湿性关节炎 |
| WO2021262561A1 (en) * | 2020-06-22 | 2021-12-30 | Bristol-Myers Squibb Company | Treating rheumatoid arthritis |
| CN111732658A (zh) * | 2020-06-28 | 2020-10-02 | 东大生物技术(苏州)有限公司 | 一组gitr单克隆抗体及其医药用途 |
| EP4339209A4 (en) * | 2021-05-10 | 2025-05-28 | MediMabbio Inc. | ANTI-GITR ANTIBODIES AND THEIR USES |
| WO2022241134A1 (en) | 2021-05-13 | 2022-11-17 | Gilead Sciences, Inc. | COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS |
| WO2022261310A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-body drug conjugates |
| US11931424B2 (en) | 2021-06-11 | 2024-03-19 | Gilead Sciences, Inc. | Combination MCL-1 inhibitors with anti-body drug conjugates |
| US11957693B2 (en) | 2021-06-11 | 2024-04-16 | Gilead Sciences, Inc. | Combination MCL-1 inhibitors with anti-cancer agents |
| WO2022261301A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-cancer agents |
| WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| EP4190810A1 (en) | 2021-12-01 | 2023-06-07 | Universität zu Köln | Neutralizing antibodies against sars-related coronavirus |
| WO2023099688A1 (en) | 2021-12-01 | 2023-06-08 | Universität Zu Köln | Neutralizing antibodies against sars-related coronavirus |
| WO2024020579A1 (en) | 2022-07-22 | 2024-01-25 | Bristol-Myers Squibb Company | Antibodies binding to human pad4 and uses thereof |
| WO2025024265A1 (en) | 2023-07-21 | 2025-01-30 | Bristol-Myers Squibb Company | Methods of assessing citrullination and activity of pad4 modulators |
| WO2025085489A1 (en) | 2023-10-17 | 2025-04-24 | Bristol-Myers Squibb Company | Gspt1-degrading compounds, anti-cd33 antibodies and antibody-drug conjugates and uses thereof |
| WO2025145207A1 (en) | 2023-12-29 | 2025-07-03 | Bristol-Myers Squibb Company | Combination therapy of kras inhibitor and treg-depleting agent |
| WO2025174974A1 (en) | 2024-02-14 | 2025-08-21 | Bristol-Myers Squibb Company | Anti-cd33 antibodies and uses thereof |
| WO2025240242A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240243A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus |
| WO2025240246A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240244A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112018010172A2 (pt) | 2018-11-21 |
| IL259399A (en) | 2018-07-31 |
| JP6983776B2 (ja) | 2021-12-17 |
| SG11201803817PA (en) | 2018-06-28 |
| US11213586B2 (en) | 2022-01-04 |
| US20220175921A1 (en) | 2022-06-09 |
| EP3377532B1 (en) | 2022-07-27 |
| CA3005855A1 (en) | 2017-05-26 |
| KR20180082563A (ko) | 2018-07-18 |
| AU2016356780A1 (en) | 2018-06-28 |
| EA201891121A1 (ru) | 2018-12-28 |
| JP2019508013A (ja) | 2019-03-28 |
| US20180339042A1 (en) | 2018-11-29 |
| CN108738324A (zh) | 2018-11-02 |
| WO2017087678A3 (en) | 2017-08-03 |
| ES2926969T3 (es) | 2022-10-31 |
| CN108738324B (zh) | 2022-06-21 |
| EP3377532A2 (en) | 2018-09-26 |
| MX2018006072A (es) | 2018-08-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240158524A1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| US20220175921A1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| US20240336695A1 (en) | Antibodies to cd40 | |
| US10479838B2 (en) | Antibodies to CD40 with enhanced agonist activity | |
| US11306149B2 (en) | Anti-CD40 antibodies and uses thereof | |
| HK1235726B (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| HK1235726A1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16805668 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201803817P Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2018/006072 Country of ref document: MX Ref document number: 259399 Country of ref document: IL Ref document number: 15776591 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 3005855 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018526125 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018010172 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201891121 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20187016781 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020187016781 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016805668 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016356780 Country of ref document: AU Date of ref document: 20161117 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112018010172 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180518 |