WO2017083276A1 - Methods for treatment of bile acid-related disorders - Google Patents

Methods for treatment of bile acid-related disorders Download PDF

Info

Publication number
WO2017083276A1
WO2017083276A1 PCT/US2016/060944 US2016060944W WO2017083276A1 WO 2017083276 A1 WO2017083276 A1 WO 2017083276A1 US 2016060944 W US2016060944 W US 2016060944W WO 2017083276 A1 WO2017083276 A1 WO 2017083276A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
amino acid
acid sequence
set forth
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/060944
Other languages
English (en)
French (fr)
Inventor
Lei Ling
Jian Luo
Hui Tian
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
NGM Biopharmaceuticals Inc
Original Assignee
NGM Biopharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by NGM Biopharmaceuticals Inc filed Critical NGM Biopharmaceuticals Inc
Priority to AU2016353988A priority Critical patent/AU2016353988B2/en
Priority to ES16864846T priority patent/ES2871036T3/es
Priority to EP16864846.7A priority patent/EP3377090B1/en
Priority to JP2018522589A priority patent/JP6728352B2/ja
Priority to EP21162848.2A priority patent/EP3888672A1/en
Priority to CA3003616A priority patent/CA3003616C/en
Priority to US15/773,120 priority patent/US10744185B2/en
Publication of WO2017083276A1 publication Critical patent/WO2017083276A1/en
Anticipated expiration legal-status Critical
Priority to US16/917,284 priority patent/US20200390859A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1825Fibroblast growth factor [FGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/50Fibroblast growth factor [FGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/56Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A61K31/575Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of three or more carbon atoms, e.g. cholane, cholestane, ergosterol, sitosterol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner

Definitions

  • FGF19 fibroblast growth factor 19
  • FGF21 fibroblast growth factor 21
  • variants and fusions modulate bile acid homeostasis, and are useful in treatment of bile acid related and associated disorders.
  • these variants and fusions have glucose lowering activity, and are useful in treatment of hyperglycemia and other disorders.
  • the invention is based, in part, on variants of FGF19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities.
  • the activity is glucose lowering activity.
  • the activity is bile acid homeostasis modulating activity.
  • variants and fusions (chimeras) of FGF19 and/or FGF21 peptide sequences include sequences that do not substantially or significantly increase or induce hepatocellular carcinoma (HCC) formation or HCC tumorigenesis.
  • HCC hepatocellular carcinoma
  • Such variants and fusions (chimeras) of FGF19 and/or FGF21 peptide sequences further include sequences that do not induce a substantial elevation or increase in lipid profile.
  • a method of modulating bile acid homeostasis comprising administering a chimeric peptide sequence provided herein.
  • a method of treating a bile acid-related disorder comprising administering a chimeric peptide sequence provided herein.
  • a method of treating a bile acid-associated disorder comprising administering a chimeric peptide sequence provided herein.
  • an effective amount of the chimeric peptide sequence is administered.
  • a chimeric peptide sequence comprises or consists of: a) an N- terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO: 121) or DASPH (SEQ ID NO: 122); and b) a C-terminal region comprising a portion of SEQ ID NO: 99 (FGF19), the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises amino acid residues 16-29 of SEQ ID NO:99 (FGF19) (WGDPIRLRHLYTSG; SEQ ID NO: 169), wherein the W residue corresponds to the first amino acid position of the C-terminal region.
  • the treatment peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO: 121) or DASPH (SEQ ID NO: 122); and b) a C-terminal region comprising a portion of SEQ ID NO: 99 [FGF19], the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises (i) a first C-terminal region sequence comprising WGDPIRLRHLYTSG (amino acids 16 to 29 of SEQ ID NO:99 [FGF19]), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and (ii) a second C-terminal region sequence comprising
  • the peptide (i) binds to fibroblast growth factor receptor 4 (FGFR4) with an affinity equal to or greater than FGF19 binding affinity for FGFR4; (ii) activates FGFR4 to an extent or amount equal to or greater than FGF19 activates FGFR4; (iii) has at least one of reduced hepatocellular carcinoma (HCC) formation; greater glucose lowering activity, less lipid increasing activity, less triglyceride activity, less cholesterol activity, less non-HDL activity or less HDL increasing activity, as compared to FGF19, or as compared to an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV(SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177),
  • HCC
  • the second C-terminal region sequence of the treatment peptide comprises from 1 to 5 amino acid substitutions, deletions or insertions. In some embodiments, the treatment peptide is less than about 250 amino acids in length. [0007] In one embodiment, the treatment peptide has an amino acid sequence comprising or consisting of
  • the treatment peptide has an amino acid sequence comprising SEQ ID NO:70. In other embodiments, the treatment peptide has an amino acid sequence consisting of SEQ ID NO:70. In some embodiments, the treatment peptide is fused with an immunoglobulin Fc region.
  • the treatment peptide has an amino acid sequence comprising or consisting of
  • the treatment peptide has an amino acid sequence comprising SEQ ID NO:69. In other embodiments, the treatment peptide has an amino acid sequence consisting of SEQ ID NO:69. In some embodiments, the treatment peptide is fused with an immunoglobulin Fc region.
  • a chimeric peptide sequence comprises or consists of: a) an N- terminal region comprising a portion of SEQ ID NO: 100 (FGF21), the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises amino acid residues GQV, and wherein the V residue corresponds to the last amino acid position of the N-terminal region; and b) a C-terminal region comprising a portion of SEQ ID NO: 99 (FGF19), the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises amino acid residues 21-29 of SEQ ID NO:99 (FGF19), RLRHLYTSG (SEQ ID NO: 185), and wherein the R residue corresponds to the first position of the C-terminal region.
  • a chimeric peptide sequence comprises or consists of any of: a) an N-terminal region comprising a portion of SEQ ID NO: 100 (FGF21), the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises at least 5 contiguous amino acids of SEQ ID NO: 100 (FGF21) including the amino acid residues GQV, and wherein the V residue corresponds to the last amino acid position of the N- terminal region; and b) a C-terminal region comprising a portion of SEQ ID NO: 99 (FGF19), the C- terminal region having a first amino acid position and a last amino acid position, wherein the C- terminal region comprises amino acid residues 21-29 of SEQ ID NO:99 (FGF19), RLRHLYTSG (SEQ ID NO: 185), and wherein the R residue corresponds to the first position of the C-terminal region.
  • a peptide sequence comprises or consists of any of: a) a FGF19 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19; b) a FGF21 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF21; c) a portion of an FGF19 sequence fused to a portion of an FGF21 sequence; or d) a portion of an FGF19 sequence fused to a portion of an FGF21 sequence, wherein the FGF19 and/or FGF21 sequence portion(s) have one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19 and/or FGF21.
  • the N-terminal region comprises at least 6 contiguous amino acids (or more, e.g., 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-40, 40-50, 50-75, 75-100 contiguous amino acids) of SEQ ID NO: 100 (FGF21), including the amino acid residues GQ; or has an N-terminal region with at least 7 contiguous amino acids (or more, e.g., 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-40, 40-50, 50-75, 75-100 contiguous amino acids) of SEQ ID NO: 100 (FGF21), including the amino acid residues GQV.
  • the peptide comprises i) a FGF19 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19; ii) a FGF21 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF21; iii) a portion of a FGF19 sequence fused to a portion of a FGF21 sequence; or iv) a portion of a FGF19 sequence fused to a portion of a FGF21 sequence, wherein the FGF19 and/or FGF21 sequence portion(s) have one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF19and/or FGF21.
  • a peptide sequence or a chimeric peptide sequence comprises or consists of amino-terminal amino acids 1-16 of SEQ ID NO: 100 (FGF21) fused to carboxy-terminal amino acids 21-194 of SEQ ID NO:99 (FGF19), or the peptide sequence has amino-terminal amino acids 1-147 of SEQ ID NO: 99 (FGF19) fused to carboxy-terminal amino acids 147-181 of SEQ ID NO: 100 (FGF21) (M41), or the peptide sequence has amino-terminal amino acids 1-20 of SEQ ID NO: 99 (FGF19) fused to carboxy-terminal amino acids 17-181 of SEQ ID NO: 100 (FGF21) (M44), or the peptide sequence has amino-terminal amino acids 1-146 of SEQ ID NO: 100 (FGF21) fused to carboxy-terminal amino acids 148-194 of SEQ ID NO:99 (FGF19) (M45), or the peptide sequence has amino-
  • a peptide sequence has at least one amino acid substitution to amino acid residues 125-129 of SEQ ID NO:99 (FGF19), EIRPD; at least one amino acid substitution to amino acid residues 126-128 of SEQ ID NO:99 (FGF19), IRP; or at least one amino acid substitution to amino acid residues 127-128 of SEQ ID NO:99 (FGF19), RP, or at least one amino acid substitution to amino acid residues 1-124 of SEQ ID NO:99 (FGF19) and/or to amino acid residues 130-194 of SEQ ID NO:99 (FGF19).
  • Said substitutions within a corresponding FGF19 sequence (e.g., EIRPD, IRP or RP) of a peptide variant provided herein is also contemplated.
  • the peptide comprises both a R127L and P128E substitution to amino acid residues 127-128 of SEQ ID NO:99 (FGF19), RP, or the corresponding FGF19 sequence thereof in a variant peptide provided herein.
  • the amino acid sequence of the peptide comprises at least one amino acid substitution in the Loop-8 region of FGF19, or the corresponding FGF19 sequence thereof in a variant peptide provided herein.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises three amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid sequence of the peptide comprises four amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises five amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In other embodiments, the amino acid sequence of the peptide comprises three amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain
  • the amino acid sequence of the peptide comprises one amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution.
  • the substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is a Pro (P) to Glu (E) substitution.
  • the substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution and a Pro (P) to Glu (E) substitution.
  • the foregoing substitution(s) in the Loop-8 region of FGF19 is in the corresponding FGF19 sequence thereof in a variant peptide provided herein. That is, said
  • substitutions within a corresponding FGF19 sequence e.g., EIRPD, IRP or RP is also contemplated.
  • Methods and uses provided herein can be practiced using a peptide or chimeric sequence, as set forth herein.
  • the peptide is a variant peptide designated M139. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 193. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 193. In some embodiments, the peptide is a variant peptide designated Ml 40. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 194. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 194. In some embodiments, the peptide is a variant peptide designated M141. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 195.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 195. In some embodiments, the peptide is a variant peptide designated Ml 60. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 196. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 196. In some embodiments, the peptide is a variant peptide designated M200. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 197. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 197. In some embodiments, the peptide is a variant peptide designated M201.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide is a variant peptide designated M202. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 199. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 199. In certain embodiments, the peptide is a variant peptide designated M203. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 200.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 200. In some embodiments, the peptide is a variant peptide designated M204. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:201. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 201. In another embodiment, the peptide is a variant peptide designated M205. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide is a variant peptide designated M206.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO:203. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 203. In yet other embodiments, the peptide is a variant peptide designated M207. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 204. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:204.
  • the N-terminal R residue is deleted.
  • the peptide comprises at least one (e.g., from 1 to 20, from 1 to 15, from 1 to 10 or from 1 to 5) amino acid substitution(s).
  • the peptide comprises at least one (e.g., from 1 to 20, from 1 to 15, from 1 to 10 or from 1 to 5) amino acid deletion(s).
  • the peptide comprises at least one (e.g., from 1 to 20, from 1 to 15, from 1 to 10 or from 1 to 5) amino acid insertion(s).
  • a peptide or chimeric sequence of any suitable length can be practiced using a peptide or chimeric sequence of any suitable length.
  • the N-terminal or C-terminal region of the peptide or chimeric sequence is from about 20 to about 200 amino acid residues in length.
  • a peptide or chimeric sequence has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • a peptide or chimeric sequence has an N-terminal region, or a C- terminal region that comprises or consists of an amino acid sequence of about 5 to 10, 10 to 20, 20 to 30, 30 to 40, 40 to 50, 60 to 70, 70 to 80, 80 to 90, 90 to 100 or more amino acids.
  • a peptide or chimeric sequence has an FGF19 sequence portion, or an FGF21 sequence portion that comprises or consists of an amino acid sequence of about 5 to 10, 10 to
  • a peptide sequence or a chimeric peptide sequence has a WGDPI (SEQ ID NO: 170) sequence motif corresponding to the WGDPI sequence of amino acids 16-20 of SEQ ID NO:99 (FGF 19); has a substituted, mutated or absent WGDPI (SEQ ID NO: 170) sequence motif corresponding to FGF19 WGDPI (SEQ ID NO: 170) sequence of amino acids 16-20 of FGF19; has a WGDPI (SEQ ID NO: 170) sequence with one or more amino acids substituted, mutated or absent.
  • the peptide sequence is distinct from an FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the FGF 19 WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20.
  • a peptide sequence or a chimeric peptide sequence has N- terminal region comprises amino acid residues VHYG (SEQ ID NO: 101), wherein the N-terminal region comprises amino acid residues DASPHVHYG (SEQ ID NO: 102), or the N-terminal region comprises amino acid residues DSSPLVHYG (SEQ ID NO: 103). More particularly, in one aspect the G corresponds to the last position of the N-terminal region.
  • the N-terminal region comprises amino acid residues DSSPLLQ (SEQ ID NO: 104), where the Q residue is the last amino acid position of the N-terminal region, or comprises amino acid residues DSSPLLQFGGQV (SEQ ID NO: 105), where the V residue corresponds to the last position of the N-terminal region.
  • an N-terminal region comprises or consists of (or further comprises or consists of): RHPIP (SEQ ID NO: 106), where R is the first amino acid position of the N-terminal region; or HPIP (SEQ ID NO: 107), where H is the first amino acid position of the N- terminal region; or RPLAF (SEQ ID NO: 108), where R is the first amino acid position of the N- terminal region; or PLAF (SEQ ID NO: 109), where P is the first amino acid position of the N- terminal region; or R, where R is the first amino acid position of the N-terminal region.
  • RHPIP SEQ ID NO: 106
  • HPIP SEQ ID NO: 107
  • H the first amino acid position of the N- terminal region
  • RPLAF SEQ ID NO: 108
  • PLAF SEQ ID NO: 109
  • a peptide or chimeric sequence has: amino acid residues HPIP (SEQ ID NO: 107), which are the first 4 amino acid residues of the N-terminal region.
  • a peptide or chimeric sequence has: an R residue at the first position of the N- terminal region, or the first position of the N-terminal region is an M residue, or the first and second positions of the N-terminal region is an MR sequence, or the first and second positions of the N- terminal region is an RM sequence, or the first and second positions of the N-terminal region is an RD sequence, or the first and second positions of the N-terminal region is an DS sequence, or the first and second positions of the N-terminal region is an MD sequence, or the first and second positions of the N-terminal region is an MS sequence, or the first through third positions of the N- terminal region is an MDS sequence, or the first through third positions of the N-terminal region is an RDS sequence, or the first through third positions
  • a peptide or chimeric sequence has at the N-terminal region first amino acid position an "M” residue, an "R” residue, a “S” residue, a “H” residue, a “P” residue, a “L” residue or an “D” residue.
  • a peptide or chimeric sequence peptide sequence does not have a "M” residue or an "R” residue at the first amino acid position of the N-terminal region.
  • a peptide or chimeric sequence has an N-terminal region with any one of the following sequences: MDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 120), MSDSSPL (SEQ ID NO: 120), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: 110), MSDSSPL (SEQ ID NO: ).
  • SDSSPL SEQ ID NO: 112
  • MSSPL SEQ ID NO: 113
  • SSPL SEQ ID NO: 114
  • a peptide sequence or a chimeric peptide sequence has a residue at the last position of the C-terminal region that corresponds to about residue 194 of SEQ ID NO: 99 (FGF19).
  • a peptide sequence or a chimeric peptide sequence an addition of amino acid residues 30-194 of SEQ ID NO: 99 (FGF19) at the C-terminus, resulting in a chimeric polypeptide having a residue at the last position of the C-terminal region that corresponds to about residue 194 of SEQ ID NO: 99 (FGF19).
  • a chimeric peptide sequence or peptide sequence comprises all or a portion of an FGF19 sequence (e.g., SEQ ID NO: 99), positioned at the C-terminus of the peptide, or where the amino terminal "R" residue is deleted from the peptide.
  • FGF19 sequence e.g., SEQ ID NO: 99
  • a chimeric peptide sequence or peptide sequence comprises or consists of any of Ml to M98, Ml 01 to Ml 60, or M200 to M207 variant peptide sequences, or a subsequence or fragment of any of the Ml to M98, Ml 01 to Ml 60, or M200 to M207 variant peptide sequences.
  • Methods and uses provided herein can also be practiced using a peptide or chimeric sequence, as set forth herein.
  • a peptide sequence comprises or consists of any one of the following sequences:
  • the R terminal residue (R residue at the N-terminus) is deleted.
  • the peptide comprises or consists of:
  • RD S SPL VHYGWGDPIRLRHLYTS GPHGL S S CFLRIRADGVVDC ARGQ S AHSLLEIKAV ALRT VAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQ RQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSP SFEK (M200) (SEQ ID NO: 197); or a subsequence or fragment thereof.
  • the N- terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the peptide comprises or consists of:
  • AVRSPSFEK (M202) (SEQ ID NO: 199); or a subsequence or fragment thereof.
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • LYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFE K (M203) (SEQ ID NO:200); or a subsequence or fragment thereof.
  • the N- terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • N- terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the peptide is a variant peptide designated Ml 39. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 193. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 193. In some embodiments, the peptide is a variant peptide designated Ml 40. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 194. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 194. In some embodiments, the peptide is a variant peptide designated M141. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 195.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 195. In some embodiments, the peptide is a variant peptide designated Ml 60. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 196. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 196. In some embodiments, the peptide is a variant peptide designated M200. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 197. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 197. In some embodiments, the peptide is a variant peptide designated M201.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide is a variant peptide designated M202. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 199. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 199. In certain embodiments, the peptide is a variant peptide designated M203. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 200.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 200. In some embodiments, the peptide is a variant peptide designated M204. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:201. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 201. In another embodiment, the peptide is a variant peptide designated M205. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide is a variant peptide designated M206.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO:203. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 203. In yet other embodiments, the peptide is a variant peptide designated M207. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 204. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:204.
  • the N-terminus of the peptide sequence includes or consists of any of:
  • HPIPDS SPLLQFGGQVRLRHLYTSG (M5-R) (amino acids 1-25 of SEQ ID NO: 160);
  • RPL AFSD S SPLLQFGGQVRLRHLYT SG (amino acids 1-27 of SEQ ID NO: 7);
  • HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (amino acids 2-26 of SEQ ID NO: 8);
  • HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (amino acids 2-28 of SEQ ID NO:9); HPIPD S SPHVHYGWGDPIRLRHLYT SG (M10-R) (amino acids 2-28 of SEQ ID NO: 10); RPLAFSDAGPLLQWGDPIRLRHLYTSG (Ml 1) (amino acids 1-27 of SEQ ID NO: 11); RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12); RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1-27 of SEQ ID NO: 13); HPIPDSSPHVHYGGQVRLRHLYTSG (M14-R) (amino acids 2-26 of SEQ ID NO: 14); RPLAFSDAGPHVHYGGQVRLRHLYTSG (Ml 5) (amino acids 1-27 of SEQ ID NO: 15
  • RHPIPDSSPLLQFGDQVRLRHLYTSG (M32) (amino acids 1-26 of SEQ ID NO:32);
  • RHPIPDS SPLLQFGPQVRLRHLYTSG (M33) (amino acids 1-26 of SEQ ID NO:33);
  • RHPIPDSSPLLQFGGAVRLRHLYTSG (amino acids 1-26 of SEQ ID NO:34);
  • RHPIPDSSPLLQFGGEVRLRHLYTSG (M35) (amino acids 1-26 of SEQ ID NO:35);
  • RHPIPDSSPLLQFGGNVRLRHLYTSG (amino acids 1-26 of SEQ ID NO:36);
  • RHPIPDSSPLLQFGGQARLRHLYTSG (M37) (amino acids 1-26 of SEQ ID NO:37);
  • RHPIPDS SPLLQFGGQIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 38);
  • RHPIPDS SPLLQFGGQTRLRHLYTSG (M39) (amino acids 1-26 of SEQ ID NO:39);
  • RHPIPDSSPLLQFGWGQPVRLRHLYTSG (M40) (amino acids 1-28 of SEQ ID NO:40); DAGPHVHYGWGDPIRLRHLYTSG (M74-R) (amino acids 2-24 of SEQ ID NO:74);
  • VHYGWGDPIRLRHLYTSG (M75-R) (amino acids 2-19 of SEQ ID NO:75); RLRHLYTSG (M77-R) (amino acids 2-10 of SEQ ID NO:77);
  • RHPIPDSSPLLQFGWGDPIRLRHLYTSG (M9) (amino acids 1-28 of SEQ ID NO:9);
  • RHPIPDSSPLLQWGDPIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 8);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12);
  • RHPIPDSSPHVHYGWGDPIRLRHLYTSG (amino acids 1-28 of SEQ ID NO: 10);
  • RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1-27 of SEQ ID NO: 13);
  • RHPIPDSSPHVHYGGQVRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 14);
  • RPLAFSDAGPHVHYGGDIRLRHLYTSG (M43) amino acids 1-27 of SEQ ID NO:43); or RDSSPLLQFGGQVRLRHLYTSG (M6) (amino acids 1-22 of SEQ ID NO:6).
  • the peptide comprises or consists of any of:
  • HPIPDS SPLLQFGGQVRLRHLYTSG (M5-R) (amino acids 1 -25 of SEQ ID NO: 160);
  • D S SPLLQFGGQ VRLRHL YT SG (M6-R) (amino acids 2-22 of SEQ ID NO: 6);
  • RPLAFSDSSPLLQFGGQVRLRHLYTSG (amino acids 1-27 of SEQ ID NO: 7);
  • HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (amino acids 2-26 of SEQ ID NO: 8);
  • HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (amino acids 2-28 of SEQ ID NO:9);
  • HPIPDSSPHVHYGWGDPIRLRHLYTSG (M10-R) (amino acids 2-28 of SEQ ID NO: 10);
  • RPLAFSDAGPLLQWGDPIRLRHLYTSG (Ml 1) (amino acids 1-27 of SEQ ID NO: 11);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12);
  • RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1-27 of SEQ ID NO: 13);
  • HPIPDSSPHVHYGGQ VRLRHL YTSG (M14-R) (amino acids 2-26 of SEQ ID NO: 14);
  • RPLAFSDAGPHVHYGGQ VRLRHL YTSG (Ml 5) (amino acids 1-27 of SEQ ID NO: 15);
  • RPLAFSDAGPHVHWGDPIRLRHLYTSG (Ml 6) (amino acids 1-27 of SEQ ID NO: 16);
  • RPLAFSDAGPHVGWGDPIRLRHLYTSG (Ml 7) (amino acids 1-27 of SEQ ID NO: 17);
  • RPLAFSDAGPHYGWGDPIRLRHLYTSG (Ml 8) (amino acids 1-27 of SEQ ID NO: 18);
  • RPLAFSDAGPVYGWGDPIRLRHLYTSG (Ml 9) (amino acids 1-27 of SEQ ID NO: 19);
  • RPLAFSDAGPVHGWGDPIRLRHLYTSG (M20) (amino acids 1-27 of SEQ ID NO:20);
  • RPLAFSDAGPVHYWGDPIRLRHLYTSG (M21) (amino acids 1-27 of SEQ ID NO:21);
  • RPLAFSDAGPHVHGWGDPIRLRHLYTSG (M22) (amino acids 1-27 of SEQ ID NO: 22);
  • RPLAFSDAGPHHGWGDPIRLRHLYTSG (M23) (amino acids 1-27 of SEQ ID NO:23);
  • RPLAFSDAGPHHYWGDPIRLRHLYTSG (M24) (amino acids 1-27 of SEQ ID NO:24);
  • RPLAFSDAGPHVYWGDPIRLRHLYTSG (M25) (amino acids 1-27 of SEQ ID NO:25);
  • RPLAFSDSSPHVHWGDPIRLRHLYTSG (M27) (amino acids 1-27 of SEQ ID NO:27);
  • RPLAFSDAGPHVWGDPIRLRHLYTSG (M28) (amino acids 1 -26 of SEQ ID NO:28);
  • RPLAFSDAGPHVHYWGDPIRLRHLYTSG (M29) (amino acids 1 -28 of SEQ ID NO:29);
  • RPLAFSDAGPHVHYAWGDPIRLRHLYTSG (M30) (amino acids 1-29 of SEQ ID NO: 30);
  • RHPIPDSSPLLQFGAQVRLRHLYTSG (M31) (amino acids 1-26 of SEQ ID NO:31);
  • RHPIPDSSPLLQFGDQVRLRHLYTSG (M32) (amino acids 1-26 of SEQ ID NO:32);
  • RHPIPDSSPLLQFGPQVRLRHLYTSG (M33) (amino acids 1-26 of SEQ ID NO:33);
  • RHPIPDSSPLLQFGGAVRLRHLYTSG (M34) (amino acids 1 -26 of SEQ ID NO:34);
  • RHPIPDSSPLLQFGGEVRLRHLYTSG (M35) (amino acids 1 -26 of SEQ ID NO:35);
  • RHPIPDSSPLLQFGGNVRLRHLYTSG (amino acids 1-26 of SEQ ID NO:36);
  • RHPIPDSSPLLQFGGQARLRHLYTSG (M37) (amino acids 1-26 of SEQ ID NO:37);
  • RHPIPDSSPLLQFGGQIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 38);
  • RHPIPDSSPLLQFGGQTRLRHLYTSG (M39) (amino acids 1-26 of SEQ ID NO:39);
  • RHPIPDSSPLLQFGWGQPVRLRHLYTSG (amino acids 1-28 of SEQ ID NO:40);
  • DAGPHVHYGWGDPIRLRHLYTSG (M74-R) (amino acids 2-24 of SEQ ID NO:74);
  • VHYGWGDPIRLRHLYTSG (M75-R) (amino acids 2-19 of SEQ ID NO:75);
  • RLRHLYTSG (M77-R) (amino acids 2-10 of SEQ ID NO:77);
  • RHPIPDSSPLLQFGWGDPIRLRHLYTSG (M9) (amino acids 1-28 of SEQ ID NO:9);
  • RHPIPDSSPLLQWGDPIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 8);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12);
  • RHPIPDSSPHVHYGWGDPIRLRHLYTSG (amino acids 1-28 of SEQ ID NO: 10);
  • RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1 -27 of SEQ ID NO: 13);
  • RHPIPDS SPFFVHYGGQVRLRHLYTSG (M14) (amino acids 1 -26 of SEQ ID NO: 14);
  • the peptide comprises a C-terminal region comprising a portion of SEQ ID NO:99 (FGF19), the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises amino acid residues 16-29 of SEQ ID NO:99 (FGF19), WGDPIRLRHLYTSG (SEQ ID NO: 169), wherein the W residue corresponds to the first amino acid position of the C-terminal region.
  • a peptide sequence includes or consists of:
  • the R terminal residue is deleted.
  • a peptide sequence includes the addition of amino acid residues 30-194 of SEQ ID NO: 99 (FGF19) at the C-terminus, resulting in a chimeric polypeptide.
  • a peptide sequence has at least one amino acid substitution to amino acid residues 125- 129 of SEQ ID NO: 99 (FGF19), EIRPD.
  • the peptide sequence has at least one amino acid substitution to amino acid residues 126-128 of SEQ ID NO:99 (FGF19), IRP.
  • the peptide sequence has at least one amino acid substitution to amino acid residues 127-128 of SEQ ID NO:99 (FGF19), RP.
  • the peptide sequence has at least one amino acid substitution to amino acid residues 1-124 of SEQ ID NO: 99 (FGF19) and/or to amino acid residues 130-194 of SEQ ID NO:99 (FGF19).
  • a peptide sequence comprises substitution to one of amino acid residues 127-128 of SEQ ID NO: 99 (FGF19), RP, wherein at least one amino acid substitution is R127L or P128E. Said substitutions within a corresponding FGF19 sequence (e.g., EIRPD, IRP or RP) of a peptide variant provided herein is also contemplated.
  • the peptide comprises both a R127L and P128E substitution to amino acid residues 127-128 of SEQ ID NO:99 (FGF19), RP, or the corresponding FGF19 sequence thereof in a variant peptide provided herein.
  • the amino acid sequence of the peptide comprises at least one amino acid substitution in the Loop-8 region of FGF19, or the corresponding FGF19 sequence thereof in a variant peptide provided herein.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In other embodiments, the amino acid sequence of the peptide comprises three amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid sequence of the peptide comprises four amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises five amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises three amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution.
  • the substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is a Pro (P) to Glu (E) substitution.
  • the substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution and a Pro (P) to Glu (E) substitution.
  • the foregoing substitution(s) in the Loop-8 region of FGF19 is in the corresponding FGF19 sequence thereof in a variant peptide provided herein. That is, said
  • substitutions within a corresponding FGF19 sequence e.g., EIRPD, IRP or RP is also contemplated.
  • a peptide or chimeric sequence of any suitable length can be practiced using a peptide or chimeric sequence of any suitable length.
  • the N-terminal or C-terminal region of the peptide or chimeric sequence is from about 20 to about 200 amino acid residues in length.
  • a chimeric peptide sequence or peptide sequence has at least one amino acid deletion.
  • a peptide or chimeric sequence has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid deletions from the amino terminus, the carboxy -terminus or internally.
  • amino acid substitution, or deletion is at any of amino acid positions 8-20 of FGF19 (AGPHVHYGWGDPI) (SEQ ID NO: 187).
  • a peptide or chimeric sequence has an N-terminal region, or a C-terminal region that comprises or consists of an amino acid sequence of about 5 to 10, 10 to 20, 20 to 30, 30 to 40, 40 to 50, 60 to 70, 70 to 80, 80 to 90, 90 to 100 or more amino acids.
  • a peptide or chimeric sequence has an FGF19 sequence portion, or an FGF21 sequence portion that comprises or consists of an amino acid sequence of about 5 to 10, 10 to 20, 20 to 30, 30 to 40, 40 to 50, 50 to 60, 60 to 70, 70 to 80, 80 to 90, 90 to 100 or more amino acids of FGF 19 or FGF21.
  • a peptide or chimeric sequence has an amino acid substitution, an addition, insertion or is a subsequence that has at least one amino acid deleted.
  • Such amino acid substitutions, additions, insertions and deletions of a peptide sequence can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid residues (10-20, 20-30, 30-40, 40-50, etc.), for example, at the N- or C-terminus, or internal.
  • the amino acid substitution, or deletion is at any of amino acid positions 8-20 of FGF 19 (AGPHVHYGWGDPI) (SEQ ID NO: 187).
  • a peptide or chimeric sequence includes all or a portion of an FGF 19 sequence set forth as:
  • a peptide or chimeric sequence has a function or activity greater or less than a comparison sequence.
  • chimeric peptide sequences and peptide sequences have particular functions or activities.
  • a chimeric peptide sequence or peptide sequence maintains or increases a fibroblast growth factor receptor 4 (FGFR4) mediated activity.
  • FGFR4 fibroblast growth factor receptor 4
  • a chimeric peptide sequence or peptide sequence binds to FGFR4 or activates FGFR4, or does not detectably bind to FGFR4 or activate FGFR4, or binds to FGFR4 with an affinity less than, comparable to or greater than FGF19 binding affinity for FGFR4, or activates FGFR4 to an extent or amount less than, comparable to or greater than FGF19 activates FGFR4.
  • a chimeric peptide sequence or peptide sequence provided herein activates FGFR4 to an extent or amount less than the extent or amount that FGF19 activates FGFR4. In some embodiments, a chimeric peptide sequence or peptide sequence provided herein activates FGFR4 to an extent or amount comparable to the extent or amount that FGF19 activates FGFR4. In some embodiments, a chimeric peptide sequence or peptide sequence provided herein activates FGFR4 to an extent or amount greater than the extent or amount that FGF19 activates FGFR4.
  • a chimeric peptide sequence or peptide sequence provided herein maintains an FGFR4 mediated activity. In one embodiment, a chimeric peptide sequence or peptide sequence provided herein increases an FGFR4 mediated activity. In some embodiments, a chimeric peptide sequence or peptide sequence provided herein binds to FGFR4 with an affinity less than FGF19 binding affinity for FGFR4. In some embodiments, a chimeric peptide sequence or peptide sequence provided herein binds to FGFR4 with an affinity comparable to FGF19 binding affinity for FGFR4.
  • a chimeric peptide sequence or peptide sequence provided herein binds to FGFR4 with an affinity greater than FGF19 binding affinity for FGFR4. In some embodiments, a chimeric peptide sequence or peptide sequence provided herein does not detectably bind to FGFR4.
  • a chimeric peptide sequence or peptide sequence has reduced HCC formation compared to FGF19, or an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20 of FGF19; or has greater glucose lowering
  • a peptide or chimeric sequence has a function or activity greater or less than a comparison sequence.
  • the comparison sequence is FGF19.
  • the comparison sequence is FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170
  • a peptide or chimeric peptide sequence provided herein has greater glucose lowering activity compared to a comparison sequence. In another embodiment, a peptide or chimeric peptide sequence provided herein has less lipid increasing activity compared to a comparison sequence. In other embodiment, a peptide or chimeric peptide sequence provided herein has lower or reduced lipid ⁇ e.g., triglyceride, cholesterol, non-HDL) activity compared to a comparison sequence. In other embodiments, a peptide or chimeric peptide sequence provided herein has more HDL increasing activity as compared to a comparison sequence. In other embodiment, a peptide or chimeric peptide sequence provided herein has less lean mass reducing activity compared to a comparison sequence or FGF21.
  • a peptide or chimeric sequence includes one or more L-amino acids, D-amino acids, non-naturally occurring amino acids, or amino acid mimetic, derivative or analogue.
  • a peptide or chimeric sequence has an N-terminal region, or a C-terminal region, or a FGF19 sequence portion, or an FGF21 sequence portion, joined by a linker or spacer.
  • chimeric peptide sequences and peptide sequences isolated or purified, and/or chimeric peptide sequences and peptide sequences can be included in compositions.
  • a chimeric peptide sequence or peptide sequence is included in a pharmaceutical composition.
  • Such compositions include combinations of inactive or other active ingredients.
  • a compositions, such as a pharmaceutical composition includes chimeric peptide sequence or peptide sequence and a glucose lowering agent.
  • a chimeric peptide or peptide sequence is included in a pharmaceutical composition, which in turn can be used for practicing the methods and uses provided herein.
  • Such compositions include combinations of inactive or other active ingredients.
  • a composition, such as a pharmaceutical composition includes chimeric peptide sequence or peptide sequence and a glucose lowering agent.
  • a composition, such as a pharmaceutical composition includes chimeric peptide sequence or peptide sequence and an agent that improves bile acid homeostasis.
  • nucleic acid molecules encoding the chimeric peptide sequence or peptide sequence are provided. Such molecules can further include an expression control element in operable linkage that confers expression of the nucleic acid molecule encoding the peptide in vitro, in a cell or in vivo, or a vector comprising the nucleic acid molecule ⁇ e.g., a viral vector). Transformed and host cells that express the chimeric peptide sequences and peptide sequences are also provided.
  • a use or method of treatment of a subject includes administering a chimeric peptide or peptide sequence provided herein to a subject, such as a subject having, or at risk of having, a disease or disorder treatable by a peptide sequence provided herein, in an amount effective for treating the disease or disorder.
  • provided herein is a method of preventing a disease or disorder in a subject having, or at risk of having, a disease or disorder preventable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for preventing the disease or disorder.
  • a method of treating a disease or disorder in a subject having, or at risk of having, a disease or disorder treatable by a peptide sequence provided herein comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for treating the disease or disorder.
  • provided herein is a method of managing a disease or disorder in a subject having, or at risk of having, a disease or disorder manageable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for managing the disease or disorder.
  • the disease or disorder is a bile acid-related disease or associated disorder.
  • Non-limiting exemplary bile acid-related or associated disorders preventable, treatable or manageable according to the methods and uses provided herein include: cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., primary biliary cirrhosis (PBC), primary familial intrahepatic cholestasis (PFIC) (e.g., progressive PFIC), primary sclerosing choangitis (PSC), pregnancy intrahepatic cholestasis (PIC), neonatal cholestasis, and drug- induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn' s disease and ulcerative
  • the bile acid-related or associated disorder is bile acid malabsorption. In another particular embodiment, the bile acid-related or associated disorder is diarrhea. In another particular embodiment, the bile acid-related or associated disorder is bile acid diarrhea. In a still further particular embodiment, the bile acid-related or associated disorder is cholestasis. In one embodiment, the cholestasis is intrahepatic cholestasis. In another embodiment, the cholestasis is extrahepatic cholestasis. In another, further particular
  • the bile acid-related or associated disorder is an error in bile acid synthesis.
  • the bile acid-related or associated disorder is primary biliary cirrhosis (PBC).
  • the bile acid-related or associated disorder is primary sclerosing cholangitis (PSC).
  • PSC primary sclerosing cholangitis
  • the bile acid-related or associated disorder is PFIC (e.g., progressive PFIC).
  • the bile acid- related or associated disorder is NASH.
  • the bile acid-related or associated disorder is a hyperglycemic condition.
  • the bile acid-related or associated disorder is type 2 diabetes.
  • the pharmaceutical composition further comprises at least one additional agent effective in modulating bile acid homeostasis or treating a bile acid-related or associated disorder, wherein the additional agent is: a glucocorticoid; CDCA; UDCA; insulin, an insulin secretagogues, an insulin mimetic, a sulfonylurea and a meglitinide; a biguanide; an alpha-glucosidase inhibitors; a DPP-IV inhibitor, GLP-1, a GLP-1 agonists and a GLP-1 analog; a DPP-IV-resistant analogue; a PPAR gamma agonist, a dual-acting PPAR agonist, a pan-acting PPAR agonist; a PTP1B inhibitor; an SGLT inhibitor; an RXR agonist; a glycogen synthase kinase-3 inhibitor; an immune modulator; a beta-3 adrenergic receptor
  • the additional agent is:
  • the at least one additional agent effective in modulating PBC is UDCA, an FXR agonist, OCA, an ASBT inhibitor, an autoimmune agent, an anti-IL-12 agent, an anti-CD80 agent, an anti-CD20 agent, a CXCL10 neutralizing antibody, a ligand for CXCR3, a fibrate, fish oil, colchicine, methotrexate, azathioprine, cyclosporine, or an anti-retroviral therapy.
  • the at least one additional agent effective in modulating PBC is UDCA, OCA, an ASBT inhibitor, an anti-IL-12 agent, an anti-CD20 agent, or a fibrate.
  • Non-limiting exemplary disorders or conditions preventable, treatable or manageable with the peptide formulations, methods and uses thereof provided herein, include metabolic diseases and disorders.
  • diseases and disorders include: metabolic syndrome; a lipid- or glucose-related disorder; cholesterol or triglyceride metabolism; type 2 diabetes; cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), disorders impairing absorption of bile acids not otherwise characterized
  • hyperglycemic-related disorders including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage (e.g., diabetic retinopathy or cataracts), and diabetic foot disorders; dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like.
  • Other conditions which may be associated with metabolic syndrome such as obesity and elevated body mass (including the co-morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), and also include thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension (including portal hypertension (defined as a hepatic venous pressure gradient (HVPG) greater than 5 mm Hg), cardiovascular disease, stroke and heart failure; disorders or conditions in which inflammatory reactions are involved, including atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders;
  • NAFD nonalcoholic fatty liver disease
  • NASH nonalcoholic steatohepatitis
  • PCOS polycystic ovarian syndrome
  • thromboses hypercoagul
  • disorders of cell cycle or cell differentiation processes such as adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and neoplasms;
  • Neurodegenerative diseases and/or demyelinating disorders of the central and peripheral nervous systems and/or neurological diseases involving neuroinflammatory processes and/or other peripheral neuropathies including Alzheimer's disease, multiple sclerosis, Parkinson's disease, progressive multifocal leukoencephalopathy and Guillian-Barre syndrome; Skin and
  • dermatological disorders and/or disorders of wound healing processes including erythemato- squamous dermatoses; and other disorders such as syndrome X, osteoarthritis, and acute respiratory distress syndrome.
  • the subject is a human. In certain embodiments, the subject is a subject in need thereof.
  • the chimeric peptide sequence or a peptide sequence described herein is assessed to ensure that it does not cause untoward adverse effects in the subject.
  • the combination of a chimeric peptide sequence or a peptide sequence described herein and at least one additional therapeutic agent or treatment modality is assessed to ensure that it does not induce HCC in the subject.
  • assessments may be performed before initiation of therapy (e.g., in a dose escalation study), during therapy, (e.g., by evaluating a marker correlating with HCC activity), or subsequent to termination of therapy (e.g., by performing a liver biopsy).
  • the assessment is performed in a suitable test environment (e.g., a validated animal model).
  • a suitable test environment e.g., a validated animal model.
  • a suitable test environment e.g., a validated animal model.
  • PBC bile acid-related or associated disorder
  • a method includes administering a chimeric peptide or peptide sequence provided herein to a subject, such as a subject having a hyperglycemic condition (e.g., diabetes, such as insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes), insulin resistance, hyperinsulinemia, glucose intolerance or metabolic syndrome, or is obese or has an undesirable body mass.
  • a chimeric peptide sequence or peptide sequence is administered to a subject in an amount effective to improve glucose metabolism in the subject.
  • a subject has a fasting plasma glucose level greater than 100 mg/dl or has a hemoglobin Ale (HbAlc) level above 6%, prior to administration.
  • HbAlc hemoglobin Ale
  • a use or method of treatment of a subject is intended to or results in reduced glucose levels, increased insulin sensitivity, reduced insulin resistance, reduced glucagon, an improvement in glucose tolerance, or glucose metabolism or homeostasis, improved pancreatic function, or reduced triglyceride, cholesterol, IDL, LDL or VLDL levels, or a decrease in blood pressure, a decrease in intimal thickening of the blood vessel, or a decrease in body mass or weight gain.
  • a chimeric peptide sequence or peptide sequence is administered to a subject in an amount effective to improve or provide bile acid homeostasis.
  • Non-limiting exemplary bile acid related or associated disorders treatable according to the invention methods and uses include: metabolic syndrome; a lipid- or glucose-related disorder; cholesterol or triglyceride metabolism; type 2 diabetes; cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), disorders impairing absorption of bile acids not otherwise characterized (idiopathic)) leading to diarrhea (e.g., BAD) and GI symptoms, and GI
  • the bile acid related or associated disorder is bile acid malabsorption. In another embodiment, the bile acid related or associated disorder is diarrhea. In another embodiment, the bile acid related or associated disorder is cholestasis (e.g., intrahepatic or extrahepatic cholestasis). In another embodiment, the bile acid related or associated disorder is primary billiary cirrhosis. In another embodiment, the bile acid related or associated disorder is primary sclerosing cholangitis. In another embodiment, the bile acid related or associated disorder is PFIC (e.g., progressive PFIC).
  • PFIC progressive PFIC
  • FIG. 1 shows cyp7al expression in db/db mice dosed intraperitoneally with the indicated concentrations of FGF19 and FGF21 (SEQ ID NOs:99 and 100).
  • FIG. 2A-2D show cyp7al expression in human primary hepatocytes following dosing of A) variant Ml (SEQ ID NO: 1); B) variant M2 (SEQ ID NO:2); C) variant M5 (SEQ ID NO: 5); and D) variant M32 (SEQ ID NO: 32).
  • FIG. 3A-3D show cyp7al expression in human primary hepatocytes following dosing of A) variant M69 (SEQ ID NO:69); B) variant M75 (SEQ ID NO:75); C) variant M70 (SEQ ID NO: 70); and D) variant M76 (SEQ ID NO: 76).
  • FIG. 4A-4D show cyp7al expression in human primary hepatocytes following dosing of A) variant M85 (SEQ ID NO: 85); B) variant M96 (SEQ ID NO:96); C) variant M90 (SEQ ID NO: 90); and D) variant M98 (SEQ ID NO: 98).
  • FIG. 5 is a table showing the cyp7al IC 50 (pM), relative cyp7al expression and HCC core of the indicated variants: Ml, M2, M5, M32, M69, M70, M75, M76, M85, M90, M96 and M98.
  • FIG. 6 depicts the results of a human clinical trial, showing administration of M70 is able to suppress 7a-hydroxy-4-cholsten-3-one (C4), a marker of bile acid synthesis, as compared to a placebo.
  • C4 7a-hydroxy-4-cholsten-3-one
  • FIG. 7 depicts that the expression of FGFR4/p-klotho complex in L6 cells potentiates activation of intracellular signaling pathways by FGF19, M3 and M70.
  • FIG. 8 depicts that administration of M70 is able to suppress C4 as compared to a placebo.
  • FIG. 9 depicts that mice treated with M70 showed a statistically significant improvement in biochemical markers of liver damage, such as alkaline phosphatase (ALP), alkaline
  • ALT aminotransferase
  • AST aspartate aminotransfease
  • GTT gamma-glutamyltransferase
  • FIG. 10 depicts that continuous expression of M70 in Mdr2 knockout mouse normalized liver enzymes such as ALP, ALT, and AST.
  • FIG. 11 depicts the results of a human clinical trial, showing administration of M70 was able to promote body weight loss and to reduce serum triglycerides in type 2 diabetes patients.
  • patient or “subject” are used interchangeably to refer to a human or a non- human animal ⁇ e.g., a mammal).
  • treat refers to a course of action (such as administering a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated after a disease, disorder or condition, or a symptom thereof, has been diagnosed, observed, and the like so as to eliminate, reduce, suppress, mitigate, or ameliorate, either temporarily or permanently, at least one of the underlying causes of a disease, disorder, or condition afflicting a subject, or at least one of the symptoms associated with a disease, disorder, condition afflicting a subject.
  • treatment includes inhibiting (i.e. , arresting the development or further development of the disease, disorder or condition or clinical symptoms association therewith) an active disease.
  • in need of treatment refers to a judgment made by a physician or other medical professional that a subject requires or will benefit from treatment.
  • prevent refers to a course of action (such as administering a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated in a manner (e.g. , prior to the onset of a disease, disorder, condition or symptom thereof) so as to prevent, suppress, inhibit or reduce, either temporarily or permanently, a subject's risk of developing a disease, disorder, condition or the like (as determined by, for example, the absence of clinical symptoms) or delaying the onset thereof, generally in the context of a subject predisposed to having a particular disease, disorder or condition. In certain instances, the terms also refer to slowing the progression of the disease, disorder or condition or inhibiting progression thereof to a harmful or otherwise undesired state.
  • in need of prevention refers to a judgment made by a physician or other medical professional that a subject requires or will benefit from preventative care.
  • terapéuticaally effective amount refers to the administration of an agent to a subject, either alone or as a part of a pharmaceutical composition and either in a single dose or as part of a series of doses, in an amount that is capable of having any detectable, positive effect on any symptom, aspect, or characteristics of a disease, disorder or condition when administered to a patient.
  • the therapeutically effective amount can be ascertained by measuring relevant physiological effects. For example, in the case of a hyperglycemic condition, a lowering or reduction of blood glucose or an improvement in glucose tolerance test can be used to determine whether the amount of an agent is effective to treat the hyperglycemic condition.
  • a therapeutically effective amount is an amount sufficient to reduce or decrease any level (e.g.
  • a baseline level) of fasting plasma glucose (FPG) wherein, for example, the amount is sufficient to reduce a FPG level greater than 200 mg/dl to less than 200 mg/dl, wherein the amount is sufficient to reduce a FPG level between 175 mg/dl and 200 mg/dl to less than the starting level, wherein the amount is sufficient to reduce a FPG level between 150 mg/dl and 175 mg/dl to less than the starting level, wherein the amount is sufficient to reduce a FPG level between 125 mg/dl and 150 mg/dl to less than the starting level, and so on (e.g.
  • the effective amount is an amount sufficient to reduce or decrease levels by more than about 10% to 9%, by more than about 9% to 8%, by more than about 8% to 7%, by more than about 7% to 6%, by more than about 6% to 5%, and so on.
  • HbAIc levels by about 0.1%, 0.25%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 1.5%, 2%, 3%, 4%, 5%, 10%, 20%, 30%, 33%, 35%, 40%, 45%, 50%, or more is contemplated by the present disclosure.
  • the therapeutically effective amount can be adjusted in connection with the dosing regimen and diagnostic analysis of the subject's condition and the like.
  • the phrase "in a sufficient amount to effect a change” means that there is a detectable difference between a level of an indicator measured before (e.g., a baseline level) and after administration of a particular therapy.
  • Indicators include any objective parameter (e.g., level of glucose or insulin) or subjective parameter (e.g., a subject's feeling of well-being).
  • glucose tolerance refers to the ability of a subject to control the level of plasma glucose and/or plasma insulin when glucose intake fluctuates.
  • glucose tolerance encompasses the subject's ability to reduce, within about 120 minutes, the level of plasma glucose back to a level determined before the intake of glucose.
  • the terms “diabetes” and “diabetic” refer to a progressive disease of carbohydrate metabolism involving inadequate production or utilization of insulin, frequently characterized by hyperglycemia and glycosuria.
  • pre-diabetes and pre-diabetic refer to a state wherein a subject does not have the characteristics, symptoms and the like typically observed in diabetes, but does have characteristics, symptoms and the like that, if left untreated, can progress to diabetes. The presence of these conditions can be determined using, for example, either the fasting plasma glucose (FPG) test or the oral glucose tolerance test (OGTT). Both usually require a subject to fast for at least 8 hours prior to initiating the test.
  • FPG fasting plasma glucose
  • OGTT oral glucose tolerance test
  • a subject's blood glucose is measured after the conclusion of the fasting; generally, the subject fasts overnight and the blood glucose is measured in the morning before the subject eats.
  • a healthy subject would generally have a FPG concentration between about 90 and about 100 mg/dl
  • a subject with "pre-diabetes” would generally have a FPG concentration between about 100 and about 125 mg/dl
  • a subject with "diabetes” would generally have a FPG level above about 126 mg/dl.
  • OGTT a subject's blood glucose is measured after fasting and again two hours after drinking a glucose-rich beverage.
  • a healthy subject Two hours after consumption of the glucose-rich beverage, a healthy subject generally has a blood glucose concentration below about 140 mg/dl, a pre-diabetic subject generally has a blood glucose concentration about 140 to about 199 mg/dl, and a diabetic subject generally has a blood glucose concentration about 200 mg/dl or above. While the aforementioned glycemic values pertain to human subjects, normoglycemia, moderate hyperglycemia and overt hyperglycemia are scaled differently in murine subjects.
  • a healthy murine subject after a four-hour fast would generally have a FPG concentration between about 100 and about 150 mg/dl
  • a murine subject with "pre-diabetes” would generally have a FPG concentration between about 175 and about 250 mg/dl
  • a murine subject with "diabetes” would generally have a FPG concentration above about 250 mg/dl.
  • insulin resistance refers to a condition where a normal amount of insulin is unable to produce a normal physiological or molecular response.
  • a hyper- physiological amount of insulin either endogenously produced or exogenously administered, is able to overcome the insulin resistance, in whole or in part, and produce a biologic response.
  • metabolic syndrome refers to an associated cluster of traits that includes, but is not limited to, hyperinsulinemia, abnormal glucose tolerance, obesity, redistribution of fat to the abdominal or upper body compartment, hypertension, dysfibrinolysis, and dyslipidemia characterized by high triglycerides, low high density lipoprotein (HDL)-cholesterol, and high small dense low density lipoprotein (LDL) particles.
  • Subjects having metabolic syndrome are at risk for development of type 2 diabetes and/or other disorders (e.g., atherosclerosis).
  • glucose metabolism disorder encompasses any disorder characterized by a clinical symptom or a combination of clinical symptoms that is associated with an elevated level of glucose and/or an elevated level of insulin in a subject relative to a healthy individual. Elevated levels of glucose and/or insulin can be manifested in the following diseases, disorders and conditions: hyperglycemia, type II diabetes, gestational diabetes, type I diabetes, insulin resistance, impaired glucose tolerance, hyperinsulinemia, impaired glucose metabolism, pre-diabetes, other metabolic disorders (such as metabolic syndrome, which is also referred to as syndrome X), and obesity, among others.
  • diseases, disorders and conditions hyperglycemia, type II diabetes, gestational diabetes, type I diabetes, insulin resistance, impaired glucose tolerance, hyperinsulinemia, impaired glucose metabolism, pre-diabetes, other metabolic disorders (such as metabolic syndrome, which is also referred to as syndrome X), and obesity, among others.
  • polypeptides of the present disclosure can be used, for example, to achieve and/or maintain glucose homeostasis, e.g., to reduce glucose level in the bloodstream and/or to reduce insulin level to a range found in a healthy subject.
  • hypoglycemia refers to a condition in which an elevated amount of glucose circulates in the blood plasma of a subject relative to a healthy individual.
  • Hyperglycemia can be diagnosed using methods known in the art, including measurement of fasting blood glucose levels as described herein.
  • hyperinsulinemia refers to a condition in which there are elevated levels of circulating insulin when, concomitantly, blood glucose levels are either elevated or normal.
  • Hyperinsulinemia can be caused by insulin resistance which is associated with dyslipidemia, such as high triglycerides, high cholesterol, high low-density lipoprotein (LDL) and low high-density lipoprotein (HDL); high uric acids levels; polycystic ovary syndrome; type ⁇ diabetes and obesity.
  • hyperinsulinemia can be diagnosed as having a plasma insulin level higher than about 2 ⁇ /mL.
  • body weight disorder and similar terms refer to conditions associated with excessive body weight and/or enhanced appetite.
  • a subject can be considered overweight or obese by assessment of the subject's Body Mass Index (BMI), which is calculated by dividing a subject's weight in kilograms by the subject's height in meters squared.
  • BMI Body Mass Index
  • An adult having a BMI in the range of -18.5 to -24.9 kg/m 2 is considered to have a normal weight; an adult having a BMI between -25 and -29.9 kg/m 2 can be considered overweight (pre-obese); and an adult having a BMI of -30 kg/m 2 or higher can be considered obese.
  • Enhanced appetite frequently contributes to excessive body weight.
  • night eating syndrome which is characterized by morning anorexia and evening polyphagia often associated with insomnia, but which can be related to injury to the hypothalamus.
  • polypeptide refers to a polymeric form of amino acids of any length, which can include genetically coded and non- genetically coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified polypeptide backbones.
  • the terms include fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence, fusion proteins with heterologous and homologous leader sequences, with or without N-terminus methionine residues; immunologically tagged proteins; and the like. It will be appreciated that throughout this disclosure reference is made to amino acids according to the single letter or three letter codes.
  • variants encompasses naturally-occurring variants (e.g. , homologs and allelic variants) and non-naturally-occurring variants (e.g. , muteins).
  • Naturally- occurring variants include homologs, i.e. , nucleic acids and polypeptides that differ in nucleotide or amino acid sequence, respectively, from one species to another.
  • Naturally-occurring variants include allelic variants, i.e. , nucleic acids and polypeptides that differ in nucleotide or amino acid sequence, respectively, from one individual to another within a species.
  • Non-naturally-occurring variants include nucleic acids and polypeptides that comprise a change in nucleotide or amino acid sequence, respectively, where the change in sequence is artificially introduced, e.g. , the change is generated in the laboratory or other facility by human intervention ("hand of man").
  • label in reference to FGF19, refers to biologically active, naturally- occurring FGF19, including biologically active, naturally-occurring FGF19 variants.
  • the term includes the 194 amino acid human FGF19 mature sequence.
  • label when use in the context of a polypeptide or nucleic acid (or antibody, as appropriate) of the present disclosure are meant to refer broadly to any means useful in, for example, polypeptide purification, identification, isolation and synthesis.
  • Labels are generally covalently bound to the polypeptide of interest and can be introduced in any manner known in the art, including attachment to a mature polypeptide (generally at the N- or C-terminus), incorporation during solid-phase peptide synthesis, or through recombinant means. Examples include, but are not limited to, fluorescence, biotinylation, and radioactive isotopes.
  • Polypeptide and nucleic acid molecules can be labeled by both in vitro and in vivo methods. Labeling reagents and kits can be obtained from a number of commercial sources ⁇ e.g., Thermo Fischer Scientific,
  • muteins refers broadly to mutated recombinant proteins, i.e., a polypeptide comprising an artificially introduced change in amino acid sequence, e.g., a change in amino acid sequence generated in the laboratory or other facility by human intervention ("hand of man"). These proteins usually carry single or multiple amino acid substitutions and are frequently derived from cloned genes that have been subjected to site-directed or random mutagenesis, or from completely synthetic genes.
  • modified refers to one or more changes that enhance a desired property of human FGF19, a naturally-occurring FGF19 variant, or a FGF19 mutein, wherein the change(s) does not alter the primary amino acid sequence of the FGF19.
  • Such desired properties include, for example, enhancing solubility, prolonging the circulation half-life, increasing the stability, reducing the clearance, altering the immunogenicity or allergenicity, improving aspects of manufacturability ⁇ e.g., cost and efficiency), and enabling the raising of particular antibodies ⁇ e.g., by introduction of unique epitopes) for use in detection assays.
  • Changes to human FGF19, a naturally -occurring FGF19 variant, or a FGF19 mutein that can be carried out include, but are not limited to, pegylation
  • PEG polyethylene glycol
  • glycosylation ⁇ e.g., N-glycosylation
  • polysialylation and hesylation ⁇ e.g., N-glycosylation
  • albumin fusion ⁇ e.g., albumin binding through, for example, a conjugated fatty acid chain (acylation); Fc-fusion; and fusion with a PEG mimetic.
  • Some particular embodiments entail modifications involving polyethylene glycol, other particular embodiments entail modifications involving albumin, and still other particular modifications entail modifications involving glycosylation.
  • DNA DNA
  • nucleic acid nucleic acid molecule
  • polynucleotide polynucleotide
  • polynucleotides include linear and circular nucleic acids, messenger RNA (mRNA), complementary DNA (cDNA), recombinant polynucleotides, vectors, probes, primers and the like.
  • mRNA messenger RNA
  • cDNA complementary DNA
  • recombinant polynucleotides vectors, probes, primers and the like.
  • probe refers to a fragment of DNA or RNA corresponding to a gene or sequence of interest, wherein the fragment has been labeled radioactively (e.g., by incorporating 2 P or 5 S) or with some other detectable molecule, such as biotin, digoxygen or fluorescein.
  • a probe can be used, for example, to label viral plaques, bacterial colonies or bands on a gel that contain the gene of interest.
  • a probe can be cloned DNA or it can be a synthetic DNA strand; the latter can be used to obtain a cDNA or genomic clone from an isolated protein by, for example, microsequencing a portion of the protein, deducing the nucleic acid sequence encoding the protein, synthesizing an oligonucleotide carrying that sequence, radiolabeling the sequence and using it as a probe to screen a cDNA library or a genomic library.
  • heterologous refers to two components that are defined by structures derived from different sources.
  • a “heterologous” polypeptide can include operably linked amino acid sequences that are derived from different polypeptides.
  • a “heterologous" polynucleotide can include operably linked nucleic acid sequences that can be derived from different genes.
  • heterologous nucleic acids include expression constructs in which a nucleic acid comprising a coding sequence is operably linked to a regulatory element (e.g., a promoter) that is from a genetic origin different from that of the coding sequence (e.g., to provide for expression in a host cell of interest, which can be of different genetic origin than the promoter, the coding sequence or both).
  • a regulatory element e.g., a promoter
  • heterologous can refer to the presence of a nucleic acid (or gene product, such as a polypeptide) that is of a different genetic origin than the host cell in which it is present.
  • operably linked refers to linkage between molecules to provide a desired function.
  • “operably linked” in the context of nucleic acids refers to a functional linkage between nucleic acid sequences.
  • a nucleic acid expression control sequence such as a promoter, signal sequence, or array of transcription factor binding sites
  • the expression control sequence affects transcription and/or translation of the second polynucleotide.
  • “operably linked” refers to a functional linkage between amino acid sequences (e.g., different domains) to provide for a described activity of the polypeptide.
  • N-terminus or “amino terminus” and “C-terminus” (or “carboxyl terminus”) refer to the extreme amino and carboxyl ends of the polypeptide, respectively, while the terms “N-terminal” and “C-terminal” refer to relative positions in the amino acid sequence of the polypeptide toward the N-terminus and the C-terminus, respectively, and can include the residues at the N-terminus and C-terminus, respectively.
  • Immediately N-terminal or “immediately C-terminal” refers to a position of a first amino acid residue relative to a second amino acid residue where the first and second amino acid residues are covalently bound to provide a contiguous amino acid sequence.
  • “Derived from”, in the context of an amino acid sequence or polynucleotide sequence is meant to indicate that the polypeptide or nucleic acid has a sequence that is based on that of a reference polypeptide or nucleic acid (e.g., a naturally occurring FGF19 polypeptide or a FGF19-encoding nucleic acid), and is not meant to be limiting as to the source or method in which the protein or nucleic acid is made.
  • the term “derived from” includes homologues or variants of reference amino acid or DNA sequences.
  • isolated refers to a polypeptide of interest that, if naturally occurring, is in an environment different from that in which it can naturally occur.
  • isolated is meant to include polypeptides that are within samples that are substantially enriched for the polypeptide of interest and/or in which the polypeptide of interest is partially or substantially purified. Where the polypeptide is not naturally occurring, “isolated” indicates the polypeptide has been separated from an environment in which it was made by either synthetic or recombinant means.
  • Enriched means that a sample is non-naturally manipulated (e.g., by a scientist or a clinician) so that a polypeptide of interest is present in a) a greater concentration (e.g., at least 3-fold greater, at least 4-fold greater, at least 8-fold greater, at least 64-fold greater, or more) than the concentration of the polypeptide in the starting sample, such as a biological sample (e.g., a sample in which the polypeptide naturally occurs or in which it is present after administration), or b) a concentration greater than the environment in which the polypeptide was made (e.g., as in a bacterial cell).
  • a biological sample e.g., a sample in which the polypeptide naturally occurs or in which it is present after administration
  • a concentration greater than the environment in which the polypeptide was made e.g., as in a bacterial cell.
  • substantially pure indicates that a component (e.g., a polypeptide) makes up greater than about 50% of the total content of the composition, and typically greater than about 60% of the total polypeptide content. More typically, “substantially pure” refers to compositions in which at least 75%, at least 85%, at least 90% or more of the total composition is the component of interest. In some cases, the polypeptide will make up greater than about 90%, or greater than about 95% of the total content of the composition.
  • a component e.g., a polypeptide
  • measuring or “assaying” and grammatical variations thereof are used interchangeably herein and refer to either qualitative or quantitative determinations, or both qualitative and quantitative determinations.
  • any means of assessing the relative amount is contemplated, including the various methods set forth herein and known in the art.
  • gene expression can be assayed or measured by a Northern blot, Western blot, immunoprecipitation assay, or by measuring activity, function or amount of the expressed protein.
  • antibodies refer to glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules which lack antigen specificity.
  • the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations, which can include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • isolated refers to an antibody that has been separated and/or recovered from contaminant components of its natural environment; such contaminant components include materials which might interfere with diagnostic or therapeutic uses for the antibody, and can include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • FGF19-dependent refers to a disease, disorder or other condition that is caused all, or in part, by the expression of FGF19.
  • the expression of FGF19 is amplified as compared to a control.
  • the expression of FGF19 is amplified 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more, or any numerical range thereof.
  • the amplified expression of FGF19 directly results in the disease, disorder or condition, or a symptom thereof.
  • the amplified expression of FGF19 indirectly results in the disease disorder or condition, or a symptom thereof.
  • the pharmaceutical compositions, formulations and dosage forms provided herein comprise one or more peptides or peptide sequences provided herein.
  • the pharmaceutical compositions, formulations and dosage forms provided herein comprise one or more variants of FGF 19 peptide sequences, fusions of FGF 19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of a bile acid-related or associated disorder (e.g., PBC), a metabolic disorder or a cancer or tumor.
  • the activity is a glucose lowering activity.
  • Such variants and fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences include sequences that do not
  • a chimeric peptide sequence includes or consists of an N- terminal region having at least seven amino acid residues and the N-terminal region having a first amino acid position and a last amino acid position, where the N-terminal region has a DSSPL (SEQ ID NO: 121) or DASPH (SEQ ID NO: 122) sequence; and a C-terminal region having a portion of FGF19 and the C-terminal region having a first amino acid position and a last amino acid position, where the C-terminal region includes amino acid residues 16-29 of FGF 19 (WGDPIRLRHLYTSG; SEQ ID NO: 169) and the W residue corresponds to the first amino acid position of the C-terminal region.
  • the variant is M70:
  • the variant is M69: RDS SPLVHYGWGDPIRLRHLYTSGPHGLS SCFLRIRADGVVDC ARGQ S AHSLLEIKAVA LRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVS L S S AKQRQL YKNRGFLPL SUFLPMLPMVPEEPEDLRGHLE SDMF S SPLETD S 16MDPF GL VTGLE A VRSP SFEK (SEQ ID NO:69).
  • the treatment peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position; and b) a C-terminal region comprising a portion of SEQ ID NO: 99 [FGF19], the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises (i) a first C-terminal region sequence comprising WGDPIRLRHLYTSG (amino acids 16 to 29 of SEQ ID NO:99 [FGF19]), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and (ii) a second C-terminal region sequence comprising
  • the treatment peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO: 121) or DASPH (SEQ ID NO: 122); and b) a C-terminal region comprising a portion of SEQ ID NO: 99 [FGF19], the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises (i) a first C-terminal region sequence comprising WGDPIRLRHLYTSG (amino acids 16 to 29 of SEQ ID NO:99 [FGF19]), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and (ii) a second C-terminal region sequence comprising
  • the peptide (l) binds to FGFR4 with an affinity equal to or greater than FGF19 binding affinity for FGFR4; (ii) activates FGFR4 to an extent or amount equal to or greater than FGF19 activates FGFR4; (iii) has at least one of reduced HCC formation; greater glucose lowering activity, less lipid increasing activity, less triglyceride activity, less cholesterol activity, less non-HDL activity or less HDL increasing activity, as compared to FGF19, or as compared to an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV(SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI
  • the second C-terminal region sequence comprises at least one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) sequence.
  • the at least one amino acid substitution is to the IRP sequence of the EIRPD (amino acids 2-6 of SEQ ID NO: 190) sequence.
  • the at least one amino acid substitution is to the RP sequence of the EIRPD sequence (amino acids 2-6 of SEQ ID NO: 190).
  • the at least one amino acid substitution is R to L substitution.
  • the at least one amino acid substitution is P to E substitution.
  • the at least one amino acid substitution is RP to LE substitution.
  • the second C-terminal region sequence comprises from 2 to 5 amino acid substitutions, deletions or insertions. In other embodiments, the peptide is less than about 250 amino acids in length.
  • the treatment peptide has an amino acid sequence comprising or consisting of
  • the treatment peptide has an amino acid sequence comprising SEQ ID NO:70. In other embodiments, the treatment peptide has an amino acid sequence consisting of SEQ ID NO:70. In some embodiments, the treatment peptide is fused with an immunoglobulin Fc region.
  • the treatment peptide has an amino acid sequence comprising or consisting of
  • the treatment peptide has an amino acid sequence comprising SEQ ID NO:69. In other embodiments, the treatment peptide has an amino acid sequence consisting of SEQ ID NO:69.
  • the treatment peptide is fused with an immunoglobulin Fc region.
  • the treatment peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position,; and b) a C-terminal region comprising a first amino acid position and a last amino acid position, wherein the C-terminal region comprises (i) a first C-terminal region sequence comprising WGDPIRQRHLYTSG (SEQ ID NO: 169 with a L7Q substitution), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and (ii) a second C-terminal region sequence comprising
  • the treatment peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO: 121), DASPH (SEQ ID NO: 122), or DAGPH (amino acids 7 to 11 of SEQ ID NO:99 [FGF19]); and b) a C-terminal region comprising a first amino acid position and a last amino acid position, wherein the C-terminal region comprises (i) a first C-terminal region sequence comprising
  • WGDPIRQRHLYTSG (SEQ ID NO: 169 with a L7Q substitution), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and (ii) a second C-terminal region sequence comprising
  • the peptide (i) binds to FGFR4 with an affinity equal to or greater than FGF19 binding affinity for FGFR4; (ii) activates FGFR4 to an extent or amount equal to or greater than FGF19 activates FGFR4; (iii) has at least one of reduced hepatocellular carcinoma (HCC) formation; greater glucose lowering activity, less lipid increasing activity, less triglyceride activity, less cholesterol activity, less non-HDL activity or less HDL increasing activity, as compared to FGF19, or as compared to an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID
  • the second C-terminal region sequence comprises at least one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) sequence.
  • the at least one amino acid substitution is to the IRP sequence of the EIRPD (amino acids 2-6 of SEQ ID NO: 190) sequence.
  • the at least one amino acid substitution is to the RP sequence of the EIRPD sequence (amino acids 2-6 of SEQ ID NO: 190).
  • the at least one amino acid substitution is R to L substitution.
  • the at least one amino acid substitution is P to E substitution.
  • the at least one amino acid substitution is RP to LE substitution.
  • the second C-terminal region sequence comprises from 2 to 5 amino acid substitutions, deletions or insertions. In other embodiments, the peptide is less than about 250 amino acids in length.
  • a chimeric peptide sequence includes or consists of an N- terminal region having a portion of FGF21 and the N-terminal region having a first amino acid position and a last amino acid position, where the N-terminal region has a GQV sequence and the V residue corresponds to the last amino acid position of the N-terminal region; and a C- terminal region having a portion of FGF19 and the C-terminal region having a first amino acid position and a last amino acid position where the C-terminal region includes amino acid residues 21-29 of FGF 19 (RLRHLYTSG; SEQ ID NO: 185) and the R residue corresponds to the first position of the C-terminal region.
  • RLRHLYTSG amino acid residues 21-29 of FGF 19
  • modifications to the Loop-8 region of FGF 19 are disclosed herein that possess favorable metabolic parameters without exhibiting substantial tumorigenicity.
  • FGF 19 residues 127-129 are defined as constituting the Loop-8 region, although in the literature the Loop-8 region is sometimes defined as including or consisting of other residues (e.g., residues 125-129).
  • Certain combinations of R127L and P128E substitutions to the FGF19 framework had an unexpectedly positive effect on HCC formation. Even more surprisingly, a combination of R127L and P128E substitutions and a substitution of Gin (Q) for Leu (L) in the FGF 19 core region had an even more significant effect on preventing HCC formation.
  • variants of FGF 19 Loop-8 region are included since they can reduce or eliminate substantial, measurable or detectable HCC formation. Furthermore, the effect of reducing HCC formation may be enhanced by modifications to amino acid residues outside of the Loop-8 region (e.g., substitutions of amino acid residues in the core region, such as the region corresponding to amino acids 21-29 of SEQ ID NO: 99).
  • the Loop-8 modified variant comprises a substitution in the FGF 19 Loop-8 region corresponding to amino acids 127-129 of SEQ ID NO:99.
  • the Loop-8 modified variant comprises a substitution in the FGF19 Loop-8 region corresponding to (i) a R127L substitution, (ii) a P128E substitution, or (iii) a R127L substitution and a P128E substitution.
  • the amino acid sequence of the peptide comprises at least one amino acid substitution in the Loop-8 region of FGF19, or the corresponding FGF19 sequence thereof in a variant peptide provided herein.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises three amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid sequence of the peptide comprises four amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises five amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In other embodiments, the amino acid sequence of the peptide comprises three amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises one amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution.
  • the substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is a Pro (P) to Glu (E) substitution.
  • the substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution and a Pro (P) to Glu (E) substitution.
  • substitution(s) in the Loop-8 region of FGF19 is in the corresponding FGF19 sequence thereof in a variant peptide provided herein. That is, said substitutions within a corresponding FGF19 sequence (e.g., EIRPD, IRP or RP) of a peptide variant provided herein is also contemplated.
  • a corresponding FGF19 sequence e.g., EIRPD, IRP or RP
  • the FGF19 variant comprises or further comprises a substitution in the core region corresponding to amino acids 21-29 of SEQ ID NO:99. In certain embodiments, the FGF19 variant comprises or further comprises a substitution in the core region corresponding to a L22Q substitution.
  • the Loop-8 modified variant is M70:
  • the Loop-8 modified M70 variant comprises a substitution in the FGF19 Loop-8 region (RPD; underlined) corresponding to (i) an R to L substitution, (ii) a P to E substitution, or (iii) an R to L substitution and a P to E substitution (SEQ. ID NO:204).
  • the Loop-8 modified M70 variant further comprises or further comprises a substitution in the FGF19 core region.
  • the Loop-8 modified M70 variant comprises a L18Q substitution (i.e., SEQ ID NO:70 with an L18Q substitution).
  • the Loop-8 modified variant is M69:
  • the Loop-8 modified M69 variant comprises a substitution in the FGF19 Loop-8 region (RPD; underlined) corresponding to (i) an R to L substitution, (ii) a P to E substitution, or (iii) an R to L substitution and a P to E substitution.
  • RPD FGF19 Loop-8 region
  • the Loop-8 modified M69 variant further comprises or further comprises a substitution in the FGF19 core region.
  • the Loop-8 modified M69 variant comprises a L17Q substitution (i.e., SEQ ID NO:69 with an L17Q substitution).
  • the amino acid sequence of the peptide comprises one amino acid substitution to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises two amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In other embodiments, the amino acid sequence of the peptide comprises three amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises four amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In some embodiments, the amino acid sequence of the peptide comprises five amino acid substitutions to the EIRPD (amino acids 2-6 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid sequence of the peptide comprises one amino acid substitution to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In other embodiments, the amino acid sequence of the peptide comprises three amino acid substitutions to the IRP (amino acids 3-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19. In certain embodiments, the amino acid sequence of the peptide comprises one amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid sequence of the peptide comprises two amino acid substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19.
  • the amino acid substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution.
  • the substitution to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is a Pro (P) to Glu (E) substitution.
  • the substitutions to the RP (amino acids 4-5 of SEQ ID NO: 190) amino acid sequence in the Loop-8 region of FGF19 is an Arg (R) to Leu (L) substitution and a Pro (P) to Glu (E) substitution.
  • the foregoing substitution(s) in the Loop-8 region of FGF19 is in the corresponding FGF19 sequence thereof in a variant peptide provided herein. That is, said substitutions within a corresponding FGF19 sequence (e.g., EIRPD, IRP or RP) of a peptide variant provided herein is also contemplated.
  • a peptide sequence includes or consists of a FGF 19 variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF 19.
  • a peptide sequence includes or consists of a FGF21 sequence variant having one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF21.
  • a peptide sequence includes or consists of a portion of a FGF 19 sequence fused to a portion of a FGF21 sequence.
  • a peptide sequence includes or consists of a portion of a FGF 19 sequence fused to a portion of a FGF21 sequence, where the FGF 19 and/or FGF21 sequence portion(s) have one or more amino acid substitutions, insertions or deletions compared to a reference or wild type FGF 19 and/or FGF21.
  • Examples of such sequences are disclosed in PCT Pub. No. WO 2013/006486 and US Pub. No. 2013/0023474, as well as PCT Publ. No. WO 2014/085365, published June 5, 2014. Tables 1-1 1 and the Sequence Listing also sets forth representative sequences that may be used in the methods provided herein.
  • the treatment peptides provided herein include variants and fusions of FGF 19 and/or FGF21 peptide sequences.
  • the treatment peptides include one or more variant or fusion FGF19 and/or FGF21 peptide.
  • the methods provided herein include contacting or administering to a subject one or more nucleic acid molecules encoding a variant or fusion FGF 19 and/or FGF21 peptide sequence (for example, an expression control element in operable linkage with the nucleic acid encoding the peptide sequence, optionally including a vector), in an amount effective for treating a bile acid- related or associated disorder.
  • a representative reference or wild type FGF 19 sequence is set forth as:
  • a representative reference or wild type FGF21 sequence is set forth as:
  • FGF21 allelic variants include, e.g., M70, M71 and M72.
  • peptide protein
  • polypeptide sequence are used interchangeably herein to refer to two or more amino acids, or “residues,” including chemical modifications and derivatives of amino acids, covalently linked by an amide bond or equivalent.
  • the amino acids forming all or a part of a peptide may be from among the known 21 naturally occurring amino acids, which are referred to by both their single letter abbreviation or common three-letter abbreviation.
  • conventional amino acid residues have their conventional meaning. Thus, “Leu” is leucine, "He” is isoleucine, "Nle” is norleucine, and so on.
  • a peptide or chimeric sequence provided herein has at the N-terminal region first amino acid position an "M” residue, an "R” residue, a “S” residue, a “H” residue, a “P” residue, a “L” residue or an “D” residue.
  • a peptide or chimeric sequence peptide sequence does not have a "M” residue or an "R” residue at the first amino acid position of the N-terminal region.
  • subsequences, variants and modified forms of the exemplified peptide sequences include the FGF19 and FGF21 variants and subsequences listed in the Sequence Listing, or Tables 1-11), so long as the foregoing retains at least a detectable or measureable activity or function.
  • certain exemplified variant peptides for example, those having all or a portion of FGF21 sequence at the amino-terminus, have an "R" residue positioned at the N-terminus, which can be omitted.
  • certain exemplified variant peptides include an "M" residue positioned at the N-terminus, which can be appended to or further substituted for an omitted residue, such as an "R” residue. More particularly, in various embodiments peptide sequences at the N-terminus include any of: RDSS (SEQ ID NO: 115), DSS, MDSS (SEQ ID NO: 116) or MRDSS (SEQ ID NO: 117).
  • peptide sequences include those with the following residues at the N-terminus: MDSSPL (SEQ ID NO: 119), MSDSSPL (SEQ ID NO: 120) (cleaved to SDSSPL (SEQ ID NO: 112)) and MSSPL (SEQ ID NO: 113) (cleaved to SSPL (SEQ ID NO: 114)).
  • peptide sequences distinct from reference FGF19 and FGF21 polypeptides set forth herein, that modulate bile acid homeostasis, hyperglycemic conditions, insulin resistance, hyperinsulinemia, glucose intolerance, metabolic syndrome, or related disorders, in vivo ⁇ e.g., Tables 1-11 and the Sequence Listing).
  • Non-limiting particular examples are a peptide sequence with amino-terminal amino acids 1-16 of FGF21 fused to carboxy - terminal amino acids 21-194 of FGF19; a peptide sequence with amino-terminal amino acids 1- 147 of FGF19 fused to carboxy -terminal amino acids 147-181 of FGF21; a peptide sequence with amino-terminal amino acids 1-20 of FGF19 fused to carboxy -terminal amino acids 17-181 of FGF21; a peptide sequence with amino-terminal amino acids 1-146 of FGF21 fused to carboxy -terminal amino acids 148-194 of FGF19; and a peptide sequence with amino-terminal amino acids 1-20 of FGF19 fused to internal amino acids 17-146 of FGF21 fused to carboxy - terminal amino acids 148-194 of FGF19.
  • Additional particular peptides sequences have a WGDPI (SEQ ID NO: 170) sequence motif corresponding to the WGDPI sequence of amino acids 16-20 of FGF19 (SEQ ID NO:99), lack a WGDPI (SEQ ID NO: 170) sequence motif corresponding to the WGDPI sequence of amino acids 16-20 of FGF19 (SEQ ID NO:99), or have a substituted (i.e., mutated) WGDPI (SEQ ID NO: 170) sequence motif corresponding to FGF19 WGDPI sequence of amino acids 16- 20 of FGF19 (SEQ ID NO: 99).
  • Particular peptide sequences provided herein also include sequences distinct from FGF19 and FGF21 ⁇ e.g., as set forth herein), and FGF 19 variant sequences having any GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO:
  • WGDPI SEQ ID NO: 170 sequence at amino acids 16-20.
  • wild-type FGF 19 and FGF21 may be excluded sequences, and FGF19 having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV(SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID
  • WDPI SEQ ID NO: 181
  • WGDI SEQ ID NO: 182
  • WGDP SEQ ID NO: 183
  • FGDPI SEQ ID NO: 184 substituted for the WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20 of FGF19 may also be excluded.
  • peptide sequences include or consist of all or a part of a sequence variant specified herein as M1-M98 (SEQ ID NOs: l-52, 192, and 54-98, respectively), Ml 01 to Ml 60, or M200 to M207. More particular non-limiting examples of peptide sequences include or consist of all or a part of a sequence set forth as:
  • RPL AF SD S SPL VH YGWGDPIRLRHL YT S GPHGL S S CFLRIRADGVVDC ARGQ S AH SLLEI KAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKH RLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDP FGL VTGLE AVRSPSFEK (M2) (SEQ ID NO:2 or 140);
  • RHPIPD S SPLLQF GGN VRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIK A V ALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPV SL S S AKQRQL YKNRGFLPL SHFLPMLPMVPEEPEDLRGHLE SDMF S SPLETD SMDPF GL V TGLE AVRSP SFEK (M51) (SEQ ID NO:51, 36 or 155);
  • MRD SPLVHYGWGDPIRLRHLYT SGPHGL S SCFLRIRADGVVDC ARGQ S AHSLLEIK AV ALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPV SL S S AKQRQL YKNRGFLPL SHFLPMLPMVPEEPEDLRGHLE SDMF S SPLETD SMDPF GL V TGLE AVRSP SFEK (M70) (SEQ ID NO:70);
  • the R terminal residue is deleted.
  • HPIPD S SPLLQF GGQ VRLRHL YT S G (M5-R) (amino acids 1-25 of SEQ ID NO: 160);
  • RPL AF SD S SPLLQF GGQ VRLRHL YT S G (amino acids 1-27 of SEQ ID NO:7);
  • HPIPD S SPLLQ WGDPIRLRHL YT S G (M8-R) (amino acids 2-26 of SEQ ID NO:8);
  • HPIPD S SPLLQF GWGDPIRLRHL YT SG (M9-R) (amino acids 2-28 of SEQ ID NO:9);
  • HPIPD S SPHVH YGWGDPIRLRHL YT S G (M10-R) (amino acids 2-28 of SEQ ID NO: 10); RPLAFSDAGPLLQWGDPIRLRHLYTSG (Ml 1) (amino acids 1-27 of SEQ ID NO: 11);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (amino acids 1-29 of SEQ ID NO: 12);
  • RPL AFSDAGPLLQFGGQ VRLRHL YTSG (M13) (amino acids 1-27 of SEQ ID NO: 13);
  • HPIPD S SPHVH YGGQ VRLRHL YT S G (M14-R) (amino acids 2-26 of SEQ ID NO: 14);
  • RPL AFSDAGPHVHYGGQ VRLRHL YTSG (Ml 5) (amino acids 1-27 of SEQ ID NO: 15);
  • RPL AFSDAGPHVHWGDPIRLRHL YTSG (M16) (amino acids 1-27 of SEQ ID NO: 16); RPLAF SD AGPHVGWGDPIRLRHL YTSG (M17) (amino acids 1-27 of SEQ ID NO: 17); RPL AF SD AGPHYGWGDPIRLRHL YTSG (M18) (amino acids 1-27 of SEQ ID NO: 18); RPLAF SD AGP VYGWGDPIRLRHL YTSG (M19) (amino acids 1-27 of SEQ ID NO: 19); RPLAF SD AGP VHGWGDPIRLRHL YTSG (M20) (amino acids 1-27 of SEQ ID NO:20); RPLAF SD AGP VHYWGDPIRLRHL YTSG (M21) (amino acids 1-27 of SEQ ID NO:21); RPLAF SDAGPHVHGWGDPIRLRHL YTSG (M22) (amino acids 1-27 of SEQ ID NO:22);
  • RHPIPD S SPLLQF GPQ VRLRHL YT S G (M33) (amino acids 1-26 of SEQ ID NO:33);
  • RHPIPD S SPLLQF GGQ ARLRHL YT S G (M37) (amino acids 1-26 of SEQ ID NO:37);
  • RHPIPD S SPLLQF GWGQP VRLRHL YT S G (M40) (amino acids 1-28 of SEQ ID NO:40); D AGPH VH YGWGDPIRLRHL YT S G (M74-R) (amino acids 2-24 of SEQ ID NO:74);
  • VH YGWGDPIRLRHL YT S G (M75-R) (amino acids 2-19 of SEQ ID NO:75);
  • RLRHLYTSG (M77-R) (amino acids 2-10 of SEQ ID NO:77);
  • RHPIPD S SPLLQF GWGDPIRLRHL YT SG (amino acids 1-28 of SEQ ID NO:9);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (amino acids 1-29 of SEQ ID NO: 12); RHPIPD S SPHVH YGWGDPIRLRHL YT S G (M10) (amino acids 1-28 of SEQ ID NO: 10); RPLAFSDAGPLLQFGGQVRLRHLYTSG (M13) (amino acids 1-27 of SEQ ID NO: 13); RHPIPD S SPHVHYGGQ VRLRHL YT SG (M14) (amino acids 1-26 of SEQ ID NO: 14); RPLAFSDAGPHVHYGGDIRLRHLYTSG (M43) amino acids 1-27 of SEQ ID NO:43); or RDSSPLLQFGGQ VRLRHL YTSG (M6) (amino acids 1-22 of SEQ ID NO:6);
  • amino terminal R residue may be deleted.
  • the peptide comprises or consists of any of:
  • HPIPDS SPLLQFGGQ VRLRHL YTSG (M5-R) (amino acids 1-25 of SEQ ID NO: 160);
  • DSSPLLQFGGQ VRLRHL YTSG (M6-R) (amino acids 2-22 of SEQ ID NO: 6);
  • RPL AFSD S SPLLQFGGQ VRLRHL YT SG (amino acids 1-27 of SEQ ID NO: 7);
  • HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (amino acids 2-26 of SEQ ID NO: 8);
  • HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (amino acids 2-28 of SEQ ID NO:9);
  • HPIPD S SPHVHYGWGDPIRLRHLYT SG (M10-R) (amino acids 2-28 of SEQ ID NO: 10); RPLAFSDAGPLLQWGDPIRLRHLYTSG (Ml 1) (amino acids 1-27 of SEQ ID NO: 11);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12);
  • RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1-27 of SEQ ID NO: 13);
  • HPIPDSSPHVHYGGQ VRLRHL YTSG (M14-R) (amino acids 2-26 of SEQ ID NO: 14);
  • RPLAFSDAGPHVHYGGQ VRLRHL YTSG (Ml 5) (amino acids 1-27 of SEQ ID NO: 15);
  • RPLAFSDAGPHVHWGDPIRLRHLYTSG (Ml 6) (amino acids 1-27 of SEQ ID NO: 16);
  • RPLAFSDAGPHVGWGDPIRLRHLYTSG (Ml 7) (amino acids 1-27 of SEQ ID NO: 17);
  • RPLAFSDAGPHYGWGDPIRLRHLYTSG (Ml 8) (amino acids 1-27 of SEQ ID NO: 18);
  • RPLAFSDAGPVYGWGDPIRLRHLYTSG (Ml 9) (amino acids 1-27 of SEQ ID NO: 19);
  • RPLAFSDAGPVHGWGDPIRLRHLYTSG (M20) (amino acids 1-27 of SEQ ID NO:20);
  • RPLAFSDAGPVHYWGDPIRLRHLYTSG (M21) (amino acids 1-27 of SEQ ID NO:21);
  • RPLAFSDAGPHVHGWGDPIRLRHLYTSG (M22) (amino acids 1-27 of SEQ ID NO: 22); RPLAFSDAGPHHGWGDPIRLRHLYTSG (M23) (amino acids 1-27 of SEQ ID NO:23);
  • RPLAFSDAGPHHYWGDPIRLRHLYTSG (M24) (amino acids 1-27 of SEQ ID NO:24);
  • RPLAFSDAGPHVYWGDPIRLRHLYTSG (M25) (amino acids 1-27 of SEQ ID NO:25);
  • RPLAFSDSSPHVHWGDPIRLRHLYTSG (M27) (amino acids 1-27 of SEQ ID NO:27);
  • RPLAFSDAGPHVWGDPIRLRHLYTSG (M28) (amino acids 1-26 of SEQ ID NO:28);
  • RPLAFSDAGPHVHYWGDPIRLRHLYTSG (amino acids 1-28 of SEQ ID NO: 29); RPLAFSDAGPHVHYAWGDPIRLRHLYTSG (M30) (amino acids 1-29 of SEQ ID NO: 30); RHPIPDSSPLLQFGAQVRLRHLYTSG (M31) (amino acids 1-26 of SEQ ID NO:31); RHPIPDSSPLLQFGDQVRLRHLYTSG (M32) (amino acids 1-26 of SEQ ID NO:32);
  • RHPIPDS SPLLQFGPQVRLRHLYTSG (M33) (amino acids 1-26 of SEQ ID NO:33);
  • RHPIPDSSPLLQFGGAVRLRHLYTSG (amino acids 1-26 of SEQ ID NO:34);
  • RHPIPDSSPLLQFGGEVRLRHLYTSG (M35) (amino acids 1-26 of SEQ ID NO:35);
  • RHPIPDSSPLLQFGGNVRLRHLYTSG (amino acids 1-26 of SEQ ID NO:36);
  • RHPIPDSSPLLQFGGQARLRHLYTSG (M37) (amino acids 1-26 of SEQ ID NO:37);
  • RHPIPDS SPLLQFGGQIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 38);
  • RHPIPDS SPLLQFGGQTRLRHLYTSG (M39) (amino acids 1-26 of SEQ ID NO:39);
  • RHPIPDSSPLLQFGWGQPVRLRHLYTSG (amino acids 1-28 of SEQ ID NO:40);
  • DAGPHVHYGWGDPIRLRHLYTSG (M74-R) (amino acids 2-24 of SEQ ID NO:74);
  • VHYGWGDPIRLRHLYTSG (M75-R) (amino acids 2-19 of SEQ ID NO:75);
  • RLRHLYTSG (M77-R) (amino acids 2-10 of SEQ ID NO:77);
  • RHPIPDSSPLLQFGWGDPIRLRHLYTSG (M9) (amino acids 1-28 of SEQ ID NO:9);
  • RHPIPDSSPLLQWGDPIRLRHLYTSG (amino acids 1-26 of SEQ ID NO: 8);
  • RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (Ml 2) (amino acids 1-29 of SEQ ID NO: 12);
  • RPLAFSDAGPLLQFGGQVRLRHLYTSG (Ml 3) (amino acids 1-27 of SEQ ID NO: 13);
  • RPLAFSDAGPHVHYGGDIRLRHLYTSG (M43) amino acids 1-27 of SEQ ID NO:43); or RDSSPLLQFGGQVRLRHLYTSG (M6) (amino acids 1-22 of SEQ ID NO:6).
  • the peptide comprise one of the foregoing sequences.
  • the peptide consists of one of the foregoing sequences.
  • the peptide comprises a C-terminal region comprising a portion of SEQ ID NO: 99 (FGF19), the C-terminal region having a first amino acid position and a last amino acid position,
  • the C-terminal region comprises amino acid residues 16-29 of SEQ ID NO:99 (FGF19), WGDPIRLRHLYTSG (SEQ ID NO: 169), wherein the W residue corresponds to the first amino acid position of the C-terminal region.
  • a peptide sequence comprises or consists of:
  • a peptide sequence comprises or consists of:
  • SFEK (M69) (SEQ ID NO: 69), or a subsequence or fragment thereof.
  • the peptide comprises or consists of:
  • RD S SPL VHYGWGDPIRLRHLYTS GPHGL S S CFLRIRADGVVDC ARGQ S AHSLLEIKAV ALRT VAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQ RQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSP SFEK (M200) (SEQ ID NO: 197); or a subsequence or fragment thereof.
  • the N- terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • F GLVTGLEAVRSPSFEK (M202) (SEQ ID NO: 199); or a subsequence or fragment thereof.
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • AVRSPSFEK (M203) (SEQ ID NO:200); or a subsequence or fragment thereof.
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • AVRSPSFEK (M205) (SEQ ID NO:202); or a subsequence or fragment thereof.
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • GLEAVRSPSFEK (M206) (SEQ ID NO:203); or a subsequence or fragment thereof.
  • the N-terminal R residue is deleted.
  • the peptide comprises or consists of:
  • the peptide is a variant peptide designated M139. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 193. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 193. In some embodiments, the peptide is a variant peptide designated Ml 40. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 194. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 194. In some embodiments, the peptide is a variant peptide designated M141. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 195.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 195. In some embodiments, the peptide is a variant peptide designated Ml 60. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 196. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 196. In some embodiments, the peptide is a variant peptide designated M200. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 197. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 197. In some embodiments, the peptide is a variant peptide designated M201.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide is a variant peptide designated M202. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 199. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 199. In certain embodiments, the peptide is a variant peptide designated M203. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 200.
  • the peptide consists of an amino acid sequence set forth in SEQ ID NO: 200. In some embodiments, the peptide is a variant peptide designated M204. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:201. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 201. In another embodiment, the peptide is a variant peptide designated M205. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:202. In other embodiments, the peptide is a variant peptide designated M206.
  • the peptide comprises an amino acid sequence set forth in SEQ ID NO:203. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO: 203. In yet other embodiments, the peptide is a variant peptide designated M207. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 204. In other embodiments, the peptide consists of an amino acid sequence set forth in SEQ ID NO:204.
  • Peptide sequences provided herein additionally include those with reduced or absent induction or formation of HCC compared to FGF 19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence at amino acids 16-20 of FGF 19.
  • Peptide sequences provided herein also include those with greater glucose lowering activity compared to FGF 19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID
  • Peptide sequences provided herein moreover include those with less lipid (e.g., triglyceride, cholesterol, non-HDL or HDL) increasing activity compared to FGF19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO: 178), WGDAI (SEQ ID NO: 179), WGDPA (SEQ ID NO: 180), WDPI (SEQ ID NO: 181), WGDI (SEQ ID NO: 182), WGDP (SEQ ID NO: 183) or FGDPI (SEQ ID NO: 184) substituted for the WGDPI (SEQ ID NO: 170) sequence
  • the number of amino acids or residues in a peptide sequence provided herein will total less than about 250 (e.g., amino acids or mimetics thereof).
  • the number of residues comprise from about 20 up to about 200 residues (e.g., amino acids or mimetics thereof).
  • the number of residues comprise from about 50 up to about 200 residues (e.g., amino acids or mimetics thereof).
  • the number of residues comprise from about 100 up to about 195 residues (e.g., amino acids or mimetics thereof) in length.
  • Amino acids or residues can be linked by amide or by non-natural and non-amide chemical bonds including, for example, those formed with glutaraldehyde, N- hydroxysuccinimide esters, bifunctional maleimides, or N, N'-dicyclohexylcarbodiimide (DCC).
  • Non-amide bonds include, for example, ketomethylene, aminomethylene, olefin, ether, thioether and the like (see, e.g., Spatola in Chemistry and Biochemistry of Amino Acids, Peptides and Proteins. Vol. 7, pp 267-357 (1983), "Peptide and Backbone Modifications," Marcel Decker, NY).
  • a peptide provided herein includes a portion of a FGF 19 sequence and a portion of a FGF21 sequence, the two portions need not be joined to each other by an amide bond, but can be joined by any other chemical moiety or conjugated together via a linker moiety.
  • the treatment peptides provided herein also include
  • certain exemplified variant peptides have FGF 19 C-terminal sequence, PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKM QGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPML PMVPEEPEDLRGHLE SDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK (SEQ ID NO: 188) at the C-terminal portion, e.g., following the "TSG" amino acid residues of the variant.
  • certain exemplified variant peptides for example, those having all or a portion of FGF21 sequence at the amino-terminus, have an "R" residue positioned at the N-terminus, which can be omitted.
  • certain exemplified variant peptides include an "M” residue positioned at the N-terminus, which can be appended to or further substituted for an omitted residue, such as an "R” residue.
  • peptide sequences at the N-terminus include any of: RDSS (SEQ ID NO: 115), DSS, MDSS (SEQ ID NO: 116) or MRDSS (SEQ ID NO: 117).
  • peptide sequences include those with the following residues at the N-terminus: MDSSPL (SEQ ID NO: 119), MSDSSPL (SEQ ID NO: 120) (cleaved to SDSSPL(SEQ ID NO: 112)) and MSSPL (SEQ ID NO: 113) (cleaved to SSPL (SEQ ID NO: 114)).
  • the "peptide,” “polypeptide,” and “protein” sequences provided herein include subsequences, variants and modified forms of the FGF19 and FGF21 variants and subsequences listed in Tables 1-11 and Sequence Listing, and the
  • FGF19/FGF21 fusions and chimeras listed in Tables 1-11 and Sequence Listing so long as the subsequence, variant or modified form (e.g., fusion or chimera) retains at least a detectable activity or function, e.g., glucose lowering activity and/or modulation of bile acid homeostasis.
  • a detectable activity or function e.g., glucose lowering activity and/or modulation of bile acid homeostasis.
  • modified peptide sequences, nucleic acids and other compositions may have greater or less activity or function, or have a distinct function or activity compared with a reference unmodified peptide sequence, nucleic acid, or other composition, or may have a property desirable in a protein formulated for therapy (e.g. serum half-life), to elicit antibody for use in a detection assay, and/or for protein purification.
  • a protein formulated for therapy e.g. serum half-life
  • a peptide sequence provided herein can be modified to increase serum half-life, to increase in vitro and/or in vivo stability of the protein, etc.
  • Particular examples of such subsequences, variants and modified forms of the peptide sequences exemplified herein ⁇ e.g., a peptide sequence listed in the Sequence Listing or Tables 1-11) include substitutions, deletions and/or insertions/additions of one or more amino acids, to or from the amino-terminus, the carboxy-terminus or internally.
  • substitutions, deletions and/or insertions/additions of one or more amino acids to or from the amino-terminus, the carboxy-terminus or internally.
  • One example is a substitution of an amino acid residue for another amino acid residue within the peptide sequence.
  • the number of residues substituted, deleted or inserted/added are one or more amino acids (e.g., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100- 110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200- 225, 225-250, or more) of a peptide sequence.
  • amino acids e.g., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100- 110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200- 225, 225-250, or more
  • a FGF19 or FGF21 sequence can have few or many amino acids substituted, deleted or inserted/added ⁇ e.g., 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140- 150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more).
  • a FGF19 amino acid sequence can include or consist of an amino acid sequence of about 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120- 130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250, or more amino acids from FGF21; or a FGF21 amino acid or sequence can include or consist of an amino acid sequence of about 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180- 190, 190-200, 200-225, 225-250, or more amino acids from FGF19.
  • substitutions include substituting a D residue for an L-residue. Accordingly, although residues are listed in the L-isomer configuration, D-amino acids at any particular or all positions of the peptide sequences provided herein are included, unless a D- isomer leads to a sequence that has no detectable or measurable function.
  • a "conservative substitution” is a replacement of one amino acid by a biologically, chemically or structurally similar residue.
  • Biologically similar means that the substitution is compatible with a biological activity, e.g., activity that improves PBC and/or the manifestations thereof.
  • Structurally similar means that the amino acids have side chains with similar length, such as alanine, glycine and serine, or having similar size, or the structure of a first, second or additional peptide sequence is maintained.
  • Chemical similarity means that the residues have the same charge or are both hydrophilic and hydrophobic.
  • Particular examples include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine, for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, serine for threonine, etc.
  • Routine assays can be used to determine whether a subsequence, variant or modified form has activity, e.g., activity that improves PBC and/or the manifestations thereof.
  • Particular examples of subsequences, variants and modified forms of the peptide sequences exemplified herein have 50%-60%, 60%-70%, 70%-75%, 75%-80%, 80%-85%, 85%- 90%, 90%-95%, or 96%, 97%, 98%, or 99% identity to a reference peptide sequence.
  • identity and “homology” and grammatical variations thereof mean that two or more referenced entities are the same. Thus, where two amino acid sequences are identical, they have the identical amino acid sequence.
  • “Areas, regions or domains of identity” mean that a portion of two or more referenced entities are the same. Thus, where two amino acid sequences are identical or homologous over one or more sequence regions, they share identity in those regions.
  • FASTA e.g., FASTA2 and FASTA3
  • SSEARCH sequence comparison programs are also used to quantitate the extent of identity (Pearson et al, Proc. Natl. Acad. Sci. USA 85:2444 (1988); Pearson, Methods Mol Biol. 132: 185 (2000); and Smith et al, J. Mol. Biol. 147: 195 (1981)).
  • Programs for quantitating protein structural similarity using Delaunay-based topological mapping have also been developed (Bostick et al, Biochem Biophys Res Commun. 304:320 (2003)).
  • an “amino acid” or “residue” includes conventional alpha- amino acids as well as beta-amino acids; alpha, alpha disubstituted amino acids; and N- substituted amino acids, wherein at least one side chain is an amino acid side chain moiety as defined herein.
  • An “amino acid” further includes N-alkyl alpha-amino acids, wherein the N- terminus amino group has a Ci to C 6 linear or branched alkyl substituent.
  • amino acid therefore includes stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids (e.g., by glycosylation, phosphorylation, ester or amide cleavage, etc.), enzymatically modified or synthesized amino acids, derivatized amino acids, constructs or structures designed to mimic amino acids, amino acids with a side chain moiety modified, derivatized from naturally occurring moieties, or synthetic, or not naturally occurring, etc. Modified and unusual amino acids are included in the peptide sequences provided herein (see, for example, in Synthetic Peptides: A User's Guide; Hruby et al, Biochem. J. 268:249 (1990); and Toniolo C, Int. J. Peptide Protein Res. 35:287 (1990)).
  • amino acid side chain moiety includes any side chain of any amino acid, as the term “amino acid” is defined herein. This therefore includes the side chain moiety in naturally occurring amino acids. It further includes side chain moieties in modified naturally occurring amino acids as set forth herein and known to one of skill in the art, such as side chain moieties in stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids, enzymatically modified or synthesized amino acids, derivatized amino acids, constructs or structures designed to mimic amino acids, etc. For example, the side chain moiety of any amino acid disclosed herein or known to one of skill in the art is included within the definition.
  • a "derivative of an amino acid side chain moiety" is included within the definition of an amino acid side chain moiety.
  • a single amino acid including stereoisomers and modifications of naturally occurring protein amino acids, non-protein amino acids, post-translationally modified amino acids, enzymatically-synthesized amino acids, non-naturally occurring amino acids including derivatized amino acids, an alpha, alpha disubstituted amino acid derived from any of the foregoing (i.e., an alpha, alpha disubstituted amino acid, wherein at least one side chain is the same as that of the residue from which it is derived), a beta-amino acid derived from any of the foregoing (i.e., a beta-amino acid which, other than for the presence of a beta-carbon, is the same as the residue from which it is derived) etc., including all of the foregoing can be referred to herein as a "residue.”
  • Suitable substituents, in addition to the side chain moiety of the alpha- amino acid include Ci to C 6 linear or branched alkyl.
  • Aib is an example of an alpha, alpha disubstituted amino acid. While alpha, alpha disubstituted amino acids can be referred to using conventional L- and D-isomeric references, it is to be understood that such references are for convenience, and that where the substituents at the alpha-position are different, such amino acid can interchangeably be referred to as an alpha, alpha disubstituted amino acid derived from the L- or D-isomer, as appropriate, of a residue with the designated amino acid side chain moiety.
  • (S)-2-Amino-2-methyl-hexanoic acid can be referred to as either an alpha, alpha disubstituted amino acid derived from L-Nle (norleucine) or as an alpha, alpha disubstituted amino acid derived from D-Ala.
  • Aib can be referred to as an alpha, alpha
  • alpha disubstituted amino acid derived from Ala. Whenever an alpha, alpha disubstituted amino acid is provided, it is to be understood as including all (R) and (S) configurations thereof.
  • N- substituted amino acid includes any amino acid wherein an amino acid side chain moiety is covalently bonded to the backbone amino group, optionally where there are no substituents other than H in the alpha-carbon position.
  • Sarcosine is an example of an N- substituted amino acid.
  • sarcosine can be referred to as an N-substituted amino acid derivative of Ala, in that the amino acid side chain moiety of sarcosine and Ala is the same, i.e., methyl.
  • covalent modifications of the peptide sequences including subsequences, variants and modified forms of the peptide sequences exemplified herein are provided.
  • An exemplary type of covalent modification includes reacting targeted amino acid residues with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues of the peptide.
  • Derivatization with bifunctional agents is useful, for instance, for cross-linking peptide to a water-insoluble support matrix or surface for use in the method for purifying anti-peptide antibodies, and vice-versa.
  • cross linking agents include, e.g., l,l-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-l,8-octane and agents such as methyl-3-[(p-azidophenyl)dithio] propioimidate.
  • Exemplified peptide sequences, and subsequences, variants and modified forms of the peptide sequences exemplified herein can also include alterations of the backbone for stability, derivatives, and peptidomimetics.
  • peptidomimetic includes a molecule that is a mimic of a residue (referred to as a "mimetic"), including but not limited to piperazine core molecules, keto-piperazine core molecules and diazepine core molecules.
  • an amino acid mimetic of a peptide sequence provided herein includes both a carboxyl group and amino group, and a group corresponding to an amino acid side chain, or in the case of a mimetic of Glycine, no side chain other than hydrogen.
  • these would include compounds that mimic the sterics, surface charge distribution, polarity, etc. of a naturally occurring amino acid, but need not be an amino acid, which would impart stability in the biological system.
  • Proline may be substituted by other lactams or lactones of suitable size and substitution;
  • Leucine may be substituted by an alkyl ketone, N-substituted amide, as well as variations in amino acid side chain length using alkyl, alkenyl or other substituents, others may be apparent to the skilled artisan.
  • the essential element of making such substitutions is to provide a molecule of roughly the same size and charge and configuration as the residue used to design the molecule.
  • binding when used in reference to a peptide sequence, means that the peptide sequence interacts at the molecular level. Specific and selective binding can be distinguished from non-specific binding using assays known in the art ⁇ e.g., competition binding, immunoprecipitation, ELISA, flow cytometry, Western blotting).
  • Peptides and peptidomimetics can be produced and isolated using methods known in the art. Peptides can be synthesized, in whole or in part, using chemical methods (see, e.g., Caruthers (1980). Nucleic Acids Res. Symp. Ser. 215; Horn (1980); and Banga, A.K.,
  • Peptide synthesis can be performed using various solid-phase techniques (see, e.g., Roberge Science 269:202 (1995); Merrifield, Methods
  • Enzymol. 289:3 (1997)) and automated synthesis may be achieved, e.g., using the ABI 431 A Peptide Synthesizer (Perkin Elmer) in accordance with the manufacturer's instructions.
  • Peptides and peptide mimetics can also be synthesized using combinatorial methodologies. Synthetic residues and polypeptides incorporating mimetics can be synthesized using a variety of procedures and methodologies known in the art (see, e.g., Organic Syntheses Collective
  • Modified peptides can be produced by chemical modification methods (see, for example, Belousov, Nucleic Acids Res. 25:3440 (1997); Frenkel, Free Radic. Biol. Med. 19:373 (1995); and Blommers, Biochemistry 33 :7886 (1994)).
  • Peptide sequence variations, derivatives, substitutions and modifications can also be made using methods such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR-based mutagenesis. Site-directed mutagenesis (Carter et al, Nucl. Acids Res., 13 :4331 (1986); Zoller et al, Nucl. Acids Res. 10:6487 (1987)), cassette
  • a "synthesized" or “manufactured” peptide sequence is a peptide made by any method involving manipulation by the hand of man. Such methods include, but are not limited to, the aforementioned, such as chemical synthesis, recombinant DNA technology, biochemical or enzymatic fragmentation of larger molecules, and combinations of the foregoing.
  • Peptide sequences provided herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences ⁇ e.g., sequences listed in the Sequence Listing or Tables 1-11), can also be modified to form a chimeric molecule.
  • sequences listed in the Sequence Listing or Tables 1-11 can also be modified to form a chimeric molecule.
  • peptide sequences that include a heterologous domain. Such domains can be added to the amino-terminus or at the carboxyl-terminus of the peptide sequence. Heterologous domains can also be positioned within the peptide sequence, and/or alternatively flanked by FGF19 and/or FGF21 derived amino acid sequences.
  • peptide also includes dimers or multimers (oligomers) of peptides.
  • dimers or multimers (oligomers) of the exemplified peptide sequences are provided herein, as well as subsequences, variants and modified forms of the exemplified peptide sequences, including sequences listed in the Sequence Listing or Tables 1-11.
  • a peptide sequence provided herein comprises an amino acid sequence set forth in Table 1. In other embodiments, a peptide sequence provided herein consists of an amino acid sequence set forth in Table 1. Table 1
  • RHPIPD SPHVHYGWGDPIRLRHL YT SGPHGL S SCFLRIRADGVVDC ARGQ SAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEE EIRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEE PEDLRGHLESDMF S SPLETD SMDPFGL VTGLE AVRSP SFEK
  • RPL AF SD AGP VH YWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLEAVRSP SFEK
  • RPLAF SD AGPHH YWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE AVRSP SFEK
  • RPLAF SD SPL VHWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE AVRSP SFEK
  • HPIPD SPLLQWGDPIRLRHL YT SGPHGLS SCFLRIRADGVVDC ARGQ S AHS LLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRP DGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEPEDL RGHLESDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK
  • RPLAF SPLLQFGGQVRLRHL YTSGPHGLS SCFLRIRADGVVDC ARGQS AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE A VRSP SFEK
  • RPL AF SD AGP VH YWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE A VRSP SFEK
  • RPL AF SD AGPHHGWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE A VRSP SFEK
  • RPL AF SD S SPL VHWGDPIRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE AVRSP SFEK
  • RPL AF SD AGPHLQ WGDPIRLRHL YT S GPHGL S S CFLRIRADGV VD C ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE AVRSP SFEK
  • RVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIK AVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYN VYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEPEDLRGHL ESDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK
  • RPL AF SD SPLVHYGWGDPIRLRHL YT SGPHGL S SCFLRIRADGVVDC ARG QSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFE EEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPE EPEDLRGHLE SDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK
  • RHPIPD S SPLLQFGGQ TRLRHL YT S GPHGL S S CFLRIRADGV VDC ARGQ S AH SLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRP DGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEPEDL RGHLESDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK
  • D SPLLQFGGQ VRLRHL YT SGPHGL
  • SCFLRIRADGVVDC ARGQ SAHSLLEI KAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGY NVYRSEKHRLPVSLSSAKQRQLYK
  • RGFLPLSHFLPMLPMVPEEPEDLRGH LE SDMF S SPLETD SMDPFGL VTGLEAVRSPSFEK
  • FIPIPD S SPHVH YGWGDPIRLRHL YT S GPHGL S S CFLRIR ADGVVDC ARGQ S AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEE IRPDGYNVYRSEKHRLPVSLSSAKQRQLYK RGFLPLSHFLPMLPMVPEEP EDLRGHLESDMF S SPLETD SMDPFGL VTGLE A VRSP SFEK
  • RPLAF SD SPLVHYGWGDPIRLRHLYT SGPHGL S SCFLRIRADGVVDC ARG QSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFE EEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPE EPEDLRGHLE SDMF S SPLETD SMDPF GL VTGLE A VRSP SFEK
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 1. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:2. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:3. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:4. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:5. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:6. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:7.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:8. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:9. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 10. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 11. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 12. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 13. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 14. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 15.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 16. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 17. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 18. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 19. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:20. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:21. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:22. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:23.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:24. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:25. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:26. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:27. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:28. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:29. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:30.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:31. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:32. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:33. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:34. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:35. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:36. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:37.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:38. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:39. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:40. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:41. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:42. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:43. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:44.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:45. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:46. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:47. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:48. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:49. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:50. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:51.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:52. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:53. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:54. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:55. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:56. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:57. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 58.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:59. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:60. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:61. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:62. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:63. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:64. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:65.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:66. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:67. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:68. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:69. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:70. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:71. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:72.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:73. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:74. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:75. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:76. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:77. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:78. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:79.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:80. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:81. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:82. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:83. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:84. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:85. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:86.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:87. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:88. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:89. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:90. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:91. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:92. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:93.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:94. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:95. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:96. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:97. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:98. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 138. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 139.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 140. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 141. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 142. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 143. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 144. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 145. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 146.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 147. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 148. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 149. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 150. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 151. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 152. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 153.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 154. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 155. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 156. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 157. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 158. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 159. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 160.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 161. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 162. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 163. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 164. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 165. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 166. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 167.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 168. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 192. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 193. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 194. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 195. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 196. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 197.
  • the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO: 199. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:200. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:201. In other embodiments, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:202. In one embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:203. In another embodiment, the peptide sequence comprises an amino acid sequence set forth in SEQ ID NO:204. In certain embodiments of the various peptide sequences provided herein, the R residue at the N-terminus is deleted.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 1. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:2. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:3. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:4. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:5. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:6. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:7.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:8. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:9. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 10. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 11. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 12. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 13. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 14.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 15. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 16. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 17. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 18. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 19. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:20. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:21.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:22. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:23. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:24. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:25. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:26. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:27. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:28.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:29. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:30. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:31. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:32. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:33. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:34. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:35.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:36. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:37. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:38. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:39. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:40. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:41. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:42.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:43. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:44. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:45. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:46. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:47. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:48. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:49.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:50. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:51. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:52. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:53. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:54. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:55. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:56.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:57. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 58. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:59. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:60. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:61. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:62. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:63.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:64. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:65. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:66. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:67. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:68. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:69. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:70.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:71. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:72. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:73. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:74. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:75. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:76. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:77.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:78. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:79. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:80. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:81. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:82. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:83. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:84.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:85. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:86. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:87. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:88. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:89. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:90. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:91.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:92. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:93. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:94. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:95. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:96. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:97. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:98.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 138. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 139. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 140. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 141. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 142. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 143. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 144.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 145. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 146. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 147. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 148. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 149. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 150. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 151.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 152. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 153. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 154. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 155. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 156. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 157. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 158.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 159. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 160. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 161. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 162. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 163. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 164. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 165.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 166. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 167. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 168. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 192. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 193. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 194. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 195.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 196. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 197. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 198. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO: 199. In one embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:200. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:201. In other embodiments, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:202.
  • the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:203. In another embodiment, the peptide sequence consists of an amino acid sequence set forth in SEQ ID NO:204. In certain embodiments of the various peptide sequences provided herein, the R residue at the N-terminus is deleted.
  • Improvements of physical properties include, for example, modulating immunogenicity; methods of increasing solubility, bioavailability, serum half-life, and/or therapeutic half-life; and/or modulating biological activity. Certain modifications may also be useful to, for example, raise of antibodies for use in detection assays (e.g., epitope tags) and to provide for ease of protein purification. Such improvements must generally be imparted without adversely impacting the bioactivity of the treatment modality and/or increasing its
  • Pegylation of is one particular modification contemplated herein, while other modifications include, but are not limited to, glycosylation (N- and O-linked); polysialylation; albumin fusion molecules comprising serum albumin (e.g., human serum albumin (HSA), cyno serum albumin, or bovine serum albumin (BSA)); albumin binding through, for example a conjugated fatty acid chain (acylation); and Fc-fusion proteins.
  • serum albumin e.g., human serum albumin (HSA), cyno serum albumin, or bovine serum albumin (BSA)
  • Fc-fusion proteins e.g., Fc-fusion proteins.
  • PEG-conjugated biomolecules have been shown to possess clinically useful properties, including better physical and thermal stability, protection against susceptibility to enzymatic degradation, increased solubility, longer in vivo circulating half-life and decreased clearance, reduced immunogenicity and antigenicity, and reduced toxicity.
  • pegylation itself may enhance activity.
  • PEGs suitable for conjugation to a polypeptide sequence are generally soluble in water at room temperature, and have the general formula R(0-CH 2 -CH 2 ) n O-R, where R is hydrogen or a protective group such as an alkyl or an alkanol group, and where n is an integer from 1 to 1000. When R is a protective group, it generally has from 1 to 8 carbons.
  • R is hydrogen or a protective group such as an alkyl or an alkanol group, and where n is an integer from 1 to 1000. When R is a protective group, it generally has from 1 to 8 carbons.
  • the PEG conjugated to the polypeptide sequence can be linear or branched. Branched PEG derivatives, "star-PEGs" and multi-armed PEGs are contemplated by the present disclosure.
  • a molecular weight of the PEG used in embodiments provided herein is not restricted to any particular range, and examples are set forth elsewhere herein; by way of example, certain embodiments have molecular weights between 500 Da and 20kDa, while other embodiments have molecular weights between 4kDa and lOkDa.
  • Such compositions can be produced by reaction conditions and purification methods know in the art. Cation exchange chromatography may be used to separate conjugates, and a fraction is then identified which contains the conjugate having, for example, the desired number of PEGs attached, purified free from unmodified protein sequences and from conjugates having other numbers of PEGs attached.
  • Pegylation most frequently occurs at the alpha amino group at the N-terminus of the polypeptide, the epsilon amino group on the side chain of lysine residues, and the imidazole group on the side chain of histidine residues. Since most recombinant polypeptides possess a single alpha and a number of epsilon amino and imidazole groups, numerous positional isomers can be generated depending on the linker chemistry.
  • PEG may be bound to a polypeptide provided herein via a terminal reactive group (a "spacer” or "linker") which mediates a bond between the free amino or carboxyl groups of one or more of the polypeptide sequences and polyethylene glycol.
  • a terminal reactive group a "spacer” or "linker”
  • the PEG having the spacer which may be bound to the free amino group includes N-hydroxysuccinylimide polyethylene glycol which may be prepared by activating succinic acid ester of polyethylene glycol with N- hydroxysuccinylimide.
  • Another activated polyethylene glycol which may be bound to a free amino group is 2,4-bis(0-methoxypolyethyleneglycol)-6-chloro-s-triazine, which may be prepared by reacting polyethylene glycol monomethyl ether with cyanuric chloride.
  • the activated polyethylene glycol which is bound to the free carboxyl group includes
  • Conjugation of one or more of the polypeptide sequences provided herein to PEG having a spacer may be carried out by various conventional methods.
  • the conjugation reaction can be carried out in solution at a pH of from 5 to 10, at temperature from 4°C to room temperature, for 30 minutes to 20 hours, utilizing a molar ratio of reagent to protein of from 4: 1 to 30: 1.
  • the reaction is terminated by acidifying the reaction mixture and freezing at, e.g., -20°C.
  • Pegylation of various molecules is discussed in, for example, U. S. Pat. Nos. 5,252,714; 5,643,575; 5,919,455; 5,932,462; and 5,985,263.
  • PEG mimetics also provided herein are uses of PEG mimetics. Recombinant PEG mimetics have been developed that retain the attributes of PEG (e.g., enhanced serum half- life) while conferring several additional advantageous properties.
  • simple polypeptide chains (comprising, for example, Ala, Glu, Gly, Pro, Ser and Thr) capable of forming an extended conformation similar to PEG can be produced recombinantly already fused to the peptide or protein drug of interest (e.g., XTEN technology; Amunix; Mountain View, CA).
  • XTEN technology e.g., XTEN technology; Amunix; Mountain View, CA.
  • established molecular biology techniques enable control of the side chain composition of the polypeptide chains, allowing optimization of immunogenicity and manufacturing properties.
  • glycosylation is meant to broadly refer to the enzymatic process by which glycans are attached to proteins, lipids or other organic molecules.
  • the use of the term “glycosylation” herein is generally intended to mean adding or deleting one or more
  • carbohydrate moieties (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that may or may not be present in the native sequence.
  • the phrase includes qualitative changes in the glycosylation of the native proteins involving a change in the nature and proportions of the various carbohydrate moieties present.
  • Glycosylation can dramatically affect the physical properties (e.g., solubility) of polypeptides and can also be important in protein stability, secretion, and subcellular
  • Glycosylated polypeptides may also exhibit enhanced stability or may improve one or more pharmacokinetic properties, such as half-life.
  • solubility improvements can, for example, enable the generation of formulations more suitable for pharmaceutical
  • Addition of glycosylation sites can be accomplished by altering the amino acid sequence.
  • the alteration to the polypeptide may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues (for O-linked glycosylation sites) or asparagine residues (for N-linked glycosylation sites).
  • the structures of N-linked and O-linked oligosaccharides and the sugar residues found in each type may be different.
  • One type of sugar that is commonly found on both is N-acetylneuraminic acid (hereafter referred to as sialic acid).
  • sialic acid is usually the terminal residue of both N-linked and O-linked oligosaccharides and, by virtue of its negative charge, may confer acidic properties to the glycoprotein.
  • a particular embodiment comprises the generation and use of N-glycosylation variants.
  • polypeptide sequences provided herein may optionally be altered through changes at the nucleic acid level, particularly by mutating the nucleic acid encoding the polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
  • DHFR Dihydrofolate reductase
  • CHO Chinese Hamster Ovary
  • polysialylation the conjugation of polypeptides to the naturally occurring, biodegradable a-(2 ⁇ 8) linked polysialic acid (“PSA") in order to improve the polypeptides' stability and in vivo pharmacokinetics.
  • PSA biodegradable a-(2 ⁇ 8) linked polysialic acid
  • Albumin Fusion Additional suitable components and molecules for conjugation include albumins such as human serum albumin (HSA), cyno serum albumin, and bovine serum albumin (BSA).
  • HSA human serum albumin
  • BSA bovine serum albumin
  • albumin is conjugated to a drug molecule (e.g., a polypeptide described herein) at the carboxyl terminus, the amino terminus, both the carboxyl and amino termini, and internally (see, e.g., US Pat Nos. 5,876,969 and 7,056,701).
  • a drug molecule e.g., a polypeptide described herein
  • albumin in the HSA-drug molecule conjugates embodiments provided herein, various forms of albumin may be used, such as albumin secretion pre-sequences and variants thereof, fragments and variants thereof, and HSA variants. Such forms generally possess one or more desired albumin activities.
  • fusion proteins are provided herein comprising a polypeptide drug molecule fused directly or indirectly to albumin, an albumin fragment, an albumin variant, etc., wherein the fusion protein has a higher plasma stability than the unfused drug molecule and/or the fusion protein retains the therapeutic activity of the unfused drug molecule.
  • the indirect fusion is effected by a linker, such as a peptide linker or modified version thereof.
  • fusion of albumin to one or more polypeptides provided herein can, for example, be achieved by genetic manipulation, such that the nucleic acid coding for HSA, or a fragment thereof, is joined to the nucleic acid coding for the one or more polypeptide sequences.
  • albumin binding through a conjugated fatty acid chain is provided herein.
  • acylation and fusion proteins which comprise an albumin binding domain (ABD) polypeptide sequence and the sequence of one or more of the polypeptides described herein.
  • ABS albumin binding domain
  • Fusion of albumin to a peptide sequence can, for example, be achieved by genetic manipulation, such that the DNA coding for HSA (human serum albumin), or a fragment thereof, is joined to the DNA coding for a peptide sequence. Thereafter, a suitable host can be transformed or transfected with the fused nucleotide sequence in the form of, for example, a suitable plasmid, so as to express a fusion polypeptide.
  • the expression may be effected in vitro from, for example, prokaryotic or eukaryotic cells, or in vivo from, for example, a transgenic organism. In some embodiments, the expression of the fusion protein is performed in
  • mammalian cell lines for example, CHO cell lines.
  • dAbs are the smallest functional binding units of human antibodies (IgGs) and have favorable stability and solubility characteristics.
  • the technology entails a dAb(s) conjugated to HSA (thereby forming a "AlbudAb”; see, e.g., EP1517921B, WO2005/118642 and WO2006/051288) and a molecule of interest ⁇ e.g., a peptide sequence provided herein).
  • AlbudAbs are often smaller and easier to manufacture in microbial expression systems, such as bacteria or yeast, than current technologies used for extending the serum half-life of peptides. As HSA has a half-life of about three weeks, the resulting conjugated molecule improves the half-life.
  • Use of the dAb technology may also enhance the efficacy of the molecule of interest.
  • Additional suitable components and molecules for conjugation include, for example, thyroglobulin; tetanus toxoid; Diphtheria toxoid; polyamino acids such as poly(D-lysine:D- glutamic acid); VP6 polypeptides of rotaviruses; influenza virus hemagglutinin, influenza virus nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B virus core protein and surface antigen; or any combination of the foregoing.
  • thyroglobulin thyroglobulin
  • tetanus toxoid Diphtheria toxoid
  • polyamino acids such as poly(D-lysine:D- glutamic acid)
  • VP6 polypeptides of rotaviruses include influenza virus hemagglutinin, influenza virus nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B virus core
  • conjugation of one or more additional components or molecules at the N- and/or C-terminus of a polypeptide sequence such as another polypeptide (e.g., a polypeptide having an amino acid sequence heterologous to the subject polypeptide), or a carrier molecule is also contemplated.
  • another polypeptide e.g., a polypeptide having an amino acid sequence heterologous to the subject polypeptide
  • a carrier molecule e.g., an exemplary polypeptide sequence can be provided as a conjugate with another component or molecule.
  • a polypeptide may also be conjugated to large, slowly metabolized macromolecules such as proteins; polysaccharides, such as sepharose, agarose, cellulose, or cellulose beads; polymeric amino acids such as polyglutamic acid, or polylysine; amino acid copolymers;
  • inactivated virus particles inactivated virus particles
  • inactivated bacterial toxins such as toxoid from diphtheria, tetanus, cholera, or leukotoxin molecules
  • inactivated bacteria inactivated bacteria
  • dendritic cells dendritic cells
  • the amino- or carboxyl- terminus of a polypeptide sequence provided herein is fused with an immunoglobulin Fc region to form a fusion conjugate (or fusion molecule).
  • the immunoglobuling Fc region is a human Fc region. Fusion conjugates have been shown to increase the systemic half-life of
  • the half-life is increased as compared to the same polypeptide that is not fused to an immunoglobuling Fc region.
  • Fc binds to the neonatal Fc receptor (FcRn) in endothelial cells that line the blood vessels, and, upon binding, the Fc fusion molecule is protected from degradation and re-released into the circulation, keeping the molecule in circulation longer.
  • This Fc binding is believed to be the mechanism by which endogenous IgG retains its long plasma half-life.
  • More recent Fc- fusion technology links a single copy of a biopharmaceutical to the Fc region of an antibody to optimize the pharmacokinetic and pharmacodynamic properties of the biopharmaceutical as compared to traditional Fc-fusion conjugates.
  • biopharmaceutical linked to the Fc region of an antibody to improve pharmacokinetics, solubility, and production efficiency. More recent Fc-fusion technology links a single copy of a biopharmaceutical to the Fc region of an antibody to optimize the pharmacokinetic and pharmacodynamic properties of the biopharmaceutical as compared to traditional Fc-fusion conjugates.
  • provided herein is a fusion of M70 to a human antibody Fc fragment.
  • a fusion of M69 to a human antibody Fc fragment Such fusions can be useful in the treatment of bile acid related disorders and other metabolic disorders provided herein.
  • the Fc-fusion of M70 has a longer half-life.
  • the longer half-life of the Fc-fusion of M70 is as compared to M70 that is not an Fc-fusion.
  • the Fc-fusion of M69 has a longer half-life.
  • the longer half life of the Fc-fusion of M69 is as compared to M69 that is not an Fc-fusion. Such a long half-life makes these fusions suitable for once weekly, or less frequent dosing.
  • the Fc-fusion comprises a linker.
  • exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers.
  • the linker is (G) 4 S.
  • the linker is ((G) 4 S) n , where n is an integer of at least one.
  • the linker is ((G) 4 S) 2 .
  • Glycine and glycine-serine polymers are relatively unstructured, and therefore may serve as a neutral tether between components.
  • the glycine- serine polymer is (GS) n , where n is an integer of at least one. In some embodiments, the glycine- serine polymer is GSGGS n (SEQ ID NO: 129), where n is an integer of at least one. In some embodiments, the glycine-serine polymer is GGGS n (SEQ ID NO: 130), where n is an integer of at least one. In certain embodiments, the linker comprises an additional G residue at the N' terminus of SEQ ID NO: 130. In one embodiment, the linker is GGSG (SEQ ID NO: 131). In one embodiment, the linker is GGSGG (SEQ ID NO: 132).
  • the linker is GSGSG (SEQ ID NO: 133). In one embodiment, the linker is GSGGG (SEQ ID NO: 134). In one embodiment, the linker is GGGSG (SEQ ID NO: 189). In one embodiment, the linker is GSSSG (SEQ ID NO: 135).
  • Additional suitable components and molecules for conjugation include those suitable for isolation or purification.
  • Particular non-limiting examples include binding molecules, such as biotin (biotin-avidin specific binding pair), an antibody, a receptor, a ligand, a lectin, or molecules that comprise a solid support, including, for example, plastic or polystyrene beads, plates or beads, magnetic beads, test strips, and membranes.
  • cation exchange chromatography may be used to separate conjugates by charge difference, which effectively separates conjugates into their various molecular weights.
  • the cation exchange column can be loaded and then washed with -20 mM sodium acetate, pH -4, and then eluted with a linear (0 M to 0.5 M) NaCl gradient buffered at a pH from 3 to 5.5, such as at pH -4.5.
  • the content of the fractions obtained by cation exchange chromatography may be identified by molecular weight using conventional methods, for example, mass spectroscopy, SDS-PAGE, or other known methods for separating molecular entities by molecular weight.
  • a fraction is then identified which contains the conjugate having the desired number of PEGs attached, purified free from unmodified protein sequences and from conjugates having other numbers of PEGs attached.
  • a peptide sequence provided herein is linked to a chemical agent (e.g., an immunotoxin or chemotherapeutic agent), including, but are not limited to, a cytotoxic agent, including taxol, cytochalasin B, gramicidin D, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, and analogs or homologs thereof.
  • a chemical agent e.g., an immunotoxin or chemotherapeutic agent
  • a cytotoxic agent including taxol, cytochalasin B, gramicidin D, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, and analogs or homologs thereof.
  • Other chemical agents include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine); alkylating agents (e.g., mechlorethamine, carmustine and lomustine, cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cisplatin); antibiotics (e.g., bleomycin); and anti-mitotic agents (e.g., vincristine and vinblastine).
  • Cytotoxins can be conjugated to a peptide provided herein using linker technology known in the art and described herein.
  • suitable components and molecules for conjugation include those suitable for detection in an assay.
  • Particular non-limiting examples include detectable labels, such as a
  • radioisotope e.g. , I; S, P; P
  • an enzyme which generates a detectable product e.g., luciferase, ⁇ -galactosidase, horse radish peroxidase and alkaline phosphatase
  • a fluorescent protein e.g., a chromogenic protein, dye (e.g., fluorescein isothiocyanate); fluorescence emitting metals (e.g., 152 Eu); chemiluminescent compounds (e.g., luminol and acridinium salts);
  • bioluminescent compounds e.g., luciferin
  • fluorescent proteins Indirect labels include labeled or detectable antibodies that bind to a peptide sequence, where the antibody may be detected.
  • a peptide sequence provided herein is conjugated to a radioactive isotope to generate a cytotoxic radiopharmaceutical (radioimmunoconjugates) useful as a diagnostic or therapeutic agent.
  • radioactive isotopes include, but are not limited to, iodine 131 , indium 111 , yttrium 90 and lutetium 177 .
  • radioimmunoconjugates are known to the skilled artisan. Examples of radioimmunoconjugates that are commercially available include ibritumomab, tiuxetan, and tositumomab.
  • Linkers and their use have been described above. Any of the foregoing components and molecules used to modify the polypeptide sequences provided herein may optionally be conjugated via a linker. Suitable linkers include "flexible linkers" which are generally of sufficient length to permit some movement between the modified polypeptide sequences and the linked components and molecules.
  • the linker molecules are generally about 6-50 atoms long.
  • the linker molecules may also be, for example, aryl acetylene, ethylene glycol oligomers containing 2-10 monomer units, diamines, diacids, amino acids, or combinations thereof.
  • Suitable linkers can be readily selected and can be of any suitable length, such as 1 amino acid (e.g., Gly), 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, 30-50 or more than 50 amino acids.
  • Exemplary flexible linkers include glycine polymers (G )n , glycine-serine polymers (for example, (GS) n , GSGGS n (SEQ ID NO: 129) and GGGS n (SEQ ID NO: 130), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers.
  • Glycine and glycine-serine polymers are relatively unstructured, and therefore may serve as a neutral tether between components.
  • Exemplary flexible linkers include, but are not limited to GGSG (SEQ ID NO: 131), GGSGG (SEQ ID NO: 132), GSGSG (SEQ ID NO: 133), GSGGG (SEQ ID NO: 134), GGGSG (SEQ ID NO: 189), and GSSSG (SEQ ID NO: 135).
  • the linker is (G) 4 S.
  • the linker is ((G) 4 S) n ), where n is an integer of at least one.
  • the linker is ((G) 4 S) 2 ).
  • the glycine-serine polymer is (GS) n , where n is an integer of at least one. In some embodiments, the glycine-serine polymer is GSGGS n (SEQ ID NO: 129), where n is an integer of at least one. In some embodiments, the glycine-serine polymer is GGGS n (SEQ ID NO: 130), where n is an integer of at least one. In certain embodiments, the linker comprises an additional G residue at the N' terminus of SEQ ID NO: 130. In one embodiment, the linker is GGSG (SEQ ID NO: 131). In one embodiment, the linker is GGSGG (SEQ ID NO: 132).
  • the linker is GSGSG (SEQ ID NO: 133). In one embodiment, the linker is GSGGG (SEQ ID NO: 134). In one embodiment, the linker is GGGSG (SEQ ID NO: 189). In one embodiment, the linker is GSSSG (SEQ ID NO: 135).
  • Peptide sequences provided herein including the FGF 19 and FGF21 variants and subsequences and the FGF 19/FGF21 fusions and chimeras listed in Tables 1-1 1 and Sequence Listing, as well as subsequences, sequence variants and modified forms of the sequences listed in Tables 1-1 1 and Sequence Listing have one or more activities as set forth herein.
  • One example of an activity is modulating bile acid homeostasis.
  • Another example of an activity is reduced stimulation or formation of HCC, for example, as compared to FGF 19.
  • an activity is lower or reduced lipid (e.g., triglyceride, cholesterol, non-HDL) or HDL increasing activity, for example, as compared to FGF21.
  • a further example of an activity is a lower or reduced lean muscle mass reducing activity, for example, as compared to FGF21.
  • Yet another example of an activity is binding to FGFR4, or activating FGFR4, for example, peptide sequences that bind to FGFR4 with an affinity comparable to or greater than FGF 19 binding affinity for FGFR4; and peptide sequences that activate FGFR4 to an extent or amount comparable to or greater than FGF 19 activates FGFR4.
  • Still further examples of activities include treating a bile acid-related or associated disorder.
  • Activities such as, for example, modulation of bile acid homeostasis, glucose lowering activity, analysis of a bile acid-related or associated disorder, HCC formation or tumorigenesis, lipid increasing activity, or lean mass reducing activity can be ascertained in an animal, such as a db/db mouse.
  • Measurement of binding to FGFR4 or activation of FGFR4 can be ascertained by assays disclosed herein or known to the skilled artisan.
  • Indicators for HCC include detection of a tumor maker such as elevated alpha-fetoprotein (AFP) or des-gamma carboxyprothrombin (DCP) levels.
  • AFP alpha-fetoprotein
  • DCP des-gamma carboxyprothrombin
  • a number of different scanning and imaging techniques are also helpful, including ultrasound, CT scans and MRI.
  • evaluation of whether a peptide ⁇ e.g., a candidate peptide) exhibits evidence of inducing HCC may be determined in vivo by, for example, quantifying HCC nodule formation in an animal model, such as db/db mice, administered a peptide, compared to HCC nodule formation by wild type FGF19.
  • liver cancer may be nodular, where the tumor nodules (which are round-to-oval, grey or green, well circumscribed but not encapsulated) appear as either one large mass or multiple smaller masses.
  • HCC may be present as an infiltrative tumor which is diffuse and poorly circumscribed and frequently infiltrates the portal veins.
  • Pathological assessment of hepatic tissue samples is generally performed after the results of one or more of the aforementioned techniques indicate the likely presence of HCC.
  • methods provided herein may further include assessing a hepatic tissue sample from an in vivo animal model ⁇ e.g., a db/db mouse) useful in HCC studies in order to determine whether a peptide sequence exhibits evidence of inducing HCC.
  • a pathologist can determine whether one of the four general architectural and cytological types (patterns) of HCC are present ⁇ i.e., fibrolamellar, pseudoglandular (adenoid), pleomorphic (giant cell) and clear cell).
  • patterns fibrolamellar, pseudoglandular (adenoid), pleomorphic (giant cell) and clear cell.
  • peptide sequences provided herein including the FGF19 and FGF21 variants and subsequences and the FGF19/FGF21 fusions and chimeras listed in Tables 1-11 and Sequence Listing, as well as subsequences, variants and modified forms of the sequences listed in Tables 1-11 and Sequence Listing include those with the following activities: peptide sequences modulating bile acid homeostasis or treating a bile acid-related or associated disorder while having reduced HCC formation compared to FGF19, or a FGF 19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO: 171), WGDPV (SEQ ID NO: 172), WGDI (SEQ ID NO: 173), GDPI (SEQ ID NO: 174), GPI, WGQPI (SEQ ID NO: 175), WGAPI (SEQ ID NO: 176), AGDPI (SEQ ID NO: 177), WADPI (SEQ ID NO:
  • peptide sequences provided herein including the FGF 19 and FGF21 variants and subsequences and the FGF19/FGF21 fusions and chimeras listed in Tables 1-1 1 and Sequence Listing, as well as subsequences, variants and modified forms of the sequences listed in Tables 1-1 1 and the Sequence Listing include those with the following activities: peptide sequences that modulate bile acid homeostasis; peptide sequences that treat a bile acid-related or associated disorder, peptide sequences that bind to FGFR4, or activate FGFR4, such as peptide sequences that bind to FGFR4 with an affinity comparable to or greater than FGF 19 binding affinity for FGFR4; peptide sequences that activate FGFR4 to an extent or amount comparable to or greater than FGF 19 activates FGFR4; peptide sequences that down- regulate or reduce aldo-keto reductase gene expression, for example, compared to FGF
  • variants include various N-terminal modifications and/or truncations of FGF 19, including variants in which there has been a substitution of one or several N-terminal FGF19 amino acids with amino acids from FGF21.
  • variants include variants having glucose lowering activity, as well as a favorable lipid profile and are not measurably or detectably tumorigenic.
  • Peptide sequences provided herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences (e.g., sequences listed in the Sequence Listing or Tables 1-1 1), may be formulated in a unit dose or unit dosage form.
  • a peptide sequence is in an amount effective to treat a subject in need of treatment, e.g., due to abnormal or aberrant bile acid homeostasis, such as metabolic syndrome; a lipid- or glucose-related disorder; cholesterol or triglyceride metabolism; type 2 diabetes; cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), disorders impairing absorption of bile acids not otherwise characterized (
  • Exemplary unit doses range from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ng; from about 25-250, 250-500, 500- 1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ⁇ g; and from about 25-250, 250- 500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 mg.
  • Peptide sequences provided herein including subsequences, sequence variants and modified forms of the exemplified peptide sequences can be administered to provide the intended effect as a single dose or multiple dosages, for example, in an effective or sufficient amount.
  • Exemplary doses range from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 pg/kg; from about 50-500, 500-5000, 5000-25,000 or 25,000-50,000 ng/kg; and from about 25-250, 250-500, 500-1000, 1000-2500 or 2500-5000, 5000-25,000, 25,000-50,000 ⁇ g/kg.
  • Single or multiple doses can be administered, for example, multiple times per day, on consecutive days, alternating days, weekly or intermittently (e.g., twice per week, once every 1, 2, 3, 4, 5, 6, 7 or 8 weeks, or once every 2, 3, 4, 5 or 6 months).
  • Peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences can be administered and methods may be practiced via systemic, regional or local administration, by any route.
  • a peptide sequence can be administered parenterally (e.g., subcutaneously, intravenously, intramuscularly, or intraperitoneally), orally (e.g., ingestion, buccal, or sublingual), inhalation, intradermally, intracavity, intracranially, transdermally (topical), transmucosally or rectally.
  • Peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences e.g., sequences listed in the Sequence Listing or Tables 1-1 1
  • methods provided herein including pharmaceutical compositions can be administered via a (micro)encapsulated delivery system or packaged into an implant for administration.
  • a particular non-limiting example of parenteral (e.g., subcutaneous) administration entails the use of Intarcia's subcutaneous delivery system (Intarcia Therapeutics, Inc.; Hayward, CA).
  • the system comprises a miniature osmotic pump that delivers a consistent amount of a therapeutic agent over a desired period of time.
  • the system can be used with formulations that maintain the stability of proteinaceous therapeutic agents at human body temperature for extended periods of time.
  • DUROS®- type implantable osmotic pumps from, e.g., DURECT Corp.
  • the DUROS® system can be used for therapies requiring systemic or site-specific administration of a drug.
  • the DUROS® system is placed just under the skin, for example in the upper arm, in an outpatient procedure that is completed in just a few minutes using local anesthetic.
  • miniaturized catheter technology can be used. The catheter can be attached to the DUROS® system to direct the flow of a drug to the target organ, tissue or synthetic medical structure, such as a graft.
  • Site-specific delivery enables a therapeutic concentration of a drug to be administered to the desired target without exposing the entire body to a similar concentration.
  • the precision, size and performance of the DUROS® system will allow for continuous site-specific delivery to a variety of precise locations within the body.
  • an on-body delivery system e.g., the Neulasta® Delivery Kit by Amgen.
  • This on-body delivery system includes an on-body injector, which is a small, lightweight, injection system applied on the same day as a doctor visit (such as the day of chemotherapy). It is designed to deliver a dose of the therapeutic agent the next day, or in the near future of the doctor visit, so that the patient does not need to return to the doctor's office to receive the injection.
  • Various methods of controlled release is also contemplated herein. Encapsulation of therapeutic molecules within polymer particles is a well-established method for achieving controlled release and can be used in methods provided herein. Also, by taking advantage of the adsorption of protein therapeutics to poly(lactic-co-gly colic acid) (PLGA) nanoparticles, controlled release can also be achieved without encapsulation. In particular, extended-release for protein therapeutics cam be applied with and without encapsulation in PLGA nanoparticles embedded within a hydrogel. The release profile tunable by modifying nanoparticle concentration, nanoparticle size, or environmental pH. Pakulska et al, Science Advances 2(5): el600519 (2016)
  • provided herein is a method of preventing a disease or disorder in a subject having, or at risk of having, a disease or disorder preventable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for preventing the disease or disorder.
  • a method of treating a disease or disorder in a subject having, or at risk of having, a disease or disorder treatable by a peptide sequence provided herein comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for treating the disease or disorder.
  • provided herein is a method of managing a disease or disorder in a subject having, or at risk of having, a disease or disorder manageable by a peptide sequence provided herein, comprising administering a pharmaceutical composition comprising a peptide provided herein to a subject in an amount effective for managing the disease or disorder.
  • the disease or disorder is a bile acid-related disease or associated disorder.
  • the disease or disorder is a metabolic disease or disorder.
  • the disease or disorder is a cancer or tumor.
  • bile acid-related disorder when used in reference to a condition of a subject, means a disruption of bile acid homeostasis, which may manifest itself as, for example, an acute, transient or chronic abnormal level of a bile acid or one or more bile acids.
  • the condition can be caused by inhibition, reduction or a delay in bile acid synthesis, metabolism or absorption such that the subject exhibits a bile acid level not typically found in normal subjects.
  • the methods include administering a peptide sequence, such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., in the Sequence Listing or Tables 1-11), or a subsequence, a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., the Sequence Listing or Tables 1-11), to a subject in an amount effective for treating a bile acid-related or associated disorder.
  • a peptide sequence such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., in the Sequence Listing or Tables 1-11
  • a subsequence a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., the Sequence Listing or Tables 1-11
  • the peptide is administered in combination with an additional therapeutic agent(s) and/or treatment modalities ⁇ e.g., an agent useful in the treatment and/or prevention of PBC).
  • the additional therapeutic agent(s) can be administered before, with, or following administration of the peptides described herein.
  • Also provided herein are methods of preventing (e.g., in subjects predisposed to having a particular disorder(s)), delaying, slowing or inhibiting progression of, the onset of, or treating (e.g., ameliorating) a bile acid-related or associated disorder relative to an appropriate matched subject of comparable age, gender, race, etc.).
  • a method provided herein for, for example, modulating bile acid homeostasis or treating a bile acid-related or associated disorder includes contacting or administering one or more peptides provided herein (e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Tables 1-11) in an amount effective to modulate bile acid homeostasis or treat a bile acid-related or associated disorder.
  • the method further comprises contacting or administering at least one additional therapeutic agent or treatment modality that is useful in the treatment or prevention of a bile acid-related or associated disorder (e.g., PBC).
  • subject refers to an animal.
  • the animal is a mammal that would benefit from treatment with a peptide sequence provided herein.
  • Particular examples include primates (e.g., humans), dogs, cats, horses, cows, pigs, and sheep.
  • Subjects include those having a disorder, e.g., a bile acid-related or associated disorder, such as cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), short bowel syndrome, disorders impairing absorption of bile acids not otherwise characterized (idiopathic)) leading to diarrhea (e.g., BAD) and GI symptoms, and GI, liver, and/or biliary cancers (e.
  • Non-limiting exemplary bile acid-related or associated disorders preventable, treatable or manageable according to the methods and uses provided herein include: cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., primary biliary cirrhosis (PBC), primary familial intrahepatic cholestasis (PFIC) (e.g., progressive PFIC), primary sclerosing choangitis (PSC), pregnancy intrahepatic cholestasis (PIC), neonatal cholestasis, and drug- induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn' s disease and ulcerative
  • Additional bile acid-related or associated disorders include metabolic syndrome; a lipid or glucose disorder; cholesterol or triglyceride metabolism; type 2 diabetes.
  • the bile acid-related or associated disorder is bile acid malabsorption.
  • the bile acid-related or associated disorder is diarrhea.
  • the bile acid-related or associated disorder is cholestasis (e.g., intrahepatic or extrahepatic cholestasis).
  • the bile acid- related or associated disorder is primary biliary cirrhosis (PBC).
  • PBC primary biliary cirrhosis
  • the bile acid-related or associated disorder is primary sclerosing cholangitis.
  • the bile acid-related or associated disorder is PFIC (e.g., progressive PFIC).
  • the bile acid-related or associated disorder is NASH.
  • the bile acid-related or associated disorder is a hyperglycemic condition.
  • the bile acid-related or associated disorder is type 2 diabetes.
  • the methods provided herein comprises administration of at least one additional agent effective in modulating bile acid homeostasis or treating a bile acid- related or associated disorder, wherein the additional agent is: a glucocorticoid; CDCA; UDCA; insulin, an insulin secretagogues, an insulin mimetic, a sulfonylurea and a meglitinide; a biguanide; an alpha-glucosidase inhibitors; a DPP -IV inhibitor, GLP-1, a GLP-1 agonists and a GLP-1 analog; a DPP-IV-resistant analogue; a PPAR gamma agonist, a dual-acting PPAR agonist, a pan-acting PPAR agonist; a PTP1B inhibitor; an SGLT inhibitor; an RXR agonist; a glycogen synthase kinase-3 inhibitor; an immune modulator; a beta-3 ad
  • the at least one additional agent effective in modulating PBC is UDCA, an FXR agonist, OCA, an ASBT inhibitor, an autoimmune agent, an anti-IL-12 agent, an anti-CD80 agent, an anti-CD20 agent, a CXCL10 neutralizing antibody, a ligand for CXCR3, a fibrate, fish oil, colchicine, methotrexate, azathioprine, cyclosporine, or an anti-retroviral therapy.
  • the at least one additional agent effective in modulating PBC is UDCA, OCA, an ASBT inhibitor, an anti-IL-12 agent, an anti-CD20 agent, or a fibrate.
  • Additional bile acid-related or associated disorders that may be treated or prevented with the peptide sequences provided herein include metabolic syndrome, a lipid or glucose disorder, cholesterol or triglyceride metabolism, diabetes (e.g., type 2 diabetes), other hyperglycemic-related disorders, including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage (e.g., diabetic retinopathy or cataracts), and diabetic foot disorders, and dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like.
  • diabetes e.g., type 2 diabetes
  • other hyperglycemic-related disorders including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage (e.g., diabetic retinopathy or cataracts), and diabetic foot disorders, and dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders
  • Other conditions which may be associated with metabolic syndrome such as obesity and elevated body mass (including the co-morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), and also include thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension (including portal hypertension (defined as a hepatic venous pressure gradient (HVPG) greater than 5 mm Hg), cardiovascular disease, stroke and heart failure; Disorders or conditions in which inflammatory reactions are involved, including atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn' s disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders;
  • NAFD nonalcoholic fatty liver disease
  • NASH nonalcoholic steatohepatitis
  • PCOS polycystic ovarian syndrome
  • thromboses
  • disorders of cell cycle or cell differentiation processes such as adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and neoplasms;
  • Neurodegenerative diseases and/or demyelinating disorders of the central and peripheral nervous systems and/or neurological diseases involving neuroinflammatory processes and/or other peripheral neuropathies including Alzheimer' s disease, multiple sclerosis, Parkinson' s disease, progressive multifocal leukoencephalopathy and Guillian-Barre syndrome; Skin and
  • dermatological disorders and/or disorders of wound healing processes including erythemato- squamous dermatoses; and Other Disorders such as syndrome X, osteoarthritis, and acute respiratory distress syndrome.
  • Treatment of a bile acid-related or associated disorder may have the benefit of alleviating or abolishing a disorder secondary thereto.
  • a subject suffering from NASH may also have depression or anxiety due to NASH; thus, treating the subject' s NASH may also indirectly treat the depression or anxiety.
  • the use of the therapies disclosed herein to target such secondary disorders is also contemplated in certain embodiments.
  • the subject has or is at risk of having PBC. In other particular embodiments, the subject has or is at risk of having NASH.
  • Subjects at risk of developing a bile acid-related or associated disorder include, for example, those who may have a family history or genetic predisposition toward such disorder, as well those whose diet may contribute to development of such disorders.
  • treatment methods include contacting or administering a peptide as set forth herein (e.g., a variant or fusion of FGF 19 and/or FGF21 provided herein, for example, as set forth in the Sequence Listing or Tables 1-1 1) in an amount effective to achieve a desired outcome or result in a subject.
  • a peptide as set forth herein e.g., a variant or fusion of FGF 19 and/or FGF21 provided herein, for example, as set forth in the Sequence Listing or Tables 1-1 1
  • a treatment that results in a desired outcome or result includes decreasing, reducing or preventing the severity or frequency of one or more symptoms of the condition in the subject, e.g., an improvement in the subject' s condition or a "beneficial effect” or "therapeutic effect.” Therefore, treatment can decrease or reduce or prevent the severity or frequency of one or more symptoms of the disorder, stabilize or inhibit progression or worsening of the disorder, and in some instances, reverse the disorder, transiently (e.g., for 1-6, 6-12, or 12-24 hours), for medium term (e.g., 1-6, 6-12, 12-24 or 24-48 days) or long term (e.g., for 1-6, 6-12, 12-24, 24-48 weeks, or greater than 24-48 weeks).
  • treatment can lower or reduce one or more symptoms or effects of the bile acid-related or associated disorders described above.
  • the various methods provided herein further include contacting or administering one or more additional agents or therapeutic modalities useful in the treatment or prevention of a bile acid-related or associated disorder, such as those agents or therapeutic modalities described herein, in an amount effective to achieve a desired outcome or result in a subject.
  • an "effective amount” or a "sufficient amount” for use and/or for treating a subject refers to an amount that provides, in single or multiple doses, alone, or in combination with one or more other agents, treatments, protocols, or therapeutic regimens, a detectable response of any duration of time (transient, medium or long term), a desired outcome in or an objective or subjective benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for hours, days, months, years, in remission or cured).
  • Such amounts typically are effective to ameliorate a disorder, or one, multiple or all adverse symptoms, consequences or
  • the term "ameliorate” means an improvement in the subject's disorder, a reduction in the severity of the disorder, or an inhibition of progression or worsening of the disorder (e.g., stabilizing the disorder).
  • a bile acid-related or associated disorder such as those described above, including cholestasis (e.g., PBC), disorders impairing absorption of bile acids leading to diarrhea (e.g., BAD) and bile acid synthesis abnormalities (e.g., NASH)
  • an improvement can be a lowering or a reduction in one or more symptoms or effects of the disorder.
  • a therapeutic benefit or improvement therefore need not be complete ablation of any one, most or all symptoms, complications, consequences or underlying causes associated with the disorder or disease.
  • a satisfactory endpoint is achieved when there is a transient, medium or long term, incremental improvement in a subject's condition, or a partial reduction in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of one or more associated adverse symptoms or complications or consequences or underlying causes, worsening or progression (e.g., stabilizing one or more symptoms or complications of the condition, disorder or disease), of the disorder or disease, over a duration of time (hours, days, weeks, months, etc.).
  • the amount of the peptide (and optionally the additional agent )sufficient to ameliorate a disorder will depend on the type, severity and extent, or duration of the disorder, the therapeutic effect or outcome desired, and can be readily ascertained by the skilled artisan. Appropriate amounts will also depend upon the individual subject (e.g., the bioavailability within the subject, gender, age, etc.).
  • a transient, or partial, restoration of normal bile acid homeostasis in a subject can reduce the dosage amount or frequency of the peptides and agents described herein in order to treat the bile acid-related or associated disorders described previously even though complete freedom from treatment has not resulted.
  • An effective amount can be ascertained, for example, by measuring one or more relevant physiological effects.
  • Methods and uses provided herein for treating a subject are applicable for prophylaxis to prevent or reduce the likelihood of a disorder in a subject, such as a bile acid-related or associated disorder. Accordingly, methods and uses provided herein for treating a subject having, or at risk of developing, a bile acid-related or associated disorder can be practiced prior to, substantially contemporaneously with, or following administration or application of another agent useful for the treatment or prevention of a bile acid-related or associated disorder, and/or can be supplemented with other forms of therapy.
  • Supplementary therapies include other glucose lowering treatments, such as insulin, an insulin sensitivity enhancer and other drug treatments, a change in diet (low sugar, fats, etc.), weight loss surgery- (reducing stomach volume by gastric bypass, gastrectomy), gastric banding, gastric balloon, gastric sleeve, etc.
  • a method or use provided herein for treating a hyperglycemic or insulin resistance disorder can be used in combination with drugs or other pharmaceutical compositions that lower glucose or increase insulin sensitivity in a subject.
  • a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for preventing a bile-acid related or associated disorder. In one embodiment, a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for treating a bile-acid related or associated disorder. In one embodiment, a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for managing a bile-acid related or associated disorder.
  • PBC Primary biliary cirrhosis
  • patients with PBC are often asymptomatic at the time of initial diagnosis, most present, or subsequently develop, one or more of the following: pruritus; fatigue; jaundice; xanthoma; disorders associated with an extrahepatic autoimmune disorder (e.g., Sjogren's Syndrome and rheumatoid arthritis); and complications that result from cirrhosis or portal hypertension (e.g., ascites, esophageal varices and hepatic encephalopathy).
  • pruritus e.g., fatigue; jaundice
  • xanthoma e.g., disorders associated with an extrahepatic autoimmune disorder (e.g., Sjogren's Syndrome and rheumatoid arthritis); and complications that result from cirrhosis or portal hypertension (e.g., ascites, esophageal varices and hepatic encephalopathy).
  • Diagnostic blood tests include deranged liver function tests (gamma-glutamyl transferase and alkaline phosphatase) and the presence of particular antibodies
  • AMA antimitochondrial antibody
  • ANA antinuclear antibody
  • Antinuclear antibodies are believed to be prognostic indicators of PBC.
  • a liver biopsy is frequently performed to confirm disease.
  • Endoscopic retrograde cholangiopancreatography (ERCP) an endoscopic evaluation of the bile duct, may also be employed to confirm disease.
  • Stage 1 is characterized by portal inflammation and mild bile duct damage
  • Stage 2 Periportal Stage
  • Stage 3 is characterized by active and/or passive fibrous septa
  • Stage 4 Bory Cirrhosis
  • Liver biopsy is required to determine the stage of disease.
  • Serum bilirubin is an indicator of PBC progression and prognosis.
  • Patients with a serum bilirubin level of 2-6 mg/dL have a mean survival time of 4.1 years, patients with a serum bilirubin level of 6-10 mg/dL have a mean survival time of 2.1 years, and patients with a serum bilirubin level above 10 mg/dL have a mean survival time of 1.4 years.
  • Liver transplantation is an option in advanced cases of PBC, although the recurrence rate may be as high as 18% at 5 years, and up to 30% at 10 years.
  • one aspect pertains to the use of one or more current therapies in combination with variants of FGF19 peptide sequences, fusions of FGF19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of PBC and associated diseases, disorders and conditions.
  • the most commonly used and/or promising agents for combination therapy are set forth hereafter, although it is to be understood that these agents are illustrative, and not exclusionary.
  • UDCA bile acid ursodeoxycholic acid
  • UDCA therapy is helpful in reducing the cholestasis and improving the liver function tests in PBC patients; however, it does not demonstrably improve symptoms and has a questionable impact on prognosis.
  • UDCA has been shown to reduce mortality, adverse events and the need for transplantation in PBC. Although UDCA is considered the first-line therapy, approximately one-third of patients may be non-responsive and remain at risk of progressive liver disease and are candidates for alternative or additive therapy.
  • Farnesoid-X-receptor agonists represent a promising class of agents that may be used in combination therapy.
  • CYP7A1 hydroxylase-1
  • OCA oxidized hydroxylase-1
  • Inhibitors of the apical sodium-dependent bile acid transporter represent another class of agents that may be used in combination with the variants of FGF 19 peptide sequences, fusions of FGF 19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences described herein for the treatment and/or prevention of PBC and associated diseases.
  • ASBT a member of the sodium/bile-salt co-transport family coded by gene SLC10A2
  • ABST inhibitors include LUM001 and SC-435, both of which are being developed by Lumena Pharmaceuticals (San Diego, CA).
  • Bile acid sequestrants also find use in the treatment of PBC. Cholestyramine and colestipol are the best known bile acid sequestrants. However, their use is sometimes limited because they are only available in powder form and are not tolerated by many patients, often because of the poor texture and taste of the resin powder. The bile acid sequestrant colesevelam is available in tablet form and is often better tolerated. All bile acid sequestrants are capable of binding other compounds, including the fat-soluble vitamins A, D, E and K, and deficiencies of these vitamins many necessitate supplementation. Importantly, the PBC patient population inherently has poor lipid-dependent absorption of vitamins A, D, E and K, and thus patients taking bile acid sequestrants are at particular risk for deficiency of those vitamins.
  • Agents associated with immune and inflammatory function are candidates for combination therapy with the variants of FGF19 peptide sequences, fusions of FGF 19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of PBC and associated diseases, disorders and conditions.
  • the interleukin IL-12 is linked with autoimmunity. Data indicate that the IL-12 signaling pathway plays a key role in the effector mechanisms that lead to biliary destruction. Targeting the p40 subunit of IL-12 has also been shown to ameliorate experimental immune- mediated cholangiopathy.
  • anti-IL-12 agents e.g., monoclonal Ab inhibitors
  • CD80 polymorphisms in CD80 have been identified as conferring an increased susceptibility to PBC
  • blockade of co-stimulation between T cells and antigen-presenting cells through CD80 by use of an anti-CD80 agent could represent an important therapeutic approach for the treatment of PBC.
  • improvement in IgM titre and an increase in intrahepatic regulatory T-cell number using the anti-CD20 antibody rituximab (RITUXAN) have shown promise.
  • the immune-mediated destruction of small-sized bile ducts in PBC is predominantly cell-mediated, characterized by Thl cells, CD8+ T cells, K cells and KT cells which express CXCR3. Therefore, neutralizing antibodies to CXCL10, a ligand for CXCR3, may offer the possibility to interfere with one of the key inflammatory processes and contribute to immune- mediated biliary destruction in PBC.
  • blockade of co-stimulatory signals between T cells expressing CD28 and antigen-presenting cells expressing CD80 might represent an important approach for the treatment of autoimmune diseases.
  • variants of FGF 19 peptide sequences, fusions of FGF 19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences described herein can be used alone or in combination with other agents for the treatment and/or prevention of those bile acid-related or associated disorders referenced herein that have an immune and/or inflammatory component, including, but not limited to, PBC and associated diseases, disorders and conditions.
  • NSAID nonsteroidal anti-inflammatory drugs
  • steroids cytokine suppressive anti-inflammatory drug(s)
  • CSAIDs antibodies to, or antagonists of, other human cytokines or growth factors (e.g., IL-2, IL-6, or PDGF); TNF antagonists (e.g., agents such as REMICADE, p75T FRIgG (E BREL) or p55T FRlgG (LE ERCEPT)); interferon-p la (AVO EX); interferon-plb (BETASERON); and immune checkpoint inhibitors, including PD1 (associated agents include the antibodies nivolumab and lambrolizumab), PDLl, BTLA, CTLA4 (associated agents include the fully humanized CTLA4 monoclonal antibody ipilimumab (YERVOY), TIM3, LAG3, and A2aR.
  • PD1 associated agents include the antibodies nivolumab and lambrolizumab
  • Fibrates have been shown to improve various aspects of PBC, including liver function tests, both as monotherapy and in combination with UDCA non-responders.
  • a fibrate is a member selected from the group of bezafibrate (BEZALIP), ciprofibrate (MODALIM), gemfibrozil (LOPID), clofibrate, and fenofibrate (TRICOR).
  • BEZALIP bezafibrate
  • MODALIM ciprofibrate
  • LPID gemfibrozil
  • clofibrate clofibrate
  • TACOR fenofibrate
  • Fish oil has exhibited similar benefits.
  • corticosteroids such as budesonide may improve liver histology and biochemistry, particularly when used in combination with UDCA.
  • Colchicine has been shown to improve liver function tests (e.g., AST and ALP) and represents another alternative treatment for PBC.
  • Non-alcoholic steatohepatitis (NASH), considered part of a spectrum of non-alcoholic fatty liver diseases (NAFLD), causes inflammation and accumulation of fat and fibrous tissue in the liver.
  • NASH non-alcoholic fatty liver diseases
  • risk factors include central obesity, type-2 diabetes mellitus, insulin resistance (IR) and dyslipidemia; combinations of the foregoing are frequently described as the metabolic syndrome.
  • certain drugs have been linked to NASH, including tamoxifen, amiodarone and steroids (e.g., prednisone and hydrocortisone).
  • NASH non-alcoholic fatty liver disease
  • tamoxifen amiodarone
  • steroids e.g., prednisone and hydrocortisone
  • NASH frequently presents with no overt symptoms, complicating its diagnosis. Liver function tests generally begin the diagnostic process, with levels of AST (aspartate
  • ALT aminotransferase
  • Other blood tests are often used for ruling out other causes of liver disease, such as hepatitis.
  • Imaging tests e.g., ultrasound, CT scan, or MRI
  • a liver biopsy is required to confirm NASH.
  • treatment of NASH focuses primarily on pharmacological and non-pharmacological management of those medical conditions associated with it, including hyperlipidemia, diabetes and obesity.
  • pharmacological intervention of NASH itself includes treatment with vitamin E, pioglitazone, metformin, statins, omega-3 fatty acids, and ursodeoxycholic acid (UDCA (ursodiol)).
  • Other agents being evaluated, currently approved for different indications, include losartan and telisartan, exenatide, GLP-1 agonists, DPP IV inhibitors, and carbamazepine.
  • variants of FGF 19 peptide sequences fusions of FGF 19 and/or FGF21 peptide sequences and variants of fusions (chimeras) of FGF 19 and/or FGF21 peptide sequences having one or more activities associated with the treatment and/or prevention of other bile acid-related disorders and associated diseases, disorders and conditions besides PBC.
  • the peptides are used in combination with other therapeutic agents and/or treatment modalities.
  • Bile acid replacement is used in inborn errors of bile acid biosynthesis, usually with a mixture of CDCA or UDCA and cholic acid, to suppress the synthesis of cytotoxic bile acid precursors and restore the input of primary bile acids into the enterohepatic circulation.
  • combination therapy with numerous additional agents is also contemplated, including, but not limited to, 1) insulin e.g., bolus and basal analogs), insulin mimetics and agents that entail stimulation of insulin secretion, including sulfonylureas (e.g., chlorpropamide, tolazamide, acetohexamide, tolbutamide, glyburide, glimepiride, glipizide) and meglitinides (e.g., repaglinide (PRA DIN) and nateglinide (STARLIX)); 2) biguanides (e.g., metformin (GLUCOPHAGE)) and other agents that act by promoting glucose utilization, reducing hepatic glucose production and/or diminishing intestinal glucose output; 3) alpha-glucosidase inhibitors (e.g., acarbose and miglitol) and other agents that slow down
  • sulfonylureas e.g., chlorpropamide,
  • DPP-4 dipeptidyl peptidase-4
  • bromocriptine formulations e.g. and bile acid sequestrants (e.g., colesevelam)
  • SGLT-2 inhibitors e.g
  • a method for preventing or treating a bile acid related disorder (BARD), or a symptom thereof, in a subject comprising administering to the subject an effective amount of a peptide, wherein the peptide has an amino acid sequence comprising or consisting of:
  • a method for preventing or treating a bile acid related disorder (BARD), or a symptom thereof, in a subject comprising administering to the subject an effective amount of a peptide, wherein the peptide has an amino acid sequence comprising or consisting of:
  • a method for preventing or treating a BARD, or a symptom thereof, in a subject comprising administering to the subject an effective amount of a peptide, wherein the peptide comprises: a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO: 121) or DASPH (SEQ ID NO: 122); and b) a C-terminal region comprising a portion of SEQ ID NO: 99 (FGF19), the C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises amino acid residues 16-29 of SEQ ID NO:99 (FGF19), WGDPIRLRHLYTSG (SEQ ID NO: 169), wherein the W residue corresponds to the first amino acid position of the C-terminal region.
  • the peptide comprises: a) an N-terminal
  • the BARD, or symptom thereof is improved as compared to baseline.
  • baseline is a pre-dose baseline.
  • the BARD is non-alcoholic fatty liver disease (NAFLD).
  • NAFLD non-alcoholic fatty liver disease
  • a method of preventing or treating NAFLD, or a symptom thereof, in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the method results in an improvement of the NAFLD activity score (NAS).
  • NAS NAFLD activity score
  • the BARD is hepatic fibrosis.
  • a method of preventing or treating hepatic fibrosis, or a symptom thereof, in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the BARD is nonalcoholic steatohepatitis (NASH).
  • NASH nonalcoholic steatohepatitis
  • provided herein is a method of preventing or treating NASH or a symptom thereof, in a subject, comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the subject has biopsy-confirmed NASH.
  • the BARD is cholestatic liver disease.
  • a method of preventing or treating cholestatic liver disease, or a symptom thereof, in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the cholestatic liver disease is primary sclerosing cholangitis (PSC). In some embodiments, the cholestatic liver disease is primary biliary cirrhosis (PBC). In some embodiments, the cholestatic liver disease is intrahepatic cholestatis of pregnancy. In some embodiments, the cholestatic liver disease is alcoholic hepatitis. In some embodiments, the cholestatic liver disease is drug-induced cholestatis.
  • the methods provided herein result in a decrease in liver steatosis.
  • a method of preventing or treating liver steatosis in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a decrease in liver inflammation.
  • a method of preventing or treating liver inflammation in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the liver inflammation is lobular inflammation.
  • the methods provided herein result in a decrease in hepatocyte ballooning.
  • a method of decreasing hepatocyte ballooning in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction of CYP7al levels in the subject.
  • a method of reducing CYP7al levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction of serum bile acid levels in the subject.
  • a method of reducing serum bile acid levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction of triglycerides in the subject.
  • a method of reducing triglycerides in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction in alkaline phosphatase (ALP) levels in the subject.
  • ALP alkaline phosphatase
  • a method of reducing ALP levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the ALP levels are reduced at least 10% in the subject. In some embodiments, the ALP levels are reduced at least 15% in the subject.
  • the methods provided herein result in a reduction in alkaline aminotransferase (ALT) levels in the subject.
  • a method of reducing ALT in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • a method of reducing ALT levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction in aspartate aminotransfease (AST) levels in the subject.
  • AST aspartate aminotransfease
  • provided herein is a method of reducing AST levels in a subject, comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction in gamma- glutamyltransferase (GGT) levels in the subject.
  • GGT gamma- glutamyltransferase
  • a method of reducing GGT levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in an improvement in a biochemical marker of liver function.
  • a method of improving a biochemical marker of liver function in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the biochemical marker of liver function is an enzyme.
  • the enzyme is ALP.
  • the enzyme is ALT.
  • the enzyme is AST.
  • the enzyme is GGT.
  • the methods provided herein result in a reduction in cholesterol levels in the subject.
  • a method of reducing cholesterol levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction in glucose levels in the subject.
  • a method of reducing glucose levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in an improvement in insulin resistance in the subject.
  • a method of improving insulin resistance in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in an improvement in insulin sensitivity in the subject.
  • a method of improving insulin sensitivity in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the insulin sensitivity is as measured by HOMA-IR.
  • the methods provided herein result in a reduction in body weight in the subject.
  • a method of reducing body weight in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a reduction in liver weight in the subject.
  • a method of reducing liver weight in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a decrease in bilirubin levels in the subject.
  • a method of reducing bilirubin levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in a decrease in a serum biomarker of early fibrosis in the subject.
  • a method of reducing the level of a serum biomarker of early fibrosis in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in the reduction of serum C4 levels in the subject.
  • a method of reducing serum C4 levels in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the serum C4 levels are decreased by at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% in the subject.
  • the reduction in serum C4 levels is a mean reduction in C4 levels.
  • the mean reduction in serum C4 levels is at least 90%.
  • the serum C4 levels are decreased as compared to the serum C4 levels in the subject prior to administration of the peptide.
  • the methods provided herein result in an improvement in liver function in the subject.
  • a method of improving liver function in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the methods provided herein result in improving pruritus, or a symptom thereof, in the subject.
  • a method of preventing or treating pruritus, or a symptom thereof, in a subject comprising administering a peptide (e.g., M70, or M69) provided herein.
  • the method is a method of preventing pruritus, or a symptom thereof, in a subject.
  • the method is a method of treating pruritus, or a symptom thereof, in a subject.
  • the pruritus symptom is itching.
  • the pruritus symptom is impaired sleep.
  • the pruritus symptom is depression.
  • the peptide is administered at a dose of 0.3 mg. In some embodiments, the peptide is administered at a dose of 1 mg. In some embodiments, the peptide is administered at a dose of 2 mg. In some embodiments, the peptide is administered at a dose of 3 mg. In some embodiments, the peptide is administered at a dose of 5 mg. In some embodiments, the peptide is administered at a dose of 10 mg.
  • the peptide is administered once a day. In some embodiments, the peptide is administered twice a day. [0335] In some embodiments, the peptide is administered subcutaneously.
  • the peptide is administered for 7 days or longer. In some embodiments, the peptide is administered for 14 days or longer. In some embodiments, the peptide is administered for 21 days or longer. In some embodiments, the peptide is administered for 28 days or longer. In some embodiments, the peptide is administered for 1 to 12 months. In some embodiments, the peptide is administered for 12 months. In some embodiments, the peptide is administered for more than 12 months.
  • the peptide is administered in combination with ursodeoxycholic
  • the subject is overweight. In some embodiments, the subject is obese. In some embodiments, the subject has diabetes. In some embodiments, the subject does not have diabetes. In some embodiments, the diabetes is type 2 diabetes.
  • the methods include administering a peptide sequence, such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., in the Sequence Listing or Tables 1-11), or a subsequence, a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., the Sequence Listing or Tables 1-11), to a subject in an amount effective for treating a metabolic or associated disorder.
  • a peptide sequence such as a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., in the Sequence Listing or Tables 1-11
  • a subsequence a variant or modified form of a FGF19 or FGF21 variant, fusion or chimera disclosed herein ⁇ e.g., the Sequence Listing or Tables 1-11
  • the peptide is administered in combination with an additional therapeutic agent(s) and/or treatment modalities ⁇ e.g., an agent useful in the treatment and/or prevention of PBC).
  • additional therapeutic agent(s) can be administered before, with, or following administration of the peptides described herein.
  • a method provided herein for, for example, modulating bile acid homeostasis or treating a metabolic or associated disorder includes contacting or administering one or more peptides provided herein ⁇ e.g., a variant or fusion of FGF19 and/or FGF21 as set forth in the Sequence Listing or Tables 1-11) in an amount effective to modulate bile acid homeostasis or treat a metabolic or associated disorder.
  • the method further comprises contacting or administering at least one additional therapeutic agent or treatment modality that is useful in the treatment or prevention of a metabolic or associated disorder (e.g., PBC).
  • subject refers to an animal.
  • the animal is a mammal that would benefit from treatment with a peptide sequence provided herein.
  • Particular examples include primates (e.g., humans), dogs, cats, horses, cows, pigs, and sheep.
  • Subjects include those having a disorder, e.g., a metabolic or associated disorder, or subjects that do not have a disorder but may be at risk of developing the disorder.
  • Non-limiting exemplary disorders or conditions preventable, treatable or manageable with the peptide formulations, methods and uses thereof provided herein, include metabolic diseases and disorders.
  • diseases and disorders include: metabolic syndrome; a lipid- or glucose-related disorder; cholesterol or triglyceride metabolism; type 2 diabetes; cholestasis, including, for example diseases of intrahepatic cholestasis (e.g., PBC, PFIC, PSC, PIC, neonatal cholestasis, and drug induced cholestasis (e.g., estrogen)), and diseases of extrahepatic cholestasis (e.g., bile cut compression from tumor, bile duct blockade by gall stones); bile acid malabsorption and other disorders involving the distal small intestine, including ileal resection, inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), disorders impairing absorption of bile acids not otherwise characterized
  • peptide sequences provided herein can be administered to subjects in need of modulation of bile acid homeostasis or having a bile-acid related or associated disorder.
  • Peptide sequences provided herein may also be useful in other hyperglycemic-related disorders, including kidney damage (e.g., tubule damage or nephropathy), liver degeneration, eye damage (e.g., diabetic retinopathy or cataracts), and diabetic foot disorders; dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like.
  • Other conditions which may be associated with metabolic syndrome such as obesity and elevated body mass (including the co-morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), and also include thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension (including portal hypertension (defined as a hepatic venous pressure gradient (HVPG) greater than 5 mm Hg), cardiovascular disease, stroke and heart failure; Disorders or conditions in which inflammatory reactions are involved, including atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders;
  • disorders of cell cycle or cell differentiation processes such as adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and neoplasms;
  • Neurodegenerative diseases and/or demyelinating disorders of the central and peripheral nervous systems and/or neurological diseases involving neuroinflammatory processes and/or other peripheral neuropathies including Alzheimer's disease, multiple sclerosis, Parkinson's disease, progressive multifocal leukoencephalopathy and Guillian-Barre syndrome; Skin and
  • dermatological disorders and/or disorders of wound healing processes including erythemato- squamous dermatoses; and other disorders such as syndrome X, osteoarthritis, and acute respiratory distress syndrome.
  • a subject has a hyperglycemic condition (e.g., diabetes, such as insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes), insulin resistance, hyperinsulinemia, glucose intolerance or metabolic syndrome, is obese and/or has an undesirable body mass.
  • diabetes such as insulin-dependent (type I) diabetes, type II diabetes, or gestational diabetes
  • a peptide sequence or chimeric peptide sequence provided herein is administered to a subject in an amount effective to improve glucose metabolism in the subject.
  • a subject has a fasting plasma glucose level greater than 100 mg/dl or has a hemoglobin Ale (HbAlc) level above 6%, prior to administration.
  • HbAlc hemoglobin Ale
  • a use or method of treatment of a subject is intended to or results in reduced glucose levels, increased insulin sensitivity, reduced insulin resistance, reduced glucagon, an improvement in glucose tolerance, or glucose metabolism or homeostasis, improved pancreatic function, or reduced triglyceride, cholesterol, IDL, LDL or VLDL levels, or a decrease in blood pressure, a decrease in intimal thickening of the blood vessel, or a decrease in body mass or weight gain.
  • Treatment of a metabolic or associated disorder e.g., hyperglycemia
  • a subject suffering from hyperglycemia may also have depression or anxiety due to the hyperglycemia; thus, treating the subject' s hyperglycemia may also indirectly treat the depression or anxiety.
  • the use of the therapies disclosed herein to target such secondary disorders is also contemplated in certain embodiments.
  • the subject has or is at risk of having hyperglycemia.
  • the subject has or is at risk of having diabetes, such as Type 2 diabetes.
  • Subjects at risk of developing a metabolic or associated disorder include, for example, those who may have a family history or genetic predisposition toward such disorder, as well those whose diet may contribute to development of such disorders.
  • treatment methods include contacting or administering a peptide as set forth herein (e.g., a variant or fusion of FGF 19 and/or FGF21 as set forth in the Sequence Listing or Tables 1-1 1) in an amount effective to achieve a desired outcome or result in a subject.
  • a peptide as set forth herein e.g., a variant or fusion of FGF 19 and/or FGF21 as set forth in the Sequence Listing or Tables 1-1 1
  • a treatment that results in a desired outcome or result includes decreasing, reducing or preventing the severity or frequency of one or more symptoms of the condition in the subject, e.g., an improvement in the subject' s condition or a "beneficial effect” or "therapeutic effect.” Therefore, treatment can decrease or reduce or prevent the severity or frequency of one or more symptoms of the disorder, stabilize or inhibit progression or worsening of the disorder, and in some instances, reverse the disorder, transiently (e.g., for 1-6, 6-12, or 12-24 hours), for medium term (e.g., 1-6, 6-12, 12-24 or 24-48 days) or long term (e.g., for 1-6, 6-12, 12-24, 24-48 weeks, or greater than 24-48 weeks).
  • treatment can lower or reduce one or more symptoms or effects of the metabolic or associated disorders described above.
  • the various methods provided herein further include contacting or administering one or more additional agents or therapeutic modalities useful in the treatment or prevention of a metabolic or associated disorder, such as those agents or therapeutic modalities described herein, in an amount effective to achieve a desired outcome or result in a subject.
  • an "effective amount” or a "sufficient amount” for use and/or for treating a subject refers to an amount that provides, in single or multiple doses, alone, or in combination with one or more other agents, treatments, protocols, or therapeutic regimens, a detectable response of any duration of time (transient, medium or long term), a desired outcome in or an objective or subjective benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for hours, days, months, years, in remission or cured).
  • Such amounts typically are effective to ameliorate a disorder, or one, multiple or all adverse symptoms, consequences or
  • the term “ameliorate” means an improvement in the subject's disorder, a reduction in the severity of the disorder, or an inhibition of progression or worsening of the disorder (e.g., stabilizing the disorder).
  • an improvement can be a lowering or a reduction in one or more symptoms or effects of the disorder.
  • a therapeutic benefit or improvement therefore need not be complete ablation of any one, most or all symptoms, complications, consequences or underlying causes associated with the disorder or disease.
  • a satisfactory endpoint is achieved when there is a transient, medium or long term, incremental improvement in a subject's condition, or a partial reduction in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of one or more associated adverse symptoms or complications or consequences or underlying causes, worsening or progression (e.g., stabilizing one or more symptoms or complications of the condition, disorder or disease), of the disorder or disease, over a duration of time (hours, days, weeks, months, etc.).
  • the amount of the peptide (and optionally the additional agent Sufficient to ameliorate a disorder will depend on the type, severity and extent, or duration of the disorder, the therapeutic effect or outcome desired, and can be readily ascertained by the skilled artisan. Appropriate amounts will also depend upon the individual subject (e.g., the bioavailability within the subject, gender, age, etc.).
  • a transient, or partial, restoration of normal bile acid homeostasis in a subject can reduce the dosage amount or frequency of the peptides and agents described herein in order to treat the metabolic or associated disorders described previously even though complete freedom from treatment has not resulted.
  • An effective amount can be ascertained, for example, by measuring one or more relevant physiological effects.
  • Methods and uses provided herein for treating a subject are applicable for prophylaxis to prevent or reduce the likelihood of a disorder in a subject, such as a metabolic or associated disorder. Accordingly, methods and uses provided herein for treating a subject having, or at risk of developing, a metabolic or associated disorder can be practiced prior to, substantially contemporaneously with, or following administration or application of another agent useful for the treatment or prevention of a metabolic or associated disorder, and/or can be supplemented with other forms of therapy.
  • Supplementary therapies include other glucose lowering treatments, such as insulin, an insulin sensitivity enhancer and other drug treatments, a change in diet (low sugar, fats, etc.), weight loss surgery- (reducing stomach volume by gastric bypass, gastrectomy), gastric banding, gastric balloon, gastric sleeve, etc.
  • a method or use provided herein for treating a hyperglycemic or insulin resistance disorder can be used in combination with drugs or other pharmaceutical compositions that lower glucose or increase insulin sensitivity in a subject.
  • a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for preventing a metabolic or associated disorder. In one embodiment, a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for treating a metabolic or associated disorder. In one embodiment, a method or use includes contacting or administering to a subject one or more variant or fusion FGF19 and/or FGF21 peptide sequences in an amount effective for managing a metabolic or associated disorder.
  • nucleic acid molecules encoding peptide sequences provided herein, including subsequences, sequence variants and modified forms of the sequences listed in the Sequence Listing (and in PCT Pub. No. WO 2013/006486 and US Pub. No. 2013/0023474, as well as PCT Publ. No. WO 2014/085365) or Tables 1-11, and vectors that include nucleic acid encoding the peptides used in the methods described herein.
  • nucleic acids include those that encode the exemplified peptide sequences disclosed herein, as well as those encoding functional subsequences, sequence variants and modified forms of the exemplified peptide sequences, so long as the foregoing retain at least detectable or measureable activity or function useful in the treatment or prevention of a bile acid-related or associated disorder (e.g., PBC).
  • a bile acid-related or associated disorder e.g., PBC
  • Nucleic acid which can also be referred to herein as a gene, polynucleotide, nucleotide sequence, primer, oligonucleotide or probe, refers to natural or modified purine- and pyrimidine-containing polymers of any length, either polyribonucleotides or
  • nucleic acid including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
  • the nucleic acids can be single strand, double, or triplex, linear or circular.
  • Nucleic acids include genomic DNA and cDNA.
  • RNA nucleic acid can be spliced or unspliced mRNA, rRNA, tRNA or antisense. Nucleic acids include naturally occurring, synthetic, as well as nucleotide analogs and derivatives.
  • nucleic acid molecules provided herein include sequences degenerate with respect to nucleic acid molecules encoding the peptide sequences useful in the methods provided herein.
  • degenerate nucleic acid sequences encoding peptide sequences including subsequences, variants and modified forms of the peptide sequences exemplified herein (e.g., in the Sequence Listing or Tables 1-11), are provided.
  • Nucleic acid can be produced using any of a variety of known standard cloning and chemical synthesis methods, and can be altered intentionally by site-directed mutagenesis or other recombinant techniques known to one skilled in the art. Purity of polynucleotides can be determined through, for example, sequencing, gel electrophoresis, and UV spectrometry.
  • Nucleic acids may be inserted into a nucleic acid construct in which expression of the nucleic acid is influenced or regulated by an "expression control element," referred to herein as an "expression cassette.”
  • expression control element refers to one or more nucleic acid sequence elements that regulate or influence expression of a nucleic acid sequence to which it is operatively linked.
  • An expression control element can include, as appropriate, promoters, enhancers, transcription terminators, gene silencers, a start codon (e.g., ATG) in front of a protein-encoding gene, etc.
  • An expression control element operatively linked to a nucleic acid sequence controls transcription and, as appropriate, translation of the nucleic acid sequence.
  • the term "operatively linked” refers to a juxtaposition wherein the referenced components are in a relationship permitting them to function in their intended manner.
  • expression control elements are juxtaposed at the 5' or the 3' ends of the genes but can also be intronic.
  • Expression control elements include elements that activate transcription
  • control elements sufficient to render gene expression controllable for specific cell types or tissues (i.e., tissue-specific control elements). Typically, such elements are located upstream or downstream (i.e., 5' or 3') of the coding sequence. Promoters are generally positioned 5' of the coding sequence. Promoters, produced by recombinant DNA or synthetic techniques, can be used to provide for transcription of the polynucleotides provided herein.
  • a "promoter” typically means a minimal sequence element sufficient to direct transcription.
  • Nucleic acids may be inserted into a plasmid for transformation into a host cell and for subsequent expression and/or genetic manipulation.
  • a plasmid is a nucleic acid that can be stably propagated in a host cell; plasmids may optionally contain expression control elements in order to drive expression of the nucleic acid.
  • a vector is synonymous with a plasmid. Plasmids and vectors generally contain at least an origin of replication for propagation in a cell and a promoter.
  • Plasmids and vectors may also include an expression control element for expression in a host cell, and are therefore useful for expression and/or genetic manipulation of nucleic acids encoding peptide sequences, expressing peptide sequences in host cells and organisms, or producing peptide sequences, for example.
  • transgene means a polynucleotide that has been introduced into a cell or organism by artifice.
  • the transgene has been introduced by genetic manipulation or "transformation” of the cell.
  • a cell or progeny thereof into which the transgene has been introduced is referred to as a "transformed cell” or “transformant.”
  • the transgene is included in progeny of the transformant or becomes a part of the organism that develops from the cell.
  • Transgenes may be inserted into the chromosomal DNA or maintained as a self-replicating plasmid, YAC, minichromosome, or the like.
  • Bacterial system promoters include T7 and inducible promoters such as pL of bacteriophage ⁇ , plac, ptrp, ptac (ptrp-lac hybrid promoter) and tetracycline-responsive promoters.
  • Insect cell system promoters include constitutive or inducible promoters (e.g., ecdysone).
  • Mammalian cell constitutive promoters include SV40, RSV, bovine papilloma virus (BPV) and other virus promoters, or inducible promoters derived from the genome of mammalian cells (e.g., metallothionein IIA promoter; heat shock promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the inducible mouse mammary tumor virus long terminal repeat).
  • a retroviral genome can be genetically modified for introducing and directing expression of a peptide sequence in appropriate host cells.
  • expression systems further include vectors designed for in vivo use.
  • vectors designed for in vivo use include adenoviral vectors (U.S. Patent Nos. 5,700,470 and 5,731, 172), adeno-associated vectors (U.S. Patent No. 5,604,090), herpes simplex virus vectors (U.S. Patent No. 5,501,979), retroviral vectors (U.S. Patent Nos. 5,624,820, 5,693,508 and 5,674,703), BPV vectors (U.S. Patent No. 5,719,054), CMV vectors (U.S. Patent No.
  • Vectors include those that deliver genes to cells of the intestinal tract, including the stem cells (Croyle et al, Gene Ther. 5:645 (1998); S.J. Henning, Adv. Drug Deliv. Rev. 17:341 (1997), U.S. Patent Nos. 5,821,235 and 6, 110,456). Many of these vectors have been approved for human studies.
  • Yeast vectors include constitutive and inducible promoters (see, e.g., Ausubel et al, In: Current Protocols in Molecular Biology, Vol. 2, Ch. 13, ed., Greene Publish. Assoc. & Wiley Interscience, 1988; Grant et al. Methods in Enzymology, 153 :516 (1987), eds. Wu & Grossman; Bitter Methods in Enzymology, 152:673 (1987), eds. Berger & Kimmel, Acad. Press, N.Y.; and, Strathern et al, The Molecular Biology of the Yeast Saccharomyces (1982) eds. Cold Spring Harbor Press, Vols.
  • a constitutive yeast promoter such as ADH or LEU2 or an inducible promoter such as GAL may be used (R. Rothstein In: DNA Cloning, A Practical Approach. Vol.11, Ch. 3, ed. D M. Glover, IRL Press, Wash., D.C., 1986).
  • Vectors that facilitate integration of foreign nucleic acid sequences into a yeast chromosome, via homologous recombination for example, are known in the art.
  • Yeast artificial chromosomes YAC are typically used when the inserted polynucleotides are too large for more conventional vectors (e.g., greater than about 12 Kb).
  • Expression vectors also can contain a selectable marker conferring resistance to a selective pressure or identifiable marker (e.g., beta-galactosidase), thereby allowing cells having the vector to be selected for, grown and expanded.
  • a selectable marker can be on a second vector that is co-transfected into a host cell with a first vector containing a nucleic acid encoding a peptide sequence.
  • Selection systems include, but are not limited to, herpes simplex virus thymidine kinase gene (Wigler et al, Cell 11 :223 (1977)), hypoxanthine-guanine phosphoribosyltransferase gene (Szybalska et al, Proc.
  • neomycin gene which confers resistance to aminoglycoside G-418 (Colberre-Garapin et al, J. Mol. Biol. 150: 1(1981)); puromycin; and hygromycin gene, which confers resistance to hygromycin (Santerre et al, Gene 30: 147 (1984)).
  • Additional selectable genes include trpB, which allows cells to utilize indole in place of tryptophan; hisD, which allows cells to utilize histinol in place of histidine (Hartman et al, Proc. Natl. Acad. Sci.
  • a transformed cell(s) in vitro, ex vivo and in vivo and host cells that produce a variant or fusion of FGF19 and/or FGF21 as set forth herein, where expression of the variant or fusion of FGF19 and/or FGF21 is conferred by a nucleic acid encoding the variant or fusion of FGF19 and/or FGF21.
  • a "transformed" or "host” cell is a cell into which a nucleic acid is introduced that can be propagated and/or transcribed for expression of an encoded peptide sequence. The term also includes any progeny or subclones of the host cell.
  • Transformed and host cells that express peptide sequences provided herein typically include a nucleic acid that encodes the peptide sequence.
  • a transformed or host cell is a prokaryotic cell.
  • a transformed or host cell is a eukaryotic cell.
  • the eukaryotic cell is a yeast or mammalian (e.g., human, primate, etc.) cell.
  • Transformed and host cells include but are not limited to microorganisms such as bacteria and yeast; and plant, insect and mammalian cells.
  • bacteria transformed with recombinant bacteriophage nucleic acid, plasmid nucleic acid or cosmid nucleic acid expression vectors yeast transformed with recombinant yeast expression vectors
  • plant cell systems infected with recombinant virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV
  • recombinant plasmid expression vectors e.g., Ti plasmid
  • insect cell systems infected with recombinant virus expression vectors e.g., baculovirus
  • animal cell systems infected with recombinant virus expression vectors e.g., retroviruses, adenovirus, vaccinia virus, or transformed animal cell systems engineered for transient or stable propagation or expression.
  • a transformed cell can be in a subject.
  • a cell in a subject can be transformed with a nucleic acid that encodes a peptide sequence as set forth herein in vivo.
  • a cell can be transformed in vitro with a transgene or polynucleotide, and then transplanted into a tissue of subject in order to effect treatment.
  • a primary cell isolate or an established cell line can be transformed with a transgene or polynucleotide that encodes a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, and then optionally transplanted into a tissue of a subject.
  • a transgene or polynucleotide that encodes a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, and then optionally transplanted into a tissue of a subject.
  • Non-limiting target cells for expression of peptide sequences include pancreas cells (islet cells), muscle cells, mucosal cells and endocrine cells.
  • pancreas cells islet cells
  • muscle cells can provide inducible production (secretion) of a variant of FGF19 and/or FGF21, or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21.
  • Additional cells to transform include stem cells or other multipotent or pluripotent cells, for example, progenitor cells that differentiate into the various pancreas cells (islet cells), muscle cells, mucosal cells and endocrine cells.
  • Targeting stem cells provides longer term expression of peptide sequences provided herein.
  • the term "cultured,” when used in reference to a cell means that the cell is grown in vitro.
  • a particular example of such a cell is a cell isolated from a subject, and grown or adapted for growth in tissue culture.
  • Another example is a cell genetically manipulated in vitro, and transplanted back into the same or a different subject.
  • isolated when used in reference to a cell, means a cell that is separated from its naturally occurring in vivo environment. "Cultured” and “isolated” cells may be manipulated by the hand of man, such as genetically transformed. These terms include any progeny of the cells, including progeny cells that may not be identical to the parental cell due to mutations that occur during cell division. The terms do not include an entire human being.
  • Nucleic acids encoding peptide sequences provided herein can be introduced for stable expression into cells of a whole organism. Such organisms, including non-human transgenic animals, are useful for studying the effect of peptide expression in a whole animal and therapeutic benefit.
  • nucleic acids for production of a variant of FGF19 and/or FGF21 or a fusion/chimeric sequence (or variant) thereof such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21 as set forth herein, can be introcued for stable expression in mice.
  • mice strains that develop or are susceptible to developing a particular disease are also useful for introducing therapeutic proteins as described herein in order to study the effect of therapeutic protein expression in the disease- susceptible mouse.
  • Transgenic and genetic animal models that are susceptible to particular disease or physiological conditions such as streptozotocin (STZ)-induced diabetic (STZ) mice, are appropriate targets for expressing variants of FGF19 and/or FGF21, fusions/chimeric sequences (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, as set forth herein.
  • STZ streptozotocin
  • non-human transgenic animals that produce a variant of FGF19 and/or FGF21, or a fusion/chimeric sequence (or variant) thereof, such as a chimeric peptide sequence including all or a portion of FGF19, or including all or a portion of FGF21, the production of which is not naturally occurring in the animal which is conferred by a transgene present in somatic or germ cells of the animal.
  • transgenic animal refers to an animal whose somatic or germ line cells bear genetic information received, directly or indirectly, by deliberate genetic manipulation at the subcellular level, such as by microinjection or infection with recombinant virus.
  • transgenic further includes cells or tissues (i.e., "transgenic cell,” “transgenic tissue”) obtained from a transgenic animal genetically manipulated as described herein.
  • a transgenic animal does not encompass animals produced by classical crossbreeding or in vitro fertilization, but rather denotes animals in which one or more cells receive a nucleic acid molecule.
  • Transgenic animals provided herein can be either heterozygous or homozygous with respect to the transgene.
  • mice including mice, sheep, pigs and frogs
  • transgenic animals including mice, sheep, pigs and frogs
  • U.S. Patent Nos. 5,721,367, 5,695,977, 5,650,298, and 5,614,396 are well known in the art (see, e.g., U.S. Patent Nos. 5,721,367, 5,695,977, 5,650,298, and 5,614,396) and, as such, are additionally included.
  • transformed host cells expressing peptide sequences include isolated and purified forms.
  • isolated when used as a modifier of a composition provided herein, means that the composition is separated, substantially, completely, or at least in part, from one or more components in an environment.
  • compositions that exist in nature, when isolated are substantially free of one or more materials with which they normally associate with in nature, for example, one or more protein, nucleic acid, lipid, carbohydrate or cell membrane.
  • isolated does not exclude alternative physical forms of the composition, such as variants, modifications or derivatized forms, fusions and chimeras, multimers/oligomers, etc., or forms expressed in host cells.
  • isolated also does not exclude forms ⁇ e.g., pharmaceutical compositions, combination compositions, etc.) in which there are combinations therein, any one of which is produced by the hand of man.
  • An “isolated” composition can also be “purified” when free of some, a substantial number of, or most or all of one or more other materials, such as a contaminant or an undesired substance or material.
  • the term "recombinant,” when used as a modifier of peptide sequences, nucleic acids encoding peptide sequences, etc., means that the compositions have been manipulated ⁇ i.e., engineered) in a fashion that generally does not occur in nature ⁇ e.g., in vitro).
  • a particular example of a recombinant peptide would be where a peptide sequence provided herein is expressed by a cell transfected with a nucleic acid encoding the peptide sequence.
  • a particular example of a recombinant nucleic acid would be a nucleic acid ⁇ e.g., genomic or cDNA) encoding a peptide sequence cloned into a plasmid, with or without 5', 3' or intron regions that the gene is normally contiguous within the genome of the organism.
  • Another example of a recombinant peptide or nucleic acid is a hybrid or fusion sequence, such as a chimeric peptide sequence comprising a portion of FGF19 and a portion of FGF21.
  • compositions and mixtures of peptide sequences provided herein including subsequences, variants and modified forms of the exemplified peptide sequences (including the FGF19 and FGF21 variants and subsequences listed in Tables 1-11 and the Sequence Listing, and the FGF19/FGF21 fusions and chimeras listed in Tables 1-11 and the Sequence Listing).
  • a mixture includes one or more peptide sequences and a pharmaceutically acceptable carrier or excipient.
  • a mixture in another embodiment, includes one or more peptide sequences and an adjunct drug or therapeutic agent, such as a bile acid homeostasis modulating or anti-diabetic, or glucose lowering, drug or therapeutic agent.
  • an adjunct drug or therapeutic agent such as a bile acid homeostasis modulating or anti-diabetic, or glucose lowering, drug or therapeutic agent.
  • Combinations such as one or more peptide sequences in a pharmaceutically acceptable carrier or excipient, with one or more of a bile acid homeostasis modulating or a treatment for a bile acid-related or associated disorder, or anti-diabetic, or glucose lowering drug or therapeutic agent are also provided.
  • Such combinations of a peptide sequence provided herein with another drug or agent, such as a bile acid homeostasis modulating or acid related disorder treating, or glucose lowering drug or therapeutic agent, for example are useful in accordance with the methods and uses provided herein, for example, for treatment of a subject.
  • Combinations also include incorporation of peptide sequences or nucleic acids provided herein into particles or a polymeric substances, such as polyesters, carbohydrates, polyamine acids, hydrogel, polyvinyl pyrrolidone, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers,
  • microcapsules prepared by coacervation techniques or by interfacial polymerization, for example, by the use of hydroxymethylcellulose or gelatin-microcapsules, or poly
  • methylmethacrolate microcapsules incorporation in colloid drug delivery and dispersion systems such as macromolecule complexes, nano-capsules, non-encapsulated nanoparticles, microspheres, beads, and lipid-based systems (e.g., N-fatty acyl groups such as N- lauroyl, N-oleoyl, fatty amines such as dodecyl amine, oleoyl amine, etc., see US Patent No. 6,638,513), including oil-in-water emulsions, micelles, mixed micelles, and liposomes, for example. Methods of preparing liposomes are described in, for example, U.S. Patent Nos.
  • the peptides provided herein including subsequences, variants and modified forms of the exemplified peptide sequences (including the FGF19 and FGF21 variants and subsequences listed in Tables 1-11 and the Sequence Listing, and the FGF19/FGF21 fusions and chimeras listed in Tables 1-11 and the Sequence Listing) as set forth herein can be used to modulate glucose metabolism and facilitate transport of glucose from the blood to key metabolic organs such as muscle, liver and fat.
  • Such peptide sequences can be produced in amounts sufficient or effective to restore glucose tolerance and/or to improve or provide normal glucose homeostasis.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
  • Dermatology (AREA)
PCT/US2016/060944 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders Ceased WO2017083276A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
AU2016353988A AU2016353988B2 (en) 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders
ES16864846T ES2871036T3 (es) 2015-11-09 2016-11-08 Método para el tratamiento de trastornos relacionados con ácidos biliares
EP16864846.7A EP3377090B1 (en) 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders
JP2018522589A JP6728352B2 (ja) 2015-11-09 2016-11-08 胆汁酸に関係した障害の治療方法
EP21162848.2A EP3888672A1 (en) 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders
CA3003616A CA3003616C (en) 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders
US15/773,120 US10744185B2 (en) 2015-11-09 2016-11-08 Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US16/917,284 US20200390859A1 (en) 2015-11-09 2020-06-30 Methods for treatment of bile acid-related disorders

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562252939P 2015-11-09 2015-11-09
US62/252,939 2015-11-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/773,120 A-371-Of-International US10744185B2 (en) 2015-11-09 2016-11-08 Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US16/917,284 Continuation US20200390859A1 (en) 2015-11-09 2020-06-30 Methods for treatment of bile acid-related disorders

Publications (1)

Publication Number Publication Date
WO2017083276A1 true WO2017083276A1 (en) 2017-05-18

Family

ID=58695071

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/060944 Ceased WO2017083276A1 (en) 2015-11-09 2016-11-08 Methods for treatment of bile acid-related disorders

Country Status (7)

Country Link
US (2) US10744185B2 (https=)
EP (2) EP3377090B1 (https=)
JP (3) JP6728352B2 (https=)
AU (1) AU2016353988B2 (https=)
CA (2) CA3082794A1 (https=)
ES (1) ES2871036T3 (https=)
WO (1) WO2017083276A1 (https=)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9878008B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
WO2019051073A1 (en) * 2017-09-08 2019-03-14 Bristol-Myers Squibb Company MODIFIED FIBROBLAST GROWTH FACTOR 21 (FGF-21) FOR USE IN NON-ALCOHOLIC STÉATOHÉPATITE (NASH) TREATMENT METHODS
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
US10413590B2 (en) 2011-07-01 2019-09-17 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
EP3503906A4 (en) * 2016-08-29 2020-04-08 NGM Biopharmaceuticals, Inc. METHODS FOR THE TREATMENT OF DISORDERS ASSOCIATED WITH BILAR ACIDS
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
JP2023520285A (ja) * 2021-03-12 2023-05-17 江南大学 代謝障害に対する新規なfgf19タンパク質類似物質及びその使用
EP3955954A4 (en) * 2019-04-17 2023-05-17 NGM Biopharmaceuticals, Inc. COMBINATION THERAPY FOR MODULATION OF BILE ACID HOMEOSTASIS AND TREATMENT OF BILE ACID DISORDERS AND DISEASES

Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5501979A (en) 1989-02-01 1996-03-26 The General Hospital Corporation Herpes simplex virus type I expression vector
US5561063A (en) 1987-06-26 1996-10-01 Syntro Corporation Recombinant human cytomegalovirus containing foreign gene
US5604090A (en) 1994-06-06 1997-02-18 Fred Hutchinson Cancer Research Center Method for increasing transduction of cells by adeno-associated virus vectors
US5614396A (en) 1990-06-14 1997-03-25 Baylor College Of Medicine Methods for the genetic modification of endogenous genes in animal cells by homologous recombination
US5624820A (en) 1993-11-12 1997-04-29 Case Western Reserve University Episomal expression vector for human gene therapy
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
US5650298A (en) 1993-06-14 1997-07-22 Basf Aktiengesellschaft Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters
US5674703A (en) 1992-12-02 1997-10-07 Woo; Savio L. C. Episomal vector systems and related methods
US5693508A (en) 1994-11-08 1997-12-02 Chang; Lung-Ji Retroviral expression vectors containing MoMLV/CMV-IE/HIV-TAR chimeric long terminal repeats
US5695977A (en) 1995-08-31 1997-12-09 Genetic Information Research Institute Site directed recombination
US5700470A (en) 1995-03-15 1997-12-23 Sumitomo Pharmaceuticals Company, Limited Recombinant adenovirus with removed EZA gene and method of preparation
US5719054A (en) 1991-03-14 1998-02-17 Cantab Pharmaceuticals Research Limited Recombinant virus vectors encoding human papillomavirus proteins
US5721367A (en) 1990-08-29 1998-02-24 Pharming B.V. Homologous recombination in mammalian cells
US5731172A (en) 1994-03-09 1998-03-24 Sumitomo Pharmaceuticals Company, Ltd. Recombinant adenovirus and process for producing the same
US5821235A (en) 1992-04-03 1998-10-13 Baylor College Of Medicine Gene therapy using the intestine
US5876969A (en) 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
US5919455A (en) 1993-10-27 1999-07-06 Enzon, Inc. Non-antigenic branched polymer conjugates
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US5985263A (en) 1997-12-19 1999-11-16 Enzon, Inc. Substantially pure histidine-linked protein polymer conjugates
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US6110456A (en) 1995-06-07 2000-08-29 Yale University Oral delivery or adeno-associated viral vectors
US6638513B2 (en) 1996-08-27 2003-10-28 Chiron S.R.L. Neisseria meningitidis serogroup B Glycoconjugates
US20050250684A1 (en) * 2002-09-18 2005-11-10 Eli Lilly And Company Patent Division Method for reducing morbidity and mortality in critically ill patients
WO2005118642A2 (en) 2004-06-01 2005-12-15 Domantis Limited Bispecific fusion antibodies with enhanced serum half-life
WO2006051288A2 (en) 2004-11-10 2006-05-18 Domantis Limited Ligands that enhance endogenous compounds
EP1517921B1 (en) 2002-06-28 2006-06-07 Domantis Limited Dual specific ligands with increased serum half-life
US20060258607A1 (en) 2005-04-08 2006-11-16 Noxxon Pharma Ag Ghrelin binding nucleic acids
US20070134197A1 (en) 2004-03-11 2007-06-14 Wolfram Eichner Conjugates of hydroxyalkyl starch and a protein, prepared by reductive amination
WO2013006486A2 (en) 2011-07-01 2013-01-10 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
WO2013033452A2 (en) * 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
WO2014085365A2 (en) 2012-11-28 2014-06-05 Ngm Biopharmaceuticals, Inc. Compositions and methods for treatment of metabolic disorders and diseases
US20140243266A1 (en) * 2012-12-27 2014-08-28 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
WO2014152089A1 (en) * 2013-03-14 2014-09-25 Georgetown University Compositions and treatments of metabolic disorders using fgf binding protein 3

Family Cites Families (168)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002008284A2 (en) 2000-07-20 2002-01-31 Genentech, Inc. Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis
US20020042367A1 (en) 1997-11-25 2002-04-11 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20020012961A1 (en) 1999-04-15 2002-01-31 Genentech, Inc. Fibroblast growth factor- 19
US20060246540A1 (en) 1997-08-26 2006-11-02 Ashkenazi Avi J Secreted and transmembrane polypeptides and nucleic acids encoding the same
US6806352B2 (en) 1997-09-17 2004-10-19 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030092002A1 (en) 1997-09-17 2003-05-15 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
NZ503343A (en) 1997-09-17 2002-09-27 Genentech Inc Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells
US20030113718A1 (en) 1997-09-17 2003-06-19 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20050026832A1 (en) 1997-11-25 2005-02-03 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20020155543A1 (en) 1997-11-25 2002-10-24 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20040126852A1 (en) 1997-11-25 2004-07-01 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity
AU3924300A (en) 1999-04-02 2000-10-23 Millennium Pharmaceuticals, Inc. Fibroblast growth factor-20
US7390879B2 (en) 1999-06-15 2008-06-24 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US7129072B1 (en) 1999-08-30 2006-10-31 New York University Crystal of fibroblast growth factor receptor 1 in complex with fibroblast growth factor
US7459540B1 (en) 1999-09-07 2008-12-02 Amgen Inc. Fibroblast growth factor-like polypeptides
AU7368100A (en) 1999-09-10 2001-04-10 Curagen Corporation Fibroblast growth factor polypeptide and nucleic acids encoding same
US6797695B1 (en) 1999-10-22 2004-09-28 Kyoto University Human FGF-20 gene and gene expression products
EP2163626A1 (en) 1999-11-18 2010-03-17 Novartis Vaccines and Diagnostics, Inc. Human FGF-21 gene and gene expression products
US6716626B1 (en) 1999-11-18 2004-04-06 Chiron Corporation Human FGF-21 nucleic acids
DE10160151A1 (de) 2001-01-09 2003-06-26 Ribopharma Ag Verfahren zur Hemmung der Expression eines vorgegebenen Zielgens
US20010044525A1 (en) 2000-01-05 2001-11-22 Conklin Darrell C. Novel FGF Homolog zFGF12
EP1246843A1 (en) 2000-01-05 2002-10-09 ZymoGenetics, Inc. Novel fgf homolog zfgf12
US20020081663A1 (en) 2000-01-05 2002-06-27 Conklin Darrell C. Novel FGF homolog ZFGF11
AU2631001A (en) 2000-01-05 2001-07-16 Zymogenetics Inc. Novel fgf homolog zfgf11
AU3976701A (en) 2000-02-15 2001-08-27 Amgen, Inc. Fibroblast growth factor-23 molecules and uses thereof
US20060160181A1 (en) 2000-02-15 2006-07-20 Amgen Inc. Fibroblast Growth Factor-23 molecules and uses thereof
US20030180312A1 (en) 2000-02-22 2003-09-25 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
AU2001245535A1 (en) 2000-03-08 2001-09-17 Chiron Corporation Human fgf-23 gene and gene expression products
WO2001066595A2 (en) 2000-03-08 2001-09-13 Chiron Corporation Human fgf-23 gene and gene expression products
US20020001825A1 (en) 2000-03-31 2002-01-03 Nobuyuki Itoh Fibroblast growth factor-like molecules and uses thereof
US20030065140A1 (en) 2000-04-03 2003-04-03 Vernet Corine A.M. Novel proteins and nucleic acids encoding same
JP2002112772A (ja) 2000-07-10 2002-04-16 Takeda Chem Ind Ltd 新規ポリペプチドおよびそのdna
ATE461213T1 (de) 2000-07-19 2010-04-15 Advanced Res & Tech Inst Neuer fibroblastwachstumsfaktor (fgf23) und methoden zur verwendung
US20070037165A1 (en) 2000-09-08 2007-02-15 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
US6812339B1 (en) 2000-09-08 2004-11-02 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
US7265210B2 (en) 2000-09-15 2007-09-04 Genentech, Inc. Anti-PRO9821 antibodies
IL139380A0 (en) 2000-10-31 2001-11-25 Prochon Biotech Ltd Active variants of fibroblast growth factor
US20030045489A1 (en) 2000-11-22 2003-03-06 Murphy John E. Methods for modulating angiogenesis
US20020151496A1 (en) 2000-12-08 2002-10-17 Bringmann Peter W. Novel fibroblast growth factors
DE10100587C1 (de) 2001-01-09 2002-11-21 Ribopharma Ag Verfahren zur Hemmung der Expression eines Zielgens
DE10100588A1 (de) 2001-01-09 2002-07-18 Ribopharma Ag Verfahren zur Hemmung der Expression eines Zielgens
US7164007B2 (en) 2001-06-20 2007-01-16 Genentech, Inc. Anti-PR020044 antibodies
WO2003080803A2 (en) 2002-03-21 2003-10-02 Smithkline Beecham Corporation Methods of using farnesoid x receptor (fxr) agonists
US6987121B2 (en) 2002-04-25 2006-01-17 Smithkline Beecham Corporation Compositions and methods for hepatoprotection and treatment of cholestasis
EP1553912A4 (en) 2002-06-07 2007-08-08 Genentech Inc COMPOSITIONS AND METHODS FOR TUMOR DIAGNOSIS AND TREATMENT
WO2004063355A2 (en) 2003-01-10 2004-07-29 Protein Design Labs, Inc. Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer
ATE385806T1 (de) 2003-06-12 2008-03-15 Lilly Co Eli Fusionsproteine
TWI476206B (zh) 2003-07-18 2015-03-11 Amgen Inc 對肝細胞生長因子具專一性之結合劑
EP2270163A1 (en) 2003-12-10 2011-01-05 Eli Lilly and Company Muteins of fibroblast growth factor 21
EP2194064A1 (en) 2004-05-13 2010-06-09 Eli Lilly & Company FGF-21 fusion proteins
JP2006016323A (ja) 2004-06-30 2006-01-19 Hiroshima Industrial Promotion Organization 生理活性バイオマテリアル
US7622445B2 (en) 2004-09-02 2009-11-24 Eli Lilly And Company Muteins of fibroblast growth factor 21
KR100854198B1 (ko) 2004-09-02 2008-08-26 일라이 릴리 앤드 캄파니 섬유아세포 성장 인자 21의 뮤테인
WO2006049854A2 (en) 2004-10-29 2006-05-11 Genentech, Inc. Disruptions of genes encoding secreted proteins, compositions and methods relating thereto
EP1815021A2 (en) 2004-11-03 2007-08-08 Almac Diagnostics Limited Transcriptome microarray technology and methods of using the same
US7655627B2 (en) 2004-12-14 2010-02-02 Eli Lilly And Company Muteins of fibroblast growth factor 21
US20060275794A1 (en) 2005-03-07 2006-12-07 Invitrogen Corporation Collections of matched biological reagents and methods for identifying matched reagents
EP2083081A1 (en) 2005-07-22 2009-07-29 Five Prime Therapeutics, Inc. Compositions and methods of treating disease with FGFR fusion proteins
CA2620082A1 (en) 2005-08-24 2007-03-01 Genizon Biosciences Inc. Genemap of the human genes associated with crohn's disease
EP2749571A3 (en) * 2006-01-10 2014-08-13 ZymoGenetics, Inc. Methods of treating pain and inflammation in neuronal tissue using IL-31RA and OSMRb antagonists
EP1987055A1 (en) 2006-02-10 2008-11-05 Dermagen AB Novel antimicrobial peptides and use thereof
US20100055730A1 (en) 2006-05-05 2010-03-04 Anny Usheva-Simidjiyska Methods for the Diagnosis and Treatment of Female Infertility Using Molecular Markers
US8168169B2 (en) 2006-08-09 2012-05-01 Mclean Hospital Corporation Methods and compositions for the treatment of medical disorders
CA2661332A1 (en) 2006-09-01 2008-03-13 American Type Culture Collection Compositions and methods for diagnosis and treatment of type 2 diabetes
EP2094733A1 (en) 2006-11-03 2009-09-02 U3 Pharma GmbH Fgfr4 antibodies
CA2901105C (en) 2007-01-03 2018-02-13 California Stem Cell, Inc. Stem cell growth media and methods of making and using same
CN107501407B (zh) 2007-03-30 2022-03-18 Ambrx公司 经修饰fgf-21多肽和其用途
CL2008000947A1 (es) 2007-04-02 2008-10-10 Genentech Inc Uso de un antagonista de la proteina beta-klotho (klb) para tratar trastornos asociados a la expresion o actividad de klb.
EP2036539A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Stable formulations of amylin and its analogues
US20120142546A1 (en) 2007-12-10 2012-06-07 The Johns Hopkins University Hypomethylated genes in cancer
EP2080812A1 (en) 2008-01-18 2009-07-22 Transmedi SA Compositions and methods of detecting post-stop peptides
TW200936156A (en) 2008-01-28 2009-09-01 Novartis Ag Methods and compositions using Klotho-FGF fusion polypeptides
US8420088B2 (en) 2008-01-28 2013-04-16 Novartis Ag Methods and compositions using FGF23 fusion polypeptides
US20090226459A1 (en) 2008-01-29 2009-09-10 Cold Spring Harbor Laboratory Role of fgf-19 in cancer diagnosis and treatment
NZ602702A (en) 2008-03-19 2014-03-28 Ambrx Inc Modified fgf-21 polypeptides and their uses
US20110015345A1 (en) 2008-03-19 2011-01-20 Ambrx, Inc. Modified FGF-23 Polypeptides and Their Uses
CA2719001A1 (en) 2008-03-21 2009-09-24 Podiceps B.V. Diagnostic of pre-symptomatic metabolic syndrome
CN101591653B (zh) 2008-05-27 2013-07-31 中国人民解放军军事医学科学院野战输血研究所 低表达cyp7a1的肝细胞及其构建方法
US8034770B2 (en) 2008-06-04 2011-10-11 Amgen Inc. FGF21 polypeptides comprising two or more mutations
CN102224419A (zh) 2008-06-18 2011-10-19 雅培制药有限公司 PlGF-1搭配诊断法和产物
FR2933702A1 (fr) 2008-07-08 2010-01-15 Sanofi Aventis Antagonistes specifiques du recepteur fgf-r4
WO2010006214A1 (en) 2008-07-09 2010-01-14 Ambrx, Inc. Fgf-21 neutralizing antibodies and their uses
EP2318529B1 (en) 2008-08-04 2017-10-18 Five Prime Therapeutics, Inc. Fgfr extracellular domain acidic region muteins
CA2739615C (en) 2008-10-10 2017-12-05 Amgen Inc. Fgf21 mutants comprising polyethylene glycol and uses thereof
JP2010124741A (ja) * 2008-11-27 2010-06-10 Toray Ind Inc 痒み評価のための病態モデル動物
WO2010065439A1 (en) 2008-12-05 2010-06-10 Eli Lilly And Company Variants of fibroblast growth factor 21
US20120035105A1 (en) 2009-01-09 2012-02-09 Sdg, Inc. Insulin Therapies for the Treatment of Diabetes, Diabetes Related Ailments, and/or Diseases or Conditions Other Than Diabetes or Diabetes Related Ailments
US20110268794A1 (en) 2009-01-09 2011-11-03 Camilleri Michael L Methods and materials for delivering bile acids
WO2010083051A2 (en) 2009-01-15 2010-07-22 ProChon Biotech, Ltd. Cartilage particle tissue mixtures optionally combined with a cancellous construct
ES2610356T3 (es) 2009-02-03 2017-04-27 Amunix Operating Inc. Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos
WO2010129600A2 (en) 2009-05-05 2010-11-11 Amgen Inc. Fgf21 mutants and uses thereof
WO2010129503A1 (en) 2009-05-05 2010-11-11 Amgen Inc. Fgf21 mutants and uses thereof
US8461111B2 (en) 2009-05-20 2013-06-11 Florida State University Research Foundation Fibroblast growth factor mutants having improved functional half-life and methods of their use
US10241093B2 (en) 2009-05-28 2019-03-26 The Cleveland Clinic Foundation Trimethylamine-containing compounds for diagnosis and prediction of disease
WO2010139741A1 (en) 2009-06-04 2010-12-09 Novartis Ag Fgf-21 for treating cancers
JP2012529463A (ja) 2009-06-11 2012-11-22 ノヴォ ノルディスク アー/エス 2型糖尿病を治療するための、glp−1とfgf21との組合せ
WO2011154349A2 (en) 2010-06-08 2011-12-15 Novo Nordisk A/S Fgf21 analogues and derivatives
MX2011013903A (es) 2009-06-17 2012-05-08 Amgen Inc Polipeptidos quimericos y usos de los mismos.
CN101993485B (zh) 2009-08-20 2013-04-17 重庆富进生物医药有限公司 促胰岛素分泌肽类似物同源二聚体及其用途
KR101952453B1 (ko) 2009-10-15 2019-02-26 제넨테크, 인크. 수용체 특이성이 변경된 키메라 섬유모세포 성장 인자
US8889621B2 (en) 2009-10-30 2014-11-18 New York University Inhibiting binding of FGF23 to the binary FGFR-Klotho complex for the treatment of hypophosphatemia
UA109888C2 (uk) 2009-12-07 2015-10-26 ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ
WO2011084808A2 (en) 2009-12-21 2011-07-14 Amunix Operating Inc. Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases
EP2460527A1 (en) 2010-01-21 2012-06-06 Sanofi Pharmaceutical composition for treating a metabolic syndrome
US20110195077A1 (en) 2010-01-29 2011-08-11 Novartis Ag Methods and compositions using fgf23 fusion ppolypeptides
CA2796055A1 (en) 2010-04-15 2011-10-20 Amgen Inc. Human fgf receptor and .beta.-klotho binding proteins
WO2011130729A2 (en) 2010-04-16 2011-10-20 Salk Institute For Biological Studies Methods for treating metabolic disorders using fgf
CN103415300B (zh) 2010-07-20 2018-02-23 诺沃—诺迪斯克有限公司 N‑末端修饰的fgf21化合物
JP2013537172A (ja) 2010-09-09 2013-09-30 トリフォイリウム エーピーエス 血管新生阻害剤の気道投与
MX360946B (es) 2010-09-22 2018-10-29 Amgen Inc Star Inmunoglobulinas portadoras y usos de las mismas.
CN102464712A (zh) 2010-11-11 2012-05-23 重庆富进生物医药有限公司 缺失型人成纤维细胞生长因子21变异体及其偶联物
US9023791B2 (en) 2010-11-19 2015-05-05 Novartis Ag Fibroblast growth factor 21 mutations
WO2012074989A2 (en) 2010-11-30 2012-06-07 Joslin Diabetes Center, Inc. Compositions and methods for the treatment of nervous disorders associated with diabetes
WO2012088379A2 (en) 2010-12-22 2012-06-28 Marcadia Biotech, Inc. Methods for treating metabolic disorders and obesity with gip and glp-1 receptor-active glucagon-based peptides
JP5850435B2 (ja) 2010-12-24 2016-02-03 国立研究開発法人産業技術総合研究所 ヒトfgf19活性の正確で高感度な測定方法ならびにヒトfgf19活性の制御剤
AU2012229107A1 (en) 2011-03-17 2013-09-19 Novartis Ag FGFR and ligands thereof as biomarkers for breast cancer in HR positive subjects
EP2694092B1 (en) 2011-04-08 2017-01-04 Amgen Inc. Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15)
WO2012140650A2 (en) 2011-04-12 2012-10-18 Hepacore Ltd. Conjugates of carboxy polysaccharides with fibroblast growth factors and variants thereof
AU2012254160A1 (en) 2011-05-10 2013-11-21 Amgen Inc. Method of identifying compounds that specifically modulate the interaction of FGFR1 and beta-Klotho
EA030462B1 (ru) 2011-05-16 2018-08-31 Дженентек, Инк. Агонисты fgfr1 и способы их применения
US9574002B2 (en) 2011-06-06 2017-02-21 Amgen Inc. Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
CA2838207A1 (en) 2011-06-08 2012-12-13 Denovo Biopharma (Hangzhou) Ltd. Co. Methods and compositions of predicting activity of retinoid x receptor modulator
US20140294820A1 (en) 2011-06-24 2014-10-02 University Of Miami Fibroblast growth factor receptor inhibition for the treatment of disease
EP2548570A1 (en) 2011-07-19 2013-01-23 Sanofi Pharmaceutical composition for treating a metabolic syndrome
WO2013027191A1 (en) 2011-08-25 2013-02-28 Novartis Ag Methods and compositions using fgf23 fusion polypeptides
UY34347A (es) 2011-09-26 2013-04-30 Novartis Ag Proteínas de función dual para tratar trastornos metabólicos
TWI593708B (zh) 2011-09-26 2017-08-01 諾華公司 治療代謝病症之融合蛋白質
AR087973A1 (es) 2011-10-04 2014-04-30 Lilly Co Eli Variantes del factor 21 del crecimiento de fibroblastos
CN103127503B (zh) 2011-11-23 2017-11-10 上海医学生命科学研究中心有限公司 拮抗和/或阻断IL‑6/IL‑6R/gp130信号通路在抗肝癌治疗中的用途
JP2015506944A (ja) 2012-01-18 2015-03-05 ジェネンテック, インコーポレイテッド Fgf19修飾薬を使用する方法
DK2817312T3 (en) * 2012-02-22 2016-04-11 Leo Pharma As UNKNOWN UNKNOWN NEUROKININ-1 RECEPTOR ANTAGONIST RELATIONS
WO2013131091A1 (en) 2012-03-02 2013-09-06 New York University Chimeric fgf21 proteins with enhanced binding affinity for beta-klotho for the treatment of type ii diabetes, obesity and related metabolic disorders
JP2013194049A (ja) 2012-03-23 2013-09-30 Kazuo Todokoro ヒト造血幹細胞を増幅させるための組成物及び方法
WO2013151665A2 (en) 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
US9771567B2 (en) 2012-04-16 2017-09-26 Tel Hashomer Medical Research Infrastructure And Services Ltd. Klotho variant polypeptides
MA37506B1 (fr) 2012-05-15 2017-03-31 Lilly Co Eli Utilisations thérapeutiques de protéines de facteur de croissance des fibroblastes 21
US9464126B2 (en) 2012-06-07 2016-10-11 New York University Chimeric fibroblast growth factor 21 proteins and methods of use
US9657075B2 (en) 2012-06-07 2017-05-23 New York University Chimeric fibroblast growth factor 23 proteins and methods of use
US9474785B2 (en) 2012-06-07 2016-10-25 New York University Chimeric fibroblast growth factor 19 proteins and methods of use
CA2871656A1 (en) 2012-06-11 2013-12-19 Eli Lilly And Company Fibroblast growth factor 21 variants
TWI513705B (zh) 2012-06-11 2015-12-21 Lilly Co Eli 纖維母細胞生長因子21蛋白質
SG11201500125QA (en) 2012-07-11 2015-02-27 Blueprint Medicines Corp Inhibitors of the fibroblast growth factor receptor
TW201420606A (zh) 2012-08-22 2014-06-01 Lilly Co Eli 同源二聚體蛋白
JP2015533483A (ja) 2012-09-07 2015-11-26 サノフイ メタボリックシンドロームを治療するための融合タンパク質
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
ES2915851T3 (es) 2012-12-27 2022-06-27 Ngm Biopharmaceuticals Inc Péptidos quiméricos de FGF19 para usar en el tratamiento de trastornos de ácidos biliares
US9550820B2 (en) 2013-02-22 2017-01-24 New York University Chimeric fibroblast growth factor 23/fibroblast growth factor 19 proteins and methods of use
US9789160B2 (en) 2013-03-14 2017-10-17 Georgetown University Treatments for lowering glucose levels using FGF binding protein 3
WO2014152090A1 (en) 2013-03-14 2014-09-25 Georgetown University Compositions and treatments of metabolic disorders using fgf binding protein 3 and fgf 19
WO2014149699A1 (en) 2013-03-15 2014-09-25 Eli Lilly And Company Bifunctional protein
AU2014340241B2 (en) 2013-10-21 2018-11-01 Salk Institute For Biological Studies Mutated fibroblast growth factor (FGF) 1 and methods of use
CA2927592C (en) 2013-10-28 2020-08-18 Ngm Biopharmaceuticals, Inc. Fgf-19 variants for treating a fgf-19 dependent cancer or tumor
PE20170256A1 (es) 2014-01-24 2017-04-22 Ngm Biopharmaceuticals Inc Proteinas de union y sus metodos de uso
US20170173114A1 (en) 2014-05-07 2017-06-22 Joslin Diabetes Center, Inc. Methods and compositions for induction of ucp1 expression
WO2015183890A2 (en) 2014-05-28 2015-12-03 Ngm Biopharmaceuticals, Inc. Methods and compositions for the treatment of metabolic disorders and diseases
AU2015277438B2 (en) 2014-06-16 2020-02-27 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
WO2016048995A2 (en) * 2014-09-23 2016-03-31 Salk Institute For Biological Studies Fgf19 truncations and mutants and uses thereof
RU2729161C2 (ru) 2014-10-23 2020-08-04 ЭнДжиЭм БАЙОФАРМАСЬЮТИКАЛЗ, ИНК. Фармацевтические композиции, содержащие варианты пептидов, и способы их применения
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
EP3108893A1 (en) 2015-06-25 2016-12-28 Universite Claude Bernard - Lyon 1 Novel therapeutic use of fgf19
AU2016326689A1 (en) 2015-09-24 2018-03-22 Genentech, Inc. Methods for the treatment of epilepsy
JP6728352B2 (ja) 2015-11-09 2020-07-22 エヌジーエム バイオファーマシューティカルス,インコーポレーテッド 胆汁酸に関係した障害の治療方法
CA3034399A1 (en) 2016-08-26 2018-03-01 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
CA3034435A1 (en) 2016-08-29 2018-03-08 Lei Ling Methods for treatment of bile acid-related disorders
KR102340750B1 (ko) 2017-03-03 2021-12-21 에이치엘비테라퓨틱스 주식회사 티모신 베타 4를 유효성분으로 포함하는 안정화된 외용 제제
CN108619490A (zh) 2017-03-22 2018-10-09 天士力医药集团股份有限公司 一种长效化突变的人源成纤维生长因子的新用途
US20200330555A1 (en) 2017-04-21 2020-10-22 Ngm Biopharmaceuticals, Inc. Methods of treating gastrointestinal motility-related disorders using variants and fusions of fgf19/fgf21 polypeptides
AU2018297285A1 (en) 2017-07-06 2020-01-30 Yale University Compositions and methods for treating or preventing endocrine FGF-linked diseases

Patent Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5561063A (en) 1987-06-26 1996-10-01 Syntro Corporation Recombinant human cytomegalovirus containing foreign gene
US5501979A (en) 1989-02-01 1996-03-26 The General Hospital Corporation Herpes simplex virus type I expression vector
US5614396A (en) 1990-06-14 1997-03-25 Baylor College Of Medicine Methods for the genetic modification of endogenous genes in animal cells by homologous recombination
US5721367A (en) 1990-08-29 1998-02-24 Pharming B.V. Homologous recombination in mammalian cells
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5719054A (en) 1991-03-14 1998-02-17 Cantab Pharmaceuticals Research Limited Recombinant virus vectors encoding human papillomavirus proteins
US5876969A (en) 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
US7056701B2 (en) 1992-01-31 2006-06-06 Aventis Behring L.L.C. Hormone and albumin fusion protein
US5821235A (en) 1992-04-03 1998-10-13 Baylor College Of Medicine Gene therapy using the intestine
US5674703A (en) 1992-12-02 1997-10-07 Woo; Savio L. C. Episomal vector systems and related methods
US5650298A (en) 1993-06-14 1997-07-22 Basf Aktiengesellschaft Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
US5919455A (en) 1993-10-27 1999-07-06 Enzon, Inc. Non-antigenic branched polymer conjugates
US5624820A (en) 1993-11-12 1997-04-29 Case Western Reserve University Episomal expression vector for human gene therapy
US5731172A (en) 1994-03-09 1998-03-24 Sumitomo Pharmaceuticals Company, Ltd. Recombinant adenovirus and process for producing the same
US5604090A (en) 1994-06-06 1997-02-18 Fred Hutchinson Cancer Research Center Method for increasing transduction of cells by adeno-associated virus vectors
US5693508A (en) 1994-11-08 1997-12-02 Chang; Lung-Ji Retroviral expression vectors containing MoMLV/CMV-IE/HIV-TAR chimeric long terminal repeats
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US5700470A (en) 1995-03-15 1997-12-23 Sumitomo Pharmaceuticals Company, Limited Recombinant adenovirus with removed EZA gene and method of preparation
US6110456A (en) 1995-06-07 2000-08-29 Yale University Oral delivery or adeno-associated viral vectors
US5695977A (en) 1995-08-31 1997-12-09 Genetic Information Research Institute Site directed recombination
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US6638513B2 (en) 1996-08-27 2003-10-28 Chiron S.R.L. Neisseria meningitidis serogroup B Glycoconjugates
US5985263A (en) 1997-12-19 1999-11-16 Enzon, Inc. Substantially pure histidine-linked protein polymer conjugates
EP1517921B1 (en) 2002-06-28 2006-06-07 Domantis Limited Dual specific ligands with increased serum half-life
US20050250684A1 (en) * 2002-09-18 2005-11-10 Eli Lilly And Company Patent Division Method for reducing morbidity and mortality in critically ill patients
US20070134197A1 (en) 2004-03-11 2007-06-14 Wolfram Eichner Conjugates of hydroxyalkyl starch and a protein, prepared by reductive amination
WO2005118642A2 (en) 2004-06-01 2005-12-15 Domantis Limited Bispecific fusion antibodies with enhanced serum half-life
WO2006051288A2 (en) 2004-11-10 2006-05-18 Domantis Limited Ligands that enhance endogenous compounds
US20060258607A1 (en) 2005-04-08 2006-11-16 Noxxon Pharma Ag Ghrelin binding nucleic acids
WO2013006486A2 (en) 2011-07-01 2013-01-10 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
US20130023474A1 (en) 2011-07-01 2013-01-24 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
WO2013033452A2 (en) * 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
WO2014085365A2 (en) 2012-11-28 2014-06-05 Ngm Biopharmaceuticals, Inc. Compositions and methods for treatment of metabolic disorders and diseases
US20140243266A1 (en) * 2012-12-27 2014-08-28 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
WO2014152089A1 (en) * 2013-03-14 2014-09-25 Georgetown University Compositions and treatments of metabolic disorders using fgf binding protein 3

Non-Patent Citations (36)

* Cited by examiner, † Cited by third party
Title
ABRAMS, G.A. ET AL., HEPATOLOGY, vol. 40, no. 2, 2004, pages 475 - 83
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", vol. 2, 1988, GREENE PUBLISH. ASSOC.
BELOUSOV, NUCLEIC ACIDS RES., vol. 25, 1997, pages 3440
BLOMMERS, BIOCHEMISTRY, vol. 33, 1994, pages 7886
BOSTICK ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 304, 2003, pages 320
CARTER ET AL., NUCL. ACIDS RES., vol. 13, 1986, pages 4331
CARUTHERS, NUCLEIC ACIDS RES. SYMP. SER., 1980, pages 215
COLBERRE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 195
CROYLE ET AL., GENE THER., vol. 5, 1998, pages 645
FRENKEL, FREE RADIC. BIOL. MED., vol. 19, 1995, pages 373
GALMAN ET AL., J LIPID RES., vol. 44, no. 4, 2003, pages 859 - 66
GAO ET AL., J. VIROL., vol. 78, 2004, pages 6381
GRANT ET AL.: "Current Communications in Molecular Biology", vol. 152, 1987, COLD SPRING HARBOR LABORATORY, pages: 673
HARTMAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 8047
HRUBY ET AL.: "Synthetic Peptides: A User's Guide", BIOCHEM. J., vol. 268, 1990, pages 249
LIN ET AL.: "Adiponectin Mediates the Metabolic Effects of FGF21 on Glucose Homeostasis and Insulin Sensitivity in Mice", CELL METABOLISM, vol. 17, no. 5, 7 May 2013 (2013-05-07), pages 779 - 789, XP055380974 *
LOWY ET AL., CELL, vol. 22, 1980, pages 817
MERRIFIELD, METHODS ENZYMOL., vol. 289, 1997, pages 3
MOREIRA, R.K., ARCH PATHOL LAB MED, vol. 131, no. 11, 2007, pages 1728 - 34
MULLIGAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 2072
PAKULSKA ET AL., SCIENCE ADVANCES, vol. 2, no. 5, 2016, pages e1600519
PEARSON, METHODS MOL BIOL., vol. 132, 2000, pages 185
R. ROTHSTEIN: "DNA Cloning. A Practical Approach", vol. 11, 1986, IRL PRESS
ROBERGE, SCIENCE, vol. 269, 1995, pages 202
S.J. HENNING, ADV. DRUG DELIV. REV., vol. 17, 1997, pages 341
SANTERRE ET AL., GENE, vol. 30, 1984, pages 147
STRATHERN ET AL.: "The Molecular Biology of the Yeast Saccharomyces", vol. I and II, 1982, COLD SPRING HARBOR PRESS
SZYBALSKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 48, 1962, pages 2026
T. E. CREIGHTON: "Proteins: Structure and Molecular Properties", 1983, W.H. FREEMAN & CO., pages: 79 - 86
TONIOLO C., INT. J. PEPTIDE PROTEIN RES., vol. 35, 1990, pages 287
WELLS ET AL., GENE, vol. 34, 1985, pages 315
WELLS ET AL., PHILOS. TRANS. R. SOC. LONDON SERA, vol. 317, 1986, pages 415
WIGLER ET AL., CELL, vol. 11, 1977, pages 223
ZOLLER ET AL., NUCL. ACIDS RES., vol. 10, 1987, pages 6487
ZOLOTUKHIN S. ET AL., GENE THER., vol. 6, 1999, pages 973

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11065302B2 (en) 2011-07-01 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US10413590B2 (en) 2011-07-01 2019-09-17 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US10758590B2 (en) 2012-11-28 2020-09-01 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF 19 polypeptides for treating diabetes
US11103554B2 (en) 2012-12-27 2021-08-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis
US9889177B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having primary sclerosing cholangitis
US9974833B2 (en) 2012-12-27 2018-05-22 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having pregnancy intrahepatic cholestasis
US9878009B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having error of bile acid synthesis
US9889178B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having nonalcoholic steatohepatitis
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US11564972B2 (en) 2012-12-27 2023-01-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for treating primary biliary cirrhosis in a subject
US9895416B2 (en) 2012-12-27 2018-02-20 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having cholestasis
US9878008B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
US12378312B2 (en) 2014-01-24 2025-08-05 Ngm Biopharmaceuticals, Inc. Polynucleotides encoding human beta klotho antibodies or binding fragments thereof and methods of use thereof
US11596676B2 (en) 2014-01-24 2023-03-07 Ngm Biopharmaceuticals, Inc. Methods of treating nonalcoholic steatohepatitis comprising administering an anti-human beta klotho antibody or binding fragment thereof
US10744191B2 (en) 2014-01-24 2020-08-18 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins and methods of use thereof
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US11241481B2 (en) 2014-06-16 2022-02-08 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
US11141460B2 (en) 2014-11-07 2021-10-12 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US11667708B2 (en) 2015-07-29 2023-06-06 Ngm Biopharmaceuticals, Inc. Anti-human beta klotho antibody or binding fragment thereof and methods of their use
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
EP3503906A4 (en) * 2016-08-29 2020-04-08 NGM Biopharmaceuticals, Inc. METHODS FOR THE TREATMENT OF DISORDERS ASSOCIATED WITH BILAR ACIDS
CN111050786A (zh) * 2017-09-08 2020-04-21 百时美施贵宝公司 用于治疗非酒精性脂肪性肝炎(nash)的方法的修饰的成纤维细胞生长因子21(fgf-21)
US11642395B2 (en) 2017-09-08 2023-05-09 Bristol-Myers Squibb Company Modified fibroblast growth factor 21 (FGF-21) for use in methods for treating nonalcoholic steatohepatitis (NASH)
WO2019051073A1 (en) * 2017-09-08 2019-03-14 Bristol-Myers Squibb Company MODIFIED FIBROBLAST GROWTH FACTOR 21 (FGF-21) FOR USE IN NON-ALCOHOLIC STÉATOHÉPATITE (NASH) TREATMENT METHODS
EP3955954A4 (en) * 2019-04-17 2023-05-17 NGM Biopharmaceuticals, Inc. COMBINATION THERAPY FOR MODULATION OF BILE ACID HOMEOSTASIS AND TREATMENT OF BILE ACID DISORDERS AND DISEASES
JP2023520285A (ja) * 2021-03-12 2023-05-17 江南大学 代謝障害に対する新規なfgf19タンパク質類似物質及びその使用
EP4089106A4 (en) * 2021-03-12 2023-08-09 Jiangnan University NOVEL FGF ANALOGUE AGAINST METABOLIC DISORDERS AND ITS USE
JP7457413B2 (ja) 2021-03-12 2024-03-28 江南大学 代謝障害に対する新規なfgf19タンパク質類似物質及びその使用

Also Published As

Publication number Publication date
EP3377090A4 (en) 2018-12-05
CA3003616C (en) 2020-07-28
JP6728352B2 (ja) 2020-07-22
JP2018532749A (ja) 2018-11-08
EP3377090B1 (en) 2021-04-07
US20200390859A1 (en) 2020-12-17
AU2016353988B2 (en) 2019-09-26
EP3888672A1 (en) 2021-10-06
JP2020172509A (ja) 2020-10-22
ES2871036T3 (es) 2021-10-28
CA3003616A1 (en) 2017-05-18
US20180318390A1 (en) 2018-11-08
CA3082794A1 (en) 2017-05-18
JP6936366B2 (ja) 2021-09-15
AU2016353988A1 (en) 2018-05-10
EP3377090A1 (en) 2018-09-26
US10744185B2 (en) 2020-08-18
JP2021185178A (ja) 2021-12-09

Similar Documents

Publication Publication Date Title
US20200390859A1 (en) Methods for treatment of bile acid-related disorders
US11141460B2 (en) Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US11241481B2 (en) Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US20190175694A1 (en) Methods of Using Compositions Comprising Variants and Fusions of FGF19 Polypeptides for Treatment of Liver Fibrosis
US20190307847A1 (en) Methods for treatment of bile acid-related disorders
AU2020260110A1 (en) Combination therapy for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
WO2016065106A1 (en) Pharmaceutical compositions comprising peptide variants and methods of use thereof
EP2925775A2 (en) Compositions and methods for treatment of metabolic disorders and diseases

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16864846

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3003616

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2018522589

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 15773120

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2016353988

Country of ref document: AU

Date of ref document: 20161108

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE