WO2017044894A2 - Cartilage-homing peptides - Google Patents

Cartilage-homing peptides Download PDF

Info

Publication number
WO2017044894A2
WO2017044894A2 PCT/US2016/051166 US2016051166W WO2017044894A2 WO 2017044894 A2 WO2017044894 A2 WO 2017044894A2 US 2016051166 W US2016051166 W US 2016051166W WO 2017044894 A2 WO2017044894 A2 WO 2017044894A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
composition
administration
knotted peptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/051166
Other languages
English (en)
French (fr)
Other versions
WO2017044894A3 (en
Inventor
James Olson
Andrew David STRAND
Emily June GIRARD
Roland STRONG
Christopher Mehlin
Colin CORRENTI
Natalie NAIRN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Blaze Bioscience Inc
Fred Hutchinson Cancer Center
Original Assignee
Blaze Bioscience Inc
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Blaze Bioscience Inc, Fred Hutchinson Cancer Center filed Critical Blaze Bioscience Inc
Priority to CN201680053482.4A priority Critical patent/CN108135970B/zh
Priority to CA2994865A priority patent/CA2994865A1/en
Priority to EP16845226.6A priority patent/EP3347035A4/en
Priority to AU2016321342A priority patent/AU2016321342A1/en
Priority to JP2018510741A priority patent/JP6966424B2/ja
Priority to US15/758,320 priority patent/US11090358B2/en
Priority to BR112018004536A priority patent/BR112018004536A2/pt
Publication of WO2017044894A2 publication Critical patent/WO2017044894A2/en
Publication of WO2017044894A3 publication Critical patent/WO2017044894A3/en
Priority to IL257396A priority patent/IL257396B/en
Anticipated expiration legal-status Critical
Priority to US17/353,447 priority patent/US11648290B2/en
Priority to JP2021172263A priority patent/JP7378449B2/ja
Priority to US18/177,642 priority patent/US20230364183A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/56Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A61K31/57Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone
    • A61K31/573Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/66Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid the modifying agent being a pre-targeting system involving a peptide or protein for targeting specific cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/0019Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
    • A61K49/0021Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
    • A61K49/0032Methine dyes, e.g. cyanine dyes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0056Peptides, proteins, polyamino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/04Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43513Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
    • C07K14/43518Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from spiders
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43513Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
    • C07K14/43522Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from scorpions
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43563Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • Cartilage comprises chondrocytes, a specialized cell-type which produces components of the extracellular matrix, mainly including collagen, proteoglycans (e.g., aggrecan), and elastic fibers.
  • the extracellular matrix proteins provide support, cushion, and durability to cartilage-rich portions of the body such as joints, ears, nose and windpipe.
  • Cartilage is one of few tissues in the body which does not contain blood vessels and is considered an avascular tissue. Unlike many cells in the body which rely on a combination of blood flow and diffusion, chondrocytes rely on diffusion. Because it does not have a direct blood supply, compared to other connective tissues, cartilage grows and repairs much more slowly. As a result, cartilage disorders are particularly difficult to treat.
  • the present disclosure relates to compositions and methods for treatment of cartilage disorders. Described herein are peptides that home to, migrate to, accumulate in, bind to, are retained by, or are directed to, and/or bind in cartilage following administration in a subject.
  • the homing peptides of the present disclosure are used to deliver a detection agent to image and/or diagnose cartilage.
  • the homing peptides of the present disclosure are used to deliver an active agent to a region, tissue, structure, or cell thereof.
  • the present disclosure provides a knotted peptide, wherein upon administration to a subject the knotted peptide homes, targets, migrates to, accumulates in, binds to, is retained by, or is directed to a cartilage of the subject.
  • the knotted peptide comprises a sequence of any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or a fragment thereof. In other aspects, the knotted peptide comprises a sequence that has at least 80% sequence identity with any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or a fragment thereof.
  • the knotted peptide comprises a sequence that has at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or a fragment thereof.
  • the knotted peptide comprises a sequence of any one of SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or a fragment thereof. In other aspects, the knotted peptide comprises a sequence that has at least 80% sequence identity with any one of SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or a fragment thereof.
  • the knotted peptide comprises a sequence that has at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or a fragment thereof.
  • the knotted peptide comprises a sequence of any one of SEQ ID NO: 1 - SEQ ID NO: 20 or a fragment thereof. In other aspects, the knotted peptide comprises a sequence of any one of SEQ ID NO: 217 - SEQ ID NO: 236 or a fragment thereof.
  • the knotted peptide is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% identical to any one of SEQ ID NO: 436 - SEQ ID NO: 482.
  • the knotted peptide of claim 10 wherein the knotted peptide is SEQ ID NO: 24.
  • the knotted peptide is SEQ ID NO: 111.
  • the knotted peptide comprises 4 or more cysteine residues. In further aspects, the knotted peptide comprises three or more disulfide bridges formed between cysteine residues, wherein one of the disulfide bridges passes through a loop formed by two other disulfide bridges. In still further aspects, the knotted peptide comprises a plurality of disulfide bridges formed between cysteine residues. In other aspects, the knotted peptide comprises a disulfide through a disulfide knot.
  • At least one amino acid residue of the knotted peptide is in an L configuration or, wherein at least one amino acid residue of the knotted peptide is in a D configuration.
  • the sequence comprises at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, at least 50, at least 51, at least 52, at least 53, at least 54, at least 55, at least 56, at least 57, at least 58 residues, at least 59, at least 60, at least 61, at least 62, at least 63, at least 64, at least 65, at least 66, at least 67, at least 68, at least 69, at least 70, at least 71, at least 72, at least 73
  • any one or more K residues are replaced by an R residue or wherein any one or more R residues are replaced by for a K residue.
  • any one or more M residues are replaced by any one of the I, L, or V residues.
  • any one or more L residues are replaced by any one of the V, I, or M residues.
  • any one or more I residues are replaced by any of the M, L, or V residues.
  • any one or more V residues are replaced by any of the M, I, or L residues.
  • any one or more G residues are replaced by an A residue or wherein any one or more A residues are replaced by a G residue.
  • any one or more S residues are replaced by a T residue or wherein any one or more T residues are replaced by for an S residue.
  • any one or more Q residues are replaced by an N residue or wherein any one or more N residues are replaced by a Q residue.
  • any one or more D residues are replaced by an E residue or wherein any one or more E residues are replaced by a D residue.
  • the knotted peptide has a charge distribution comprising an acidic region and a basic region.
  • the acidic region is a nub.
  • the basic region is a patch.
  • the knotted peptide comprises 6 or more basic residues and 2 or fewer acidic residues.
  • the knotted peptide comprises a 4-19 amino acid residue fragment containing at least 2 cysteine residues, and at least 2 positively charged amino acid residues.
  • the knotted peptide comprises a 20-70 amino acid residue fragment containing at least 2 cysteine residues, no more than 2 basic residues and at least 2 positively charged amino acid residues. In still other aspects, the knotted peptide comprises at least 3 positively charged amino acid residues. In some aspects, the positively charged amino acid residues are selected from K, R, or a combination thereof.
  • the knotted peptide has a charge greater than 2 at physiological pH. In other aspects, the knotted peptide has a charge greater than 3.5 at physiological pH. In still other aspects, the knotted peptide has a charge greater than 4.5 at physiological pH. In some aspects, the knotted peptide has a charge greater than 5.5 at physiological pH. In other aspects, the knotted peptide has a charge greater than 6.5 at physiological pH. In other aspects, the knotted peptide has a charge greater than 7.5 at physiological pH.
  • the knotted peptide is selected from a potassium channel agonist, a potassium channel antagonist, a portion of a potassium channel, a sodium channel agonist, a sodium channel antagonist, a calcium channel agonist, a calcium channel antagonist, a hadrucalcin, a theraphotoxin, a huwentoxin, a kaliotoxin, a cobatoxin or a lectin.
  • the lectin is SHL-Ib2.
  • the knotted peptide is arranged in a multimeric structure with at least one other knotted peptide.
  • At least one residue of the knotted peptide comprises a chemical modification.
  • the chemical modification is blocking the N-terminus of the knotted peptide.
  • the chemical modification is methylation, acetylation, or acylation.
  • the chemical modification is: methylation of one or more lysine residues or analogue thereof; methylation of the N-terminus; or methylation of one or more lysine residue or analogue thereof and methylation of the N-terminus.
  • the knotted peptide is linked to an acyl adduct.
  • the knotted peptide is linked to an active agent.
  • the active agent is fused with the knotted peptide at an N-terminus or a C-terminus of the knotted peptide.
  • the active agent is an antibody.
  • the active agent is an Fc domain.
  • the knotted peptide fused with an Fc domain comprises a contiguous sequence.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 active agents are linked to the knotted peptide.
  • the knotted peptide is linked to the active agent via a cleavable linker.
  • the knotted peptide is linked to the active agent at an N- terminus, at the epsilon amine of an internal lysine residue, at the carboxylic acid of an aspartic acid or glutamic acid residue, or a C-terminus of the knotted peptide by a linker.
  • the knotted peptide further comprises a non-natural amino acid, wherein the non-natural amino acid is an insertion, appendage, or substitution for another amino acid.
  • the knotted peptide is linked to the active agent at the non-natural amino acid by a linker.
  • the linker comprises an amide bond, an ester bond, a carbamate bond, a carbonate bond, a hydrazone bond, an oxime bond, a disulfide bond, a thioester bond, or a carbon-nitrogen bond.
  • the cleavable linker comprises a cleavage site for matrix metalloproteinases, thrombin, cathepsins, or beta-glucuronidase.
  • the linker is a hydrolytically labile linker.
  • the knotted peptide is linked to the active agent via a noncleavable linker.
  • the active agent is: a peptide, an oligopeptide, a polypeptide, a polynucleotide, a polyribonucleotide, a DNA, a cDNA, a ssDNA, a RNA, a dsRNA, a micro RNA, an oligonucleotide, an antibody, an antibody fragment, an aptamer, a cytokine, an enzyme, a growth factor, a chemokine, a neurotransmitter, a chemical agent, a fluorophore, a metal, a metal chelate, an X-ray contrast agent, a PET agent, a radioisotope, a photo sensitizer, a radio sensitizer, a radionuclide chelator, a therapeutic small molecule, a steroid, a
  • corticosteroid an ant i- inflammatory agent, an immune modulator, a protease inhibitor, an amino sugar, a chemo therapeutic agent, a cytotoxic chemical, a toxin, a tyrosine kinase inhibitor, an ant i- infective agent, an antibiotic, an anti- viral agent, an anti-fungal agent, an aminoglycoside, a nonsteroidal anti- inflammatory drug (NSAID), a statin, a nanoparticle, a liposome, a polymer, a biopolymer, a polysaccharide, a proteoglycan, a glycosaminoglycan, a glucocorticoid, an anti-cytokine agent, a pain-reducing agent, a dendrimer, a fatty acid, an Fc region, or a combination thereof.
  • NSAID nonsteroidal anti- inflammatory drug
  • the NSAID is ketorolac. In other aspects, the NSAID is ibuprofen. In some aspects, the steroid is dexamethasone. In other aspects, the steroid is budesonide. In some aspects, the active agent induces programmed cell death. In further aspects, the programmed cell death is apoptosis. In some aspects, the active agent is a tumor necrosis factor alpha inhibitor. In further aspects, the active agent is a TNF receptor family activator. In still further aspects, the active agent is a TNF alpha antibody. In some aspects, the protease inhibitor is a coUagenase inhibitor, elastase inhibitor, or a matrix metalloprotease inhibitor. In further aspects, the matrix metalloprotease is MMP13.
  • the knotted peptide is linked to a detectable agent.
  • the detectable agent is fused with the knotted peptide at an N-terminus or a C-terminus of the knotted peptide.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 detectable agents are linked to the knotted peptide.
  • the knotted peptide is linked to the detectable agent via a cleavable linker.
  • the knotted peptide is linked to the detectable agent at an N-terminus, at the epsilon amine of an internal lysine residue, or a C-terminus of the knotted peptide by a linker.
  • the peptide further comprises a non-natural amino acid, wherein the non-natural amino acid is an insertion, appendage, or substitution for another amino acid.
  • the knotted peptide is linked to the active agent at the non-natural amino acid by a linker.
  • the linker comprises an amide bond, an ester bond, a carbamate bond, a hydrazone bond, an oxime bond, or a carbon-nitrogen bond.
  • the cleavable linker comprises a cleavage site for matrix metalloproteinases, thrombin, cathepsins, or beta-glucuronidase.
  • the knotted peptide is linked to the detectable agent via a noncleavable linker.
  • the detectable agent is a fluorophore, a near-infrared dye, a contrast agent, a nanoparticle, a metal-containing nanoparticle, a metal chelate, an X-ray contrast agent, a PET agent, a radioisotope, or a radionuclide chelator.
  • the detectable agent is a fluorescent dye.
  • the knotted peptide has an isoelectric point of about 9.
  • the knotted peptide is SEQ ID NO: 24. In other aspects, the knotted peptide is SEQ ID NO: 111.
  • the present disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising any of the above compositions or a salt thereof, and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition is formulated for administration to a subject.
  • the pharmaceutical composition is formulated for inhalation, intranasal administration, oral administration, topical administration, intravenous
  • administration subcutaneous administration, intra-articular administration, intramuscular administration, intraperitoneal administration, or a combination thereof.
  • the present disclosure provides a method of treating a condition in a subject in need thereof, the method comprising: administering to the subject a knotted peptide comprising any of the above compositions or any of the above pharmaceutical compositions.
  • the composition is administered by inhalation, intranasally, orally, topically, intravenously, subcutaneously, intra-articularly, intramuscularly administration, intraperitoneally, or a combination thereof.
  • the composition homes, targets, or migrates to cartilage of the subject following administration.
  • the condition is associated with a function of cartilage.
  • the condition is an inflammation, a cancer, a degradation, a growth disturbance, genetic, a tear, an infection, or an injury.
  • the condition is a
  • condition is a traumatic rupture or detachment.
  • condition is a costochondritis.
  • condition is a herniation.
  • condition is a polychondritis.
  • the condition is a chordoma.
  • the condition is a type of arthritis.
  • the type of arthritis is rheumatoid arthritis.
  • the type of arthritis is osteoarthritis.
  • the condition is achondroplasia.
  • the cancer is benign chondroma or malignant chondrosarcoma.
  • the condition is bursitis, tendinitis, gout, pseudogout, an arthropathy, or an infection.
  • the composition is administered to treat the injury, to repair a tissue damaged by the injury, or to treat a pain caused by the injury. In further aspects, the composition is administered to treat the tear or to repair a tissue damaged by the tear.
  • the present disclosure provides a method of imaging an organ or body region of a subject, the method comprising: administering to the subject composition of any one of knotted peptide previously described or a pharmaceutical composition as previously described; and imaging the subject.
  • the method further comprises detecting a cancer or diseased region, tissue, structure or cell. In further aspects, the method further comprises performing surgery on the subject. In some aspects, the method further comprises treating the cancer.
  • the surgery comprises removing the cancer or the diseased region, tissue, structure or cell of the subject.
  • the method further comprises imaging the cancer or diseased region, tissue, structure, or cell of the subject after surgical removal.
  • FIG. 1 illustrates the 14 C signal in the cartilage of animals treated with various peptides of this disclosure.
  • FIG. 1A illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 26.
  • FIG. IB illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 28.
  • FIG. 1C illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 24.
  • FIG. ID illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 23.
  • FIG. IE illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 27.
  • FIG. 1G illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 22.
  • FIG. 1H illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 31.
  • FIG. II illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 21.
  • FIG. 1J illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 29.
  • FIG. IK illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 30.
  • FIG. 1L illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 32.
  • FIG. 1M illustrates the 14 C signal in the cartilage of an animal treated with a peptide of SEQ ID NO: 27.
  • FIG. 2 illustrates the identification of the 14 C signal in the joint and other cartilage of an animal treated with the peptide of SEQ ID NO: 24.
  • FIG. 3 illustrates the identification of the 14 C signal in rib, spinal, and other cartilage of an animal treated with the peptide of SEQ ID NO: 24.
  • FIG. 4 illustrates the identification of locations the 14 C signal in the nasal, spinal, tracheal, and other cartilage of an animal treated with the peptide of SEQ ID NO: 24.
  • FIG. 5 illustrates the 14 C signal in the cartilage of an animal with intact kidneys 24 hours after treatment with a peptide of SEQ ID NO: 24.
  • FIG. 6 illustrates the High Performance Liquid Chromatography (HPLC) profiles of peptides of this disclosure.
  • FIG. 6A illustrates the HPLC profile of a peptide of FIG. ID and SEQ ID NO: 23.
  • FIG. 6B illustrates the HPLC profile of a peptide of FIG. 1C and SEQ ID NO: 24.
  • FIG. 7 illustrates the immunogenicity profiles of the peptides of SEQ ID NO: 21 - SEQ ID NO: 33.
  • FIG. 8 illustrates a three-dimensional structure and a line structure of a peptide of FIG. IB and SEQ ID NO: 28.
  • FIG. 9 illustrates an exemplary architecture of constructs expressing sequences of FIGS. 1A-1M and SEQ ID NO: X, where X can be any one of peptides of SEQ ID NO: 21 - SEQ ID NO: 33.
  • FIG. 10 illustrates a schematic of a method of manufacturing of a peptide of the disclosure.
  • FIG. 11 shows a white light image and corresponding autoradiographic image from a section of a mouse 24 hours after administration of 100 nmol of radiolabeled GS- Hainantoxin (GSKCLPPGKPCYGATQKIPCCGVCSHNNCT) (SEQ ID NO: 433) peptide, which does not home to cartilage.
  • FIG. 11A illustrates a white light image of a frozen section of a mouse 24 hours after administration of 100 nmol of SEQ ID NO: 433.
  • FIG. 11B shows an autoradiographic image corresponding to FIG. 11A in which the 14 C signal identifies the radiolabeled SEQ ID NO: 433 peptide.
  • FIG. 12 illustrates alignment of cartilage homers as depicted by the examples and of SEQ ID NO: 9, SEQ ID NO: 24, SEQ ID NO: 23, SEQ ID NO: 27, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 25, SEQ ID NO: 21, SEQ ID NO: 30, SEQ ID NO: 10, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 22 and SEQ ID NO: 33.
  • FIG. 13 shows a white light image and corresponding autoradiographic image of a frozen section of a mouse 4 hours after administration of 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 13A illustrates a white light image of a frozen section of the mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 13B illustrates an autoradiographic image corresponding to FIG. 13A in which the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the cartilage of the mouse 4 hours after administration of 100 nmol.
  • FIG. 14 shows a white light image and corresponding autoradiographic image of a frozen section of a mouse 24 hours after administration of 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 14A illustrates a white light image of a frozen section of the mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 14B illustrates an autoradiographic image corresponding to FIG. 14A in which the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the cartilage of the mouse 24 hours after administration of 100 nmol.
  • FIG. 15 shows white light images and corresponding autoradiographic images of frozen hind limb sections of a mouse 4 hours after administration of 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15A illustrates a white light image of a frozen section of a hind limb of a mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15B illustrates an autoradiographic image corresponding to FIG. 15A in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 15A illustrates a white light image of a frozen section of a hind limb of a mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15B illustrates an autoradiographic image corresponding to FIG. 15A in which the the 14 C signal identifies the radiolabele
  • FIG. 15C illustrates an autoradiographic image in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 15D illustrates a white light image of a frozen section of a hind limb of a mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15E illustrates an autoradiographic image corresponding to FIG. 15D in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 15C illustrates an autoradiographic image in which the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 15F illustrates a white light image of a frozen section of a hind limb of a mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15G illustrates an autoradiographic image corresponding to FIG. 15F in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 16 shows white light images and corresponding autoradiographic images of frozen hind limb sections of a mouse 24 hours after administration of 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 16A illustrates a white light image of a frozen section of a hind limb of a mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 16B illustrates an autoradiographic image corresponding to FIG. 16A in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 24 hours after administration of 100 nmol.
  • FIG. 16A illustrates a white light image of a frozen section of a hind limb of a mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 16B illustrates an autoradiographic image corresponding to FIG. 16A in which the the 14 C signal identifies the radiolabele
  • FIG. 16C illustrates a white light image of a frozen section of a hind limb of a mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 16D illustrates an autoradiographic image corresponding to FIG. 16C in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 24 hours after administration of 100 nmol.
  • FIG. 16E illustrates a white light image of a frozen section of a hind limb of a mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 16F illustrates an autoradiographic image corresponding to FIG.
  • FIG. 16E in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 24 hours after administration of 100 nmol.
  • FIG. 16G illustrates an autoradiographic image in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 24 hours after administration of 100 nmol.
  • FIG. 17 shows white light images and corresponding whole body fluorescence images of a mouse 3 hours after administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 17A illustrates a white light image of a frozen section of a mouse 3 hours after administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 17B illustrates a whole body fluorescence image corresponding to the section shown in FIG. 17A showing the fluorescence signal in the mouse 3 hours after administration of 10 nmol SEQ ID NO:
  • FIG. 17C illustrates a white light image of a different frozen section of the mouse, 3 hours after administration of 10 nmol SEQ ID NO: 11 lpeptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 17D illustrates a whole body fluorescence image corresponding to the section shown in FIG. 17C showing the fluorescence signal in the mouse 3 hours after administration of 10 nmol SEQ ID NO: 11 lpeptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 17C illustrates a white light image of a different frozen section of the mouse, 3 hours after administration of 10 nmol SEQ ID NO: 11 lpeptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 17D illustrates a whole body fluorescence image corresponding to the section shown in FIG. 17C showing the fluorescence signal in the mouse 3 hours after administration of 10 nmol SEQ ID NO: 11
  • FIG. 17E illustrates a white light image of a different frozen section of the mouse, 3 hours after administration of 10 nmol SEQ ID NO: 11 lpeptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: l l lA).
  • FIG. 17F illustrates a whole body fluorescence image corresponding to the section shown in FIG. 17E showing the fluorescence signal in the mouse 3 hours after administration of 10 nmol SEQ ID NO: 11 lpeptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: l l lA).
  • FIG. 18 shows white light images and corresponding whole body fluorescence images of a mouse administered 10 nmol of a peptide of SEQ ID NO: 11 lconjugated to a Cy5.5 fluorophore (SEQ ID NO: l l lA) at 24 hours post-administration.
  • FIG. 18A illustrates an image of a frozen section of a mouse, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: 11 lconjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 18B illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 18A, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO:
  • FIG. 18C illustrates an image of a different frozen section of the mouse, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: 11 lconjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 18D illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 18C, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: 11 lconjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 18C illustrates an image of a different frozen section of the mouse, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: 11 lconjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 18D illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 18C, 24 hours after administration of 10 nmol of a peptid
  • FIG. 18E illustrates an image of a different frozen section of the mouse, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: l l lconjugated to a Cy5.5 fluorophore (SEQ ID NO: l l lA).
  • FIG. 18F illustrates a fluorescence signal in the mouse, corresponding to the section shown in FIG. 18E, 24 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 19 shows white light images and corresponding whole body fluorescence images of a mouse administered 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A) at 48 hours post-administration.
  • FIG. 19A illustrates an image of a frozen section of a mouse, 48 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 19B illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG.
  • FIG. 19A 48 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 19C illustrates an image of a different frozen section of the mouse, 48 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 19D 40 a different frozen section of the mouse
  • FIG. 19C illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 19C, 48 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 20 shows white light images and corresponding whole body fluorescence images of a mouse administered 10 nmol of a peptide of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A) at 72 hours post-administration.
  • FIG. 20A illustrates an image of a frozen section of a mouse, 72 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO:
  • FIG. 20B illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 20A, 72 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 20C illustrates an image of a different frozen section of the mouse, 72 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 20D illustrates the fluorescence signal in the mouse, corresponding to the section shown in FIG. 20C, 72 hours after administration of 10 nmol of a peptide of SEQ ID NO: 111 conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21 shows IVIS fluorescence imaging of an isolated hind limb from a first mouse and an isolated hind limb from a second mouse after administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A). Areas of low signal intensity are shown in a thin solid line, areas of medium signal intensity are shown in a thick sold line, and areas of high signal intensity are shown in a thin dotted line.
  • FIG. 21A shows the right hind limb with skin removed from a first mouse and from a second mouse 3 hours after peptide administration.
  • FIG. 21B shows the right hind limb with muscle removed from a first mouse and from a second mouse 3 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21C shows the right hind limb with skin removed from a first mouse and from a second mouse 24 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21D shows the right hind limb with muscle removed from a first mouse and from a second mouse 24 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21E shows the right hind limb with skin removed from a first mouse and from a second mouse 48 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21F shows the right hind limb with muscle removed from a first mouse and from a second mouse 48 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21G shows the right hind limb with skin removed from a first mouse and from a second mouse 72 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 21F shows the right hind limb with muscle removed from a first mouse and from a second mouse 48 hours after peptide administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • 21H shows the right hind limb with muscle removed from a first mouse and from a second mouse 72 hours after administration of 10 nmol SEQ ID NO: 111 peptide conjugated to a Cy5.5 fluorophore (SEQ ID NO: 111A).
  • FIG. 22 illustrates white light images and corresponding autoradiography images of frozen sections of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22A illustrates a white light image of a frozen section of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 22A, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22A illustrates a white light image of a frozen section of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 22A, 5 minutes after administration of
  • FIG. 22C illustrates a white light image of a different frozen section of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22D illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 22C, 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22E illustrates a white light image of a different frozen section of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled SEQ ID NO: 111.
  • FIG. 22F illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG.
  • FIG. 22E 5 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 22G illustrates a white light image of a different frozen section of a mouse, 5 minutes after administration of 100 nmol of a radiolabeled peptide of a SEQ ID NO: 111.
  • FIG. 22H illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 22G, 5 minutes after administration of 100 nmol of a radiolabeled peptide of a SEQ ID NO: 111. [0065] FIG.
  • FIG. 23 illustrates white light images and corresponding autoradiography images of frozen sections of a mouse, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23A illustrates a white light image of a frozen section of a mouse, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 23A, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23A illustrates a white light image of a frozen section of a mouse, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 23A, 30 minutes after administration of
  • FIG. 23C illustrates a white light image of a different frozen section of a mouse, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23D illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 23C, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23E illustrates a white light image of a different frozen section of the mouse, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 23F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 23E, 30 minutes after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24A illustrates a white light image of a frozen section of a mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 24A, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24A illustrates a white light image of a frozen section of a mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 24A, 1 hour after administration of
  • FIG. 24C illustrates a white light image of a different frozen section of a mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24D illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 24C, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24E illustrates a white light image of a different frozen section of the mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24F illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG.
  • FIG. 24E 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24G illustrates a white light image of a different frozen section of the mouse, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 24H illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 24G, 1 hour after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111. [0067] FIG.
  • FIG. 25 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 25A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 25A, 3 hours after administration of 100
  • FIG. 25C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25D illustrates the 14 C signal in a different frozen section of the mouse, corresponding to the section shown in FIG. 25C, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 25E illustrates the 14 C signal in a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse with ligated kidneys, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26B illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 26A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26B illustrates the 14 C signal in a frozen
  • FIG. 26C illustrates a white light image of a different frozen section of the mouse with ligated kidneys, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26D illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 26C, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26E illustrates a white light image of a different frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 26F illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to section shown in FIG. 26E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27A illustrates a white light image of a frozen section of a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 27A, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27A illustrates a white light image of a frozen section of a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 27A, 8 hours after administration of 100
  • FIG. 27C illustrates an image of a different frozen section of a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 27C, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27E illustrates an image of a different frozen section of a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG.
  • FIG. 27E 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27G illustrates a white light image of a different frozen section of a mouse, 8 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 27H illustrates the 14 C signal in a frozen section of a mouse,
  • FIG. 28 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 28A, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 28A, 24 hours after administration of 100
  • FIG. 28C illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 28C, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28E illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 28F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 28E, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29A illustrates a white light image of a frozen section of a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 29A, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29A illustrates a white light image of a frozen section of a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 29A, 48 hours after administration of 100
  • FIG. 29C illustrates a white light image of a different frozen section of a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 29C, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29E illustrates a white light image of a different frozen section of the mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 29E, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29G illustrates a white light image of a different frozen section of a mouse, 48 hours after administration of 100
  • FIG. 29H illustrates a white light image of a different frozen section of a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29H illustrates a white light image of a different frozen section of a mouse, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 29G illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 29G, 48 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 111.
  • FIG. 30 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 30A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30B illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 30A, 3 hours after administration of
  • FIG. 30C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30D illustrates the 14 C signal in a frozen section of the mouse,
  • FIG. 30E illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 30F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 30E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31 illustrates white light images and a corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31B illustrates the C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 31A, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31B illustrates the C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 31A, 24 hours after administration of 100
  • FIG. 31C illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 31C, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31E illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 31F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 31E, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 109.
  • FIG. 32 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO:
  • FIG. 32B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 32A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32D illustrates the 14 C signal in a frozen section of the mouse,
  • FIG. 32E illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32E illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a
  • FIG. 32F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 32E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32G illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 32E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32H illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32H illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 32G illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 32G, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33 illustrates white light images and a corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 33A, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33 illustrates white light images and a corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabele
  • FIG. 33C illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 33C, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33E illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 33F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 33E, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 110.
  • FIG. 34 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 34A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 34A, 3 hours after administration of 100 n
  • FIG. 34C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34D illustrates the 14 C signal in a frozen section of a mouse
  • FIG. 34E illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 34F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 34E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 35A, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 35A, 24 hours after administration of 100
  • 35C illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 35C, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35E illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 35F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 35E, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 114.
  • FIG. 36 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 36A, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide
  • FIG. 36C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36D illustrates the 14 C signal in a frozen section of the mouse,
  • FIG. 36E illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 36F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 36E, 3 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 37A, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 37A, 24 hours after administration of 100 nmol of
  • FIG. 37C illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 37C, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37E illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 37E, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37G illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radio
  • FIG. 37H illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37H illustrates a white light image of a different frozen section of the mouse, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 37G illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 37G, 24 hours after administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 200.
  • FIG. 38 illustrates white light images and corresponding autoradiography images of frozen sections a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195
  • FIG. 38A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195.
  • FIG. 38B illustrates the 14 C signal in a frozen section of a mouse with ligated kidneys, corresponding to the section shown in FIG. 38A, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195.
  • FIG. 38A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195.
  • FIG. 38C illustrates a white light image of a different frozen section of the mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195.
  • FIG. 38D illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 38C, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 195.
  • FIG. 39 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 39A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 39B illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 39A, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 39A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 39B illustrates the 14 C signal in a frozen section of the mouse
  • FIG. 39C illustrates a white light image of a different frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 39D illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 39C, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 196.
  • FIG. 40 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197
  • FIG. 40A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197.
  • FIG. 40B illustrates the 14 C signal in a frozen section of a mouse with ligated kidneys, corresponding to the section shown in FIG. 40A, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197.
  • FIG. 40A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197.
  • FIG. 40C illustrates a white light image of a different frozen section of the mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197.
  • FIG. 40D illustrates the 14 C signal in a frozen section of a mouse with ligated kidneys, corresponding to the section shown in FIG. 40C, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 197.
  • FIG. 41 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 41A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 41B illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 41A, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 41A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 41B illustrates the 14 C signal in a frozen section of the mouse
  • FIG. 41C illustrates a white light image of a different frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 41D illustrates the 14 C signal in a frozen section of a mouse with ligated kidneys, corresponding to the section shown in FIG. 41C, 3 hours after administration of 100 nmol a radiolabeled peptide of SEQ ID NO: 198.
  • FIG. 42 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434
  • FIG. 42A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42B illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 42A, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42A illustrates a white light image of a frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42C illustrates a white light image of a different frozen section of the mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42D illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 42C, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42E illustrates a white light image of a different frozen section of a mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42D illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 42C, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42F illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 42E, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42G illustrates a white light image of a different frozen section of the mouse with ligated kidneys, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 42H illustrates the 14 C signal in a frozen section of the mouse with ligated kidneys, corresponding to the section shown in FIG. 42G, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 43A, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43A illustrates a white light image of a frozen section of a mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 43A, 3 hours after
  • FIG. 43C illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 43C, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43E illustrates a white light image of a different frozen section of the mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG.
  • FIG. 43E 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43G illustrates a white light image of a different frozen section of a mouse, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 43H illustrates the 14 C signal in a frozen section of a mouse, corresponding to the section shown in FIG. 43G, 3 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434. [0086] FIG.
  • FIG. 44 illustrates white light images and corresponding autoradiography images of frozen sections from a mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 44A, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44A illustrates a white light image of a frozen section of a mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44B illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 44A, 24 hours after
  • FIG. 44C illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44D illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 44C, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44E illustrates an image of a different frozen section of the mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44F illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG.
  • FIG. 44E 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44G illustrates a white light image of a different frozen section of a mouse, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 44H illustrates the 14 C signal in a frozen section of the mouse, corresponding to the section shown in FIG. 44G, 24 hours after administration of 100 nmol a radiolabeled linearized peptide of SEQ ID NO: 434.
  • FIG. 45 illustrates the cartilage homing of various peptides of this disclosure plotted against the calculated Expasy pi.
  • FIG. 46 shows cartilage homing of various peptides of this disclosure plotted against the calculated Sillero pi using R implementation.
  • FIG. 47 depicts the topology of the "hitchins" class of cartilage homing peptides, with disulfide connectivity labeled as C1-C4, C2-C5, and C3-C6.
  • FIG. 48 illustrates structural analysis of peptides of SEQ ID NO: 28, SEQ ID NO: 23, and SEQ ID NO: 27.
  • FIG. 48A illustrates the structural analysis of a peptide of SEQ ID NO: 28 and displays the contiguous surface of positive charge and the position of positively charged residues.
  • FIG. 48B illustrates the structural analysis of a peptide of SEQ ID NO: 23 and displays the contiguous surface of positive charge and the position of positively charged residues.
  • FIG. 48C illustrates the structural analysis of a peptide of SEQ ID NO: 27 and displays the contiguous surface of positive charge and the position of positively charged residues.
  • FIG. 48D illustrates the structural analysis of a peptide of SEQ ID NO: 111 and displays the contiguous surface of positive charge and the position of positively charged residues.
  • FIG. 49 illustrates HPLC chromatograms of peptides of SEQ ID NO: 24 and SEQ ID NO: 111 in different buffer conditions.
  • FIG. 49A illustrates the HPLC trace of a peptide of SEQ ID NO: 24 in PBS.
  • FIG. 49B illustrates the HPLC trace of a peptide of SEQ ID NO: 24 in DTT in PBS.
  • FIG. 49C illustrates the HPLC trace of a peptide of SEQ ID NO: 24in 50 U trypsin and 1 mg/ml inhibitor in PBS.
  • FIG. 49D illustrates the HPLC trace of a peptide of SEQ ID NO: 24in 50 U trypsin, 1 mg/ml inhibitor, and DTT in PBS.
  • FIG. 49A illustrates the HPLC trace of a peptide of SEQ ID NO: 24 in PBS.
  • FIG. 49B illustrates the HPLC trace of a peptide of SEQ ID NO: 24 in DTT in PBS.
  • FIG. 49C
  • FIG. 49E illustrates the HPLC trace of a peptide of SEQ ID NO: 111 in PBS.
  • FIG. 49F illustrates the HPLC trace of a peptide of SEQ ID NO: 11 lin DTT in PBS.
  • FIG. 49G illustrates the HPLC trace of a peptide of SEQ ID NO: 111 in 50 U trypsin and 1 mg/ml inhibitor in PBS.
  • FIG. 49H
  • FIG. 50 illustrates alignment of SEQ ID NO: 24 with SEQ ID NO: 23, SEQ ID NO: 24 with SEQ ID NO: 27, and SEQ ID NO: 24 with SEQ ID NO: 206.
  • FIG. 50A illustrates the alignment of the peptide of SEQ ID NO: 24 with the peptide of SEQ ID NO: 23. Boxes delineate conserved positively charged residues.
  • FIG. 50B illustrates the alignment of the peptide of SEQ ID NO: 24 with the peptide of SEQ ID NO: 27. Boxes delineate conserved positively charged residues.
  • FIG. 50C illustrates the alignment of the peptide of SEQ ID NO: 24 with the peptide of SEQ ID NO: 206. Boxes delineate conserved positively charged residues.
  • FIG. 51 illustrates the alignment of the peptide of SEQ ID NO: 27 with the peptide of
  • FIG. 52 shows HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 24 suspended in various solutions including SPTD, simulated gastric fluid (SGF) at pH 1.05 and
  • FIG. 53 shows HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 111 suspended in various solutions including SPTD, simulated gastric fluid (SGF) at pH 1.05 and 20 ⁇ g pepsin (P), SGF, Dithiothreitol (DTT), and non-reducing (NR) conditions using a Tris buffer.
  • SPTD simulated gastric fluid
  • P pepsin
  • DTT Dithiothreitol
  • NR non-reducing
  • FIG. 54 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 483 (GSISIGIKCSPSIDLCEGQCRIRKYFTGYCSGDTCHCSG) suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 55 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 22 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 56 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 24 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 57 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 32 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 58 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 485
  • FIG. 59 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 27 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 60 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 205 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 61 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 195 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 62 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 196 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 63 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 197 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 64 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 198 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 65 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 206 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 66 shows an HPLC chromatogram of 5 ⁇ g trypsin in 25 mM Tris, 5 ⁇ g soybean trypsin inhibitor and 10 mM DTT (T, I, DTT) as well as HPLC chromatograms of 12.5 ⁇ g of a peptide of SEQ ID NO: 111 suspended in various solutions including (T, I, DTT), (T,I), DTT, and non-reducing (NR) conditions.
  • FIG. 67 shows the HPLC chromatograms of various peptides and the mass spectrometry results of various peptides after direct-infusion electrospray mass spectrometry. All peptides tested are shown under reducing and non-reducing conditions.
  • FIG. 67A shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 483. The peak near 9.5 minutes is the peptide under non-reducing conditions and the peak near 8.4 minutes shows reduced peptide.
  • FIG. 67B shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 22. The peak near 6.4 minutes is the peptide under non-reducing conditions and the peak near 5.4 minutes shows reduced peptide.
  • FIG. 67C shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 24. Peaks showing the peptide under non-reducing conditions and reducing conditions are overlapping.
  • FIG. 67D shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 32. The peak near 9.4 minutes is the peptide under non-reducing conditions and the peak near 9.0 minutes shows reduced peptide.
  • FIG. 67E shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 485. The peak near 9.4 minutes is the peptide under non-reducing conditions and the peak near 8.1 minutes shows reduced peptide.
  • FIG. 67C shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 24. Peaks showing the peptide under non-reducing conditions and reducing conditions are overlapping.
  • FIG. 67D shows the HPLC chromatogram and mass spect
  • FIG. 67F shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 27.
  • the peak near 8.2 minutes is the peptide under non- reducing conditions and the peak near 5.4 minutes shows reduced peptide.
  • FIG. 67G shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 205.
  • the peak near 6.6 minutes is the peptide under non-reducing conditions and the peak near 5.6 minutes shows reduced peptide.
  • FIG. 67H shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 195.
  • the peak near 9.5 minutes is the peptide under non-reducing conditions and the peak near 8.4 minutes shows reduced peptide.
  • FIG. 671 shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 196. Peaks showing the peptide under non-reducing conditions and reducing conditions are overlapping.
  • FIG. 67J shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 197. The peak near 8.5 minutes is the peptide under non- reducing conditions and the peak near 7.7 minutes shows reduced peptide.
  • FIG. 67K shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 198. The peak near 9.7 minutes is the peptide under non-reducing conditions and the peak near 6.7 minutes shows reduced peptide.
  • FIG. 67L shows the HPLC chromatogram and mass spectrometry results of a peptide of SEQ ID NO: 206.
  • the peak near 8.2 minutes is the peptide under non-reducing conditions and the peak near 7.2 minutes shows reduced peptide.
  • FIG. 67M shows the HPLC chromatogram of a peptide of SEQ ID NO: 111. Peaks showing the peptide under non-reducing conditions and reducing conditions are fully overlapping.
  • FIG. 68 shows the concentration of a radiolabeled peptide of SEQ ID NO: 24 in plasma after administration of the peptide to a mouse.
  • FIG. 68A shows the concentration of peptide in plasma after intravenous (IV) administration of 20 nmol of a radiolabeled peptide of SEQ ID NO: 24 and oral (PO) administration of 100 nmol the radiolabeled peptide of SEQ ID NO: 24, as quantified by measuring the 14 C signal using liquid scintillation counting.
  • the delivered dose of 14 C was 4.8 ⁇ for intravenous administration and 24 ⁇ for oral administration.
  • Time points examined included 0.08, 0.5, 1, 3, 8, 24, 48 hours and three mice were examined per time point.
  • 68B shows the percent of administered peptide dose recovered in plasma after intravenous (IV) administration of 20 nmol of a radiolabeled peptide of SEQ ID NO: 24 and oral (PO) administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24, as quantified by measuring the 14 C signal using liquid
  • FIG. 68C shows the intensity of peptide and peptide fragment peaks in plasma as measured by tandem HPLC and liquid scintillation counting after oral administration by gavage of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24.
  • the delivered dose of 14 C was 24 ⁇ for oral administration. Time points examined included 0.5, 1, and 3 hours.
  • FIG. 69 shows the concentration of a radiolabeled peptide of SEQ ID NO: 24 in urine after administration of the peptide to a mouse.
  • FIG. 69A shows the concentration of peptide in urine after intravenous (IV) administration of 20 nmol of a radiolabeled peptide of SEQ ID NO: 24 and oral (PO) administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24, as quantified by measuring the 14 C signal using liquid scintillation counting.
  • the delivered dose of 14 C was 4.8 ⁇ for intravenous administration and 24 ⁇ for oral administration.
  • Time points examined included 0.08, 0.5, 1, 3, 8, 24, 48 hours and three mice were examined per time point.
  • 69B shows the intensity of peptide and peptide fragment peaks in urine as measured by tandem HPLC and liquid scintillation counting after oral administration by gavage of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24.
  • the delivered dose of 14 C was 24 ⁇ for oral administration.
  • Time points examined included 0.5, 1, 3, 8, 24, and 48 hours.
  • FIG. 70 shows the concentration of a radiolabeled peptide of SEQ ID NO: 24 in urine after administration of the peptide to a mouse.
  • FIG. 70A shows the concentration of peptide in feces after intravenous (IV) administration of 20 nmol of a radiolabeled peptide of SEQ ID NO: 24 and oral (PO) administration of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24, as quantified by measuring the 14 C signal using liquid scintillation counting.
  • the delivered dose of 14 C was 4.8 ⁇ for intravenous administration and 24 ⁇ for oral administration.
  • Time points examined included 0.08, 0.5, 1, 3, 8, 24, 48 hours and three mice were examined per time point.
  • 70B shows the intensity of peptide and peptide fragment peaks in feces as measured by tandem HPLC and liquid scintillation counting after oral administration by gavage of 100 nmol of a radiolabeled peptide of SEQ ID NO: 24.
  • the delivered dose of 14 C was 24 ⁇ for oral administration.
  • FIG. 71 illustrates HPLC chromatograms of two peptides after exposure to reducing agents, proteinases, and/or simulated gastric fluid conditions.
  • FIG. 71A illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in PBS.
  • FIG. 71B illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in DTT in PBS.
  • FIG. 71C illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in simulated gastric fluid (SGF).
  • FIG. 71D illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in 500 U pepsin in SGF.
  • FIG. 71A illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in PBS.
  • FIG. 71B illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in DTT in P
  • FIG. 71E illustrates the HPLC trace of a peptide of SEQ ID NO: 24 incubated in 500 U pepsin, 0.5 M Tris, and DTT in SGF.
  • FIG. 71F illustrates the HPLC trace of a peptide of SEQ ID NO: 111 incubated in PBS.
  • FIG. 71G illustrates the HPLC trace of a peptide of SEQ ID NO: 11 lincubated in DTT in PBS.
  • FIG. 71H illustrates the HPLC trace of a peptide of SEQ ID NO: 11 lincubated in simulated gastric fluid (SGF).
  • FIG. 711 illustrates the HPLC trace of a peptide of SEQ ID NO: 11 lincubated in 500 U pepsin in SGF.
  • FIG. 71J illustrates the HPLC trace of a peptide of SEQ ID NO: 111 incubated in 500 U pepsin, 0.5 M Tris, and DTT in SGF.
  • FIG. 72 illustrates HPLC chromatograms of peptides of SEQ ID NO: 111 and SEQ ID NO: 434 after exposure to a range of conditions including oxidative, reductive, and acidic conditions as well as after exposure to proteinases.
  • FIG. 72A illustrates the HPLC trace of a peptide of SEQ ID NO: 111 under reducing and acidic conditions.
  • FIG. 72B illustrates the HPLC trace of a peptide of SEQ ID NO: 111 under various combinations of reducing agents and proteases including 10 mM DTT in 500 U pepsin, 500 U pepsin, 10 mM DTT in 50 U trypsin, and 50 U trypsin.
  • FIG. 72A illustrates the HPLC trace of a peptide of SEQ ID NO: 111 under reducing and acidic conditions.
  • FIG. 72B illustrates the HPLC trace of a peptide of SEQ ID NO: 111 under various combinations of reducing agents and proteases including 10 mM
  • 72C illustrates the HPLC trace of a peptide of SEQ ID NO: 434 under various protease conditions including in 500 U pepsin, in 50 U trypsin, non- reducing (NR, oxidized conditions) in simulated gastric fluid (SGF) at pH 1.05, and NR.
  • FIG. 73 illustrates alignment of peptides within the pfam00451:toxin_2 structural class family of SEQ ID NO: 436 - SEQ ID NO: 482. Boxed and bolded residues indicate relative conservation of sequence while non-boxed and non-bolded residues indicate areas of higher sequence variability.
  • FIG. 74 illustrates alignment of a peptide of SEQ ID NO: 436 from the
  • Asterisks indicate positions with a single, fully conserved residue, a colon indicates conservation between groups of strongly similar properties (scoring > 0.5 in the Gonnet point accepted mutation (PAM) 250 matrix), and a period indicates conservation between groups of weakly similar properties (scoring ⁇ 0.5 in the Gonnet PAM 250 matrix).
  • the present disclosure relates generally to compositions and methods for cartilage therapy.
  • the compositions and methods herein utilize peptides that home, target, are directed to, are retained by, accumulate in, migrate to, and/or bind to cartilage following administration to a subject.
  • the cartilage homing peptides of the present disclosure are used to deliver an active agent to cartilage or tissue or cell thereof.
  • the active agent can exert a therapeutic effect on cartilage or tissue or cell thereof.
  • the active agent allows for localized delivery of an ant i- inflammatory agent to cartilage or tissue or cell thereof.
  • the active agent is a fluorophore that can be used for imaging of cartilage.
  • the peptide itself induces therapeutic responses.
  • Cartilage disorders are particularly difficult to treat.
  • a direct route for drug administration can be intravenously, intra- articular ly, or orally.
  • cartilage can be avascular thus intravenous administration of drugs can fail to reach the cartilage.
  • Drugs for cartilage diseases such as osteoarthritis, can be injected directly locally into the affected area, for example, directly injected into the joint. Few drugs aimed at treating cartilage disorders have proved therapeutically viable with lack of access to target tissue being a primary reason for failure. The lack of access to the target tissue can also lead to administration of doses that are higher than would be necessary if a drug could home, target, or be directed to, is retained by, and/or binds to a target region, tissue, structure or cell.
  • Specific and potent drugs that are capable of contacting the cartilage can counteract the non- specificity of many treatments by selectively targeting and delivering compounds to specific regions, tissues, cells and structures. Such drugs can also be useful to modulate ion channels, protein-protein interactions, extracellular matrix remodeling (i.e., protease inhibition), and the like. Such targeted therapy can allow for lower dosing, reduced side effects, improved patient compliance, and improvement in therapeutic outcomes, which would be advantageous not only in acute disease of the cartilage, but in chronic conditions as well.
  • the present disclosure describes a class of peptides derived from knottins that can effectively contact cartilage and be used either directly or as carriers of active drugs, peptides, or molecules to treat a cartilage condition.
  • osteoarthritis is a cartilage condition that is associated with the thinning of cartilage covering the ends of bones resulting in bone directly contacting bone within the joint. Over time, the ends of the bones are subjected to increased levels of friction which causes erosion of the end of the bone. Individuals suffering from osteoarthritis experience reduced motion and increased pain.
  • a therapeutic peptide that could contact the cartilage at the joint and ends of the bone to interact with the chondrocytes and induce increased expression of extracellular matrix proteins could be used in the treatment and prevention of osteoarthritis by increasing expression of collagen through, for example, the rate of production, amount of production, inhibition of proteins which degrade collagen, promote expression of other proteins which maintain the integrity of existing collagen proteins, or other mechanism.
  • a peptide could also affect nearby tissues or cells such as the bone, osteoclasts, osteoblasts, ligaments, muscle, tendons, and bursa.
  • the peptides of the disclosure can be used to treat the symptoms of various conditions.
  • the peptides of the disclosure can bind to
  • chondrocytes to cartilage, to extracellular matrix, to collagen, hyaluranon, aggrecan (also known as cartilage-specific proteoglycan core protein (CSPCP)), or other components of the extracellular matrix, or to other components in joints and cartilaginous tissues.
  • CSPCP cartilage-specific proteoglycan core protein
  • peptides that selectively home, target, are directed to, migrate to, are retained by, or accumulate in and/or bind to specific regions, tissues, structures or cells of the cartilage that aid in managing, decreasing, ablating or reducing pain (e.g., joint pain) due to chronic disease or cartilage injury or other therapeutic indications as described herein.
  • a peptide that homes, targets, migrates to, is directed to, is retained by, or accumulates in and/or binds to one or more specific regions, tissues, structures or cells of the cartilage can have fewer off-target and potentially negative effects, for example, side effects that often limit use and efficacy of pain drugs.
  • such peptides can reduce dosage and increase the efficacy of existing drugs by directly targeting them to a specific region, tissue, structure or cell of the cartilage and helping the contact the cartilage or increasing the local concentration of agent.
  • the peptide itself can modulate pain or it can be conjugated to an agent that modulates pain.
  • pain modulation may operate by various mechanisms such as modulating inflammation, autoimmune responses, direct or indirect action on pain receptors, cell killing, or programmed cell death (whether via an apoptotic and/or non-apoptotic pathway of diseased cells or tissues, and the like (Tait et al. J Cell Sci 127(Pt 10):2135-44 (2014)).
  • Peptides of this disclosure that home, target, are directed to, migrate to, are retained by, accumulate in, or bind to specific regions, tissues, structures or cells of the cartilage can do so with different degrees of efficiency.
  • Peptides can have a higher concentration in cartilage than in other locations, such as blood or muscle.
  • Peptides can be recorded as having a signal in cartilage as a percentage of signal in blood. For example, a cartilage signal of 200% indicates that the signal in cartilage is twice as high as the signal in blood.
  • peptides that have cartilage homing properties can have a cartilage signal of >170% by radio densitometry measurements.
  • peptides that are cartilage homers can have a cartilage signal of >200% by radio densitometry measurements. In other embodiments, peptides that are more efficient cartilage homers can have a cartilage signal of >300% by radio densitometry measurements. In other
  • peptides that are more efficient cartilage homers can have a cartilage signal of >400% by radio densitometry measurements. In other embodiments, peptides that are strongest cartilage homers of highest interest can have a cartilage signal of >500% by radio densitometry measurements.
  • Peptides that selectively home, target, are directed to, migrate to, are retained by, or accumulate in and/or bind to specific regions, tissues, structures or cells of the cartilage can occur after administration of the peptide to a subject.
  • a subject can be a human or a non-human animal.
  • the peptides disclosed herein can be used as active agents such a fluorophores for imaging or to carry agents such as ant i- inflammatory agents to the joint to treat
  • Cartilage explants can be from any subject, such as a human or an animal.
  • Assessment of peptide binding to cartilage explants can be used to screen peptides that may efficiently home to cartilage in vivo.
  • alanine (A, Ala); arginine (R, Arg); asparagine (N, Asn); aspartic acid (D, Asp); cysteine (C, Cys); glutamic acid (E, Glu); glutamine (Q, Gin); glycine (G, Gly); histidine (H, His); isoleucine (I, He); leucine (L, Leu); lysine (K, Lys); methionine (M, Met); phenylalanine (F, Phe); proline (P, Pro); serine (S, Ser); threonine (T, Thr);
  • Xaa can indicate any amino acid.
  • X can be asparagine (N), glutamine (Q), histidine (H), lysine (K), or arginine (R).
  • D-amino acid residues of any standard or non-standard amino acid or analogue thereof When an amino acid sequence is represented as a series of three-letter or one-letter amino acid abbreviations, the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy terminal direction, in accordance with standard usage and convention.
  • Knottins are a class of peptides, usually ranging from about 20 to about 80 amino acids in length that are often folded into a compact structure. Knottins are typically assembled into a complex tertiary structure that is characterized by a number of intramolecular disulfide crosslinks and may contain beta strands and other secondary structures. The presence of the disulfide bonds gives knottins remarkable environmental stability, allowing them to withstand extremes of temperature and pH and to resist the proteolytic enzymes of the blood stream.
  • knottins A wider examination of the sequence structure and homology of knottins reveals that they have arisen by convergent evolution in all kinds of animals and plants. In animals, they are typically found in venoms, for example, the venoms of spiders and scorpions and have been implicated in the modulation of ion channels. Many of this class of peptide can be protease inhibitors, and as such can both home to cartilage and inhibit collagenase or a matrix metalloprotease that breaks down cartilage (e.g., matrix
  • knottin proteins of plants can inhibit the proteolytic enzymes of animals or have antimicrobial activity, suggesting that knottins can function in the native defense of plants. Many of this class of peptides can have antimicrobial activity, and as such one of these can both home to cartilage and treat microbial infections.
  • knottin peptides can interact with ion channels, and as such can home to cartilage and interact (bind, block, activate) with ion channels such as those in
  • chondrocytes that are known to effect proliferation, mechanotransduction, and other functions (Potassium Ion Channels in Articular Chondrocytes, Ali Mobasheri, in
  • Mechano sensitive Ion Channels Mechano sensitivity in Cells and Tissues Volume 1, 2008, pp 157- 178).
  • knotted peptides of the present disclosure provide certain advantages. For instance, the presence of the disulfide bonds gives knotted peptides remarkable
  • knotted peptides can be beneficial in terms of reducing immunogenicity.
  • the rigidity of knotted peptides also allows them to bind to targets without paying the "entropic penalty" that a floppy peptide accrues upon binding a target.
  • the knotted peptides can bind targets with antibody-like affinity.
  • the knotted peptides can modulate the activity of a plurality of cartilage regions, tissues, structures or cells.
  • cartilage regions, tissues, structures include: (a) elastic cartilage; (b) hyaline cartilage, such as articular cartilage and physeal cartilage; (c) fibrocartilage; and (d) any cells or cell types in (a) - (c) above.
  • Some of the areas where the knottin peptide can home to cartilage include joints such as knees, hips, or digits, nasal cartilage, spinal cartilage, tracheal cartilage, and rib cartilage.
  • cartilage components include aggrecan and type II collagen. Additionally, in some embodiments, knotted peptides can penetrate into cells. In other embodiments, knotted peptides exhibit more rapid clearance and cellular uptake compared to other types of molecules.
  • knotted peptides or knottins.
  • knottins or knottins.
  • the term “knotted peptide” is considered to be interchangeable with the terms “knottin” and "optide.”
  • the peptides of the present disclosure can comprise cysteine amino acid residues. In some cases, the peptide has at least 4 cysteine amino acid residues. In some cases, the peptide has at least 6 cysteine amino acid residues. In other cases, the peptide has at least 8 cysteine amino acid residues, at least 10 cysteine amino acid residues, at least 12 cysteine amino acid residues, at least 14 cysteine amino acid residues or at least 16 cysteine amino acid residues.
  • a knotted peptide can comprise disulfide bridges.
  • a knotted peptide can be a peptide wherein 5% or more of the residues are cysteines forming intramolecular disulfide bonds.
  • a disulfide-linked peptide can be a drug scaffold.
  • the disulfide bridges form an inhibitor knot.
  • a disulfide bridge can be formed between cysteine residues, for example, between cysteines 1 and 4, 2 and 5, or, 3 and 6. In some cases, one disulfide bridge passes through a loop formed by the other two disulfide bridges, for example, to form the inhibitor knot. In other cases, the disulfide bridges can be formed between any two cysteine residues.
  • the present disclosure further includes peptide scaffolds that, e.g., can be used as a starting point for generating additional peptides that can target and home to cartilage.
  • these scaffolds can be derived from a variety of knotted peptides (or knottins).
  • knotted peptides are assembled into a complex tertiary structure that is characterized by a number of intramolecular disulfide crosslinks, and optionally contain beta strands and other secondary structures such as an alpha helix.
  • knotted peptides include, in some embodiments, small disulfide-rich proteins characterized by a disulfide through disulfide knot.
  • This knot can be, e.g., obtained when one disulfide bridge crosses the macrocycle formed by two other disulfides and the interconnecting backbone.
  • the knotted peptides can include growth factor cysteine knots or inhibitor cysteine knots.
  • Other possible peptide structures can include peptide having two parallel helices linked by two disulfide bridges without ⁇ - sheets (e.g., hefutoxin).
  • a knotted peptide can comprise at least one amino acid residue in an L configuration.
  • a knotted peptide can comprise at least one amino acid residue in a D configuration.
  • a knotted peptide is 15-40 amino acid residues long.
  • a knotted peptide is 11-57 amino acid residues long.
  • a knotted peptide is at least 20 amino acid residues long.
  • peptides can be derived from a class of proteins known to be present or associated with toxins or venoms.
  • the peptide can be derived from toxins or venoms associated with scorpions or spiders.
  • the peptide can be derived from venoms and toxins of spiders and scorpions of various genus and species.
  • the peptide can be derived from a venom or toxin of the Leiurus quinquestriatus hebraeus, Buthus occitanus tunetanus, Hottentotta judaicus, Mesobuthus eupeus, Buthus occitanus Israelis, Hadrurus gertschi, Androctonus australis, Centruroides noxius, Heteropronounceds laoticus,
  • Opistophthalmus carinatus Haplopelma schmidti, Isometrus maculatus, Grammostola rosea or another suitable genus or species of scorpion.
  • a peptide can be derived from a Buthus martensii Karsh (scorpion) toxin.
  • the peptides are members of the pfam00451:toxin_2 family.
  • the pfam00451:toxin_2 structural class family can include a peptide of any one of SEQ ID NO: 436 - SEQ ID NO: 482.
  • a cartilage homoing peptide of this disclosure can be a variant of any peptide members of the pfam00451:toxin_2 family.
  • an exemplary cartilage homing peptide of this disclosure that is a variant of the
  • pfam00451:toxin_2 structural class family is a peptide of SEQ ID NO: 24.
  • an exemplary cartilage homing peptide of this disclosure that is a variant of the pfam00451:toxin_2 structural class family is a peptide of SEQ ID NO: 111.
  • the variant peptides are at least 30% identical to a peptide of the structural class pfam00451:toxin_2 family.
  • the variant peptides are 30%, 40%, 50%, 60%, 80%, 90% or 95% identical to a peptide of the structural class pfam00451:toxin_2 family.
  • the variant peptides are at least 30%, at least 40%, at least 50%, at least 60%, at least 80%, at least 90% or at least 95% identical to a peptide of the structural class pfam00451:toxin_2 family.
  • the pfam00451:toxin_2 family comprises peptide family members found as portions of various scorpion toxins, often functioning to block potassium channels.
  • Features of the pfam00451:toxin_2 family include, but are not limited to, a features associated with members of a knottin 1 (CL0054) clan, which has at least 120 family members.
  • the average family member amino acid residue lengths is 31.4 amino acid residues
  • the average identity of family member sequence homology to the consensus sequence is 46%
  • family members are derived from at least the following organisms: Tityus costatus, Centruroides noxius, Tityus serrulatus, Mesobuthus gibbosus, Centruroides elegans, Hottentotta judaicus, Mesobuthus eupeus, Parabuthus transvaalicus, Isometroides vescus, Hottentotta tamulus sindicus, Centruroides margaritatus, Centruroides suffusus suffusus, Buthus occitanus Israelis, Centruroides limpidus limpidus, Leiurus quinquestriatus hebraeus, Odontobuthus doriae, Mesobuthus tamulus, Tityus stigmurus, Lychas mucronatus, Androctonus australis
  • cartilage homing peptides are members of family with the sequence GSXVXXXVKCXGSKQCXXPCKRXXGXRXGKCINKKXCKCYXXX (SEQ ID NO: 9), in which this sequence is based on the most common elements found in the following sequences:
  • the N-terminal GS sequence can be included or excluded between the peptides of the present disclosure.
  • peptides are members of family with the sequence GSXXXGCVXXXXKCRPGXKXCCXPXKRCSRRFGXXXXKKCKXXXX (SEQ ID NO: 10), in which the sequence is based on the most common elements found in the following sequences:
  • the N-terminal GS sequence can be included or excluded between the peptides of the present disclosure.
  • a peptide comprises the sequence
  • the peptide comprises the sequence
  • X 8 is selected from T or A
  • X 9 is selected from C or M
  • X 10 is selected from F or N
  • X 11 is selected from M or I
  • X 12 is selected from Y or T
  • X 13 is selected from G or P
  • X 14 is selected from C or null
  • X 15 is selected from G or null.
  • a peptide comprises the sequence
  • X 1 X 2 X 3 X 4 IX 5 CX 6 GSKQCYX 7 PCKX 8 X 9 TGCX 10 X 11 X 12 KCX 13 X 14 KX 15 CKCYGCG (SEQ ID NO: 3), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , and X 15 are each individually any amino acid or amino acid analogue or null.
  • the peptide comprises the sequence
  • X 1 is selected from G or null
  • X 2 is selected from S or null
  • X 3 is selected from E
  • X 4 is selected from V
  • X 5 is selected from R or S
  • X 6 is selected from S or T
  • X 7 is selected from G or D
  • X 8 is selected from Q or R
  • X 9 is selected from Q or K
  • X 10 is selected from T or P
  • X 11 is selected from N or Q
  • X 12 is selected from S or A
  • X 13 is selected from M or L
  • X 14 is selected from N or Q
  • X 15 is selected from V or S.
  • a peptide comprises the sequence
  • the peptide comprises the sequence
  • X 1 is selected from G or null
  • X 2 is selected from G, S or null
  • X 3 is selected from G, S or null
  • X 4 is selected from P or R
  • X 5 is selected from N or P
  • X 6 is selected from K or S
  • X 7 is selected from R or K
  • X 8 is selected from G or H
  • X 9 is selected from R or G
  • X 10 is selected from D or Q
  • X 11 is selected from D or K
  • X 12 is selected from K or D
  • X 13 is selected from I or M
  • X 14 is selected from S or G
  • X 15 is selected from H or D
  • X 16 is selected from K or null.
  • a peptide comprises the sequence
  • XGCVXKCRPGXKXCCXPXKRCSRRFGXKKCKX (SEQ ID NO: 8), wherein each letter is each individually any amino acid or amino acid analogue and where X is no amino acid or a 1-10 amino acid long peptide fragment wherein each amino acid within such peptide fragment can in each case be any amino acid or amino acid analogue.
  • a peptide comprises the sequence
  • the peptide comprises the sequence
  • K or R wherein X is selected from T or A, wherein X is selected from C or M, wherein X is selected from F or N, wherein X 11 is selected from M or I, wherein X 12 is selected from Y or T, wherein X 13 is selected from G or P, wherein X 14 is selected from C or null, and wherein X 15 is selected from G or null.
  • a peptide comprises the sequence
  • X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , and X 15 are each individually any amino acid or amino acid analogue or null.
  • the peptide comprises the sequence
  • ID NO: 14 where X 1 is selected from G or null, wherein X 2 is selected from S or null, wherein X 3 is selected from E, G or null, wherein X 4 is selected from V, S, or null, wherein X 5 is selected from R or S, wherein X 6 is selected from S or T, wherein X 7 is selected from G or D, wherein X 8 is selected from Q or R, wherein X 9 is selected from Q, R, or K, wherein X 10 is selected from T or P, wherein X 11 is selected from N or Q, wherein X 12 is selected from S or A, wherein X 13 is selected from M or L, wherein X 14 is selected from N or Q, and wherein X 15 is selected from V or S.
  • a peptide comprises the sequence
  • the peptide comprises the sequence
  • ID NO: 16 where X 1 is selected from G or null, wherein X 2 is selected from G, S or null, wherein X 3 is selected from G, S or null, wherein X 4 is selected from P or R, wherein X 5 is selected from N or P, wherein X 6 is selected from R, K or S, wherein X 7 is selected from R or K, wherein X 8 is selected from G or H, wherein X 9 is selected from R or G, wherein X 10 is selected from D or Q, wherein X 11 is selected from D, R, or K, wherein X 12 is selected from K, R, or D, wherein X 13 is selected from I or M, wherein X 14 is selected from S or G, wherein X 15 is selected from H or D, and wherein X 16 is selected from K, R, or null.
  • a peptide comprises the sequence
  • each letter is each individually any amino acid or amino acid analogue and where X is no amino acid or a 1-10 amino acid long peptide fragment wherein each amino acid within such peptide fragment can in each case be any amino acid or amino acid analogue.
  • a peptide comprises one or more of the following peptide fragments: SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 186, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, SEQ ID NO: 190, SEQ ID NO: 191, SEQ ID NO: 193, and SEQ ID NO: 194.
  • TABLE 1 lists some exemplary peptides according to the present disclosure.
  • SEQ ID NO: 110 GSVRIPVSCRHSGQCLRPCRDAGMRFGRCMNGRCDCTPR
  • SEQ ID NO: 140 GSGNYCLRGRCLPGGRRCCNGRPCECFARICSCRPR
  • SEQ ID NO: 238 SEKDCIKHLQRCRENKDCCSKKCSRRGTNPEKRCR
  • SEQ ID NO: 354 SFCIPFRPCRSDENCCRRFRCRTTGIVRLCRW
  • SEQ ID NO: 368 SCADAYKSCDSLRCCNNRTCMCSMIGTNCTCRRR
  • SEQ ID NO: 415 ISIGIRCSPSIDLCEGQCRIRRYFTGYCSGDTCHCSG
  • SEQ ID NO: 417 SCEPGRTFRDRCNTCKCGADGRSAACTLRACPNQ
  • any one or more K residues can be replaced by an R residue or any one or more R residues can be replaced by a K residue.
  • any one or more M residues can be replaced by any one of I, L, or V residues
  • any one or more L residues can be replaced by any one of V, I, or M residues
  • any one or more I residues can be replaced by any one of M, L, or V residues
  • any one or more V residues can be replaced by any one of I, L, or M residues.
  • At least one of the amino acids alone or in combination can be interchanged in the peptides or peptide fragments as follows: K/R, M/ II L/V, G/A, S/T, Q/N, and D/E wherein each letter is each individually any amino acid or amino acid analogue.
  • the peptide can contain only one lysine residue, or no lysine residue.
  • SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or any fragment thereof can be interchanged in the peptides or peptide fragments as follows: K/R, M/ II L/V, G/A, S/T, Q/N, and D/E wherein each letter is each individually any amino acid or amino acid analogue.
  • the peptide can contain only one lysine residue, or no lysine residue
  • a peptide can include the first two N-terminal amino acids GS, as with peptides of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, and SEQ ID NO: 198 - SEQ ID NO: 216, or such N- terminal amino acids (GS) can be substituted by any other one or two amino acids.
  • a peptide does not include the first two N-terminal amino acids GS, as with peptides of SEQ ID NO: 217 - SEQ ID NO: 410, SEQ ID NO: 412, and SEQ ID NO: 414 - SEQ ID NO: 432.
  • the N-terminus of the peptide is blocked, such as by an acetyl group; in other instances the C-terminus of the peptide is block, such as by an amide group.
  • the peptide is any one of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or a functional fragment thereof.
  • the peptide of the disclosure further comprises a peptide with 99%, 95%, 90%, 85%, or 80% homology to any one of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • the peptide fragment comprises a contiguous fragment of any one of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 that is at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46 residues long, wherein the peptide fragment is selected from any portion of the peptide.
  • such peptide fragments contact the cartilage and exhibit properties of those described herein for peptide and peptide- active agent conjugates.
  • the peptides of the present disclosure can further comprise negative amino acid residues.
  • the peptide has 2 or fewer negative amino acid residues.
  • the peptide has 4 or fewer negative amino acid residues, 3 or fewer negative amino acid residues, or 1 or fewer negative amino acid residues.
  • the negative amino acid residues can be selected from any negative charged amino acid residues.
  • the negative amino acid residues can selected from either E or D, or a combination of both E and D.
  • the peptides of the present disclosure can further comprise basic amino acid residues.
  • basic residues are added to the peptide sequence to increase the charge at physiological pH.
  • the added basic residues can be any basic amino acid.
  • the added basic residues can be selected from K or R, or a combination of K or R.
  • the peptide has a charge distribution comprising an acidic region and a basic region.
  • An acidic region can be a nub.
  • a nub is a portion of a peptide extending out of the peptide's three-dimensional structure.
  • a basic region can be a patch.
  • a patch is a portion of a peptide that does not designate any specific topology characteristic of the peptide's three-dimensional structure.
  • a knotted peptide can be 6 or more basic residues and 2 or fewer acidic residues.
  • the peptides of the present disclosure can further comprise positively charged amino acid residues.
  • the peptide has at least 2 positively charged residues.
  • the peptide has at least 3 positively charged residues, at least 4 positively charged residues, at least 5 positively charged residues, at least 6 positively charged residues, at least 7 positively charged residues, at least 8 positively charged residues or at least 9 positively charged residues.
  • the positively charged residues can be selected from any positively charged amino acid residues.
  • the positively charged residues can be selected from either K or R, or a combination of K and R.
  • the peptides herein can comprise a 4-19 amino acid residue fragment of any of the above sequences containing at least 2 cysteine residues, and at least 2 or 3 positively charged amino acid residues (for example, arginine, lysine or histidine, or any combination of arginine, lysine or histidine).
  • the peptides herein is a 20-70 amino acid residue fragment of any of the above sequences containing at least 2 cysteine residues, no more than 2 basic residues, and at least 2 or 3 positively charged amino acid residues (for example, arginine, lysine or histidine, or any combination of arginine, lysine or histidine).
  • such peptide fragments contact the cartilage and exhibit properties of those described herein for peptide and peptide- active agent conjugates.
  • the peptide contains one or more disulfide bonds and has a positive net charge at neutral pH.
  • peptides can have a net charge, for example, of -5, -4, -3, -2, -1, 0, +1, +2, +3, +4, or +5.
  • the net charge is zero, the peptide can be uncharged or zwitterionic.
  • the peptide can have a positive charge at physiological pH.
  • the peptide can have a charge > +2 at physiological pH, > +3.5 at physiological pH, > +4.5 at physiological pH.
  • the peptide contains one or more disulfide bonds and has a positive net charge at neutral pH where the net charge can be +0.5 or less than +0.5, +1 or less than +1, +1.5 or less than +1.5, +2 or less than +2, +2.5 or less than +2.5, +3 or less than +3, +3.5 or less than +3.5, +4 or less than +4, +4.5 or less than +4.5, +5 or less than +5, +5.5 or less than +5.5, +6 or less than +6, +6.5 or less than +6.5, +7 or less than +7, +7.5 or less than +7.5, +8 or less than +8, +8.5 or less than +8.5, +9 or less than +9.5, +10 or less than +10.
  • the peptide has a negative net charge at physiological pH where the net charge can be -0.5 or less than -0.5, -1 or less than -1, -1.5 or less than -1.5, -2 or less than -2, -2.5 or less than -2.5, -3 or less than - 3, -3.5 or less than -3.5, -4 or less than -4, -4.5 or less than -4.5, -5 or less than -5, -5.5 or less than -5.5, -6 or less than -6, -6.5 or less than -6.5, -7 or less than -7, -7.5 or less than -7.5, -8 or less than -8, -8.5 or less than -8.5, -9 or less than -9.5, -10 or less than -10.
  • the engineering of one or more mutations within a peptide yields a peptide with an altered isoelectric point, charge, surface charge, or rheology at physiological pH.
  • Such engineering of a mutation to a peptide derived from a scorpion or spider can change the net charge of the complex, for example, by decreasing the net charge by 1, 2, 3, 4, or 5, or by increasing the net charge by 1, 2, 3, 4, or 5.
  • the engineered mutation may facilitate the ability of the peptide to contact the cartilage.
  • Suitable amino acid modifications for improving the rheology and potency of a peptide can include conservative or non-conservative mutations.
  • a peptide can comprises at most 1 amino acid mutation, at most 2 amino acid mutations, at most 3 amino acid mutations, at most 4 amino acid mutations, at most 5 amino acid mutations, at most 6 amino acid mutations, at most 7 amino acid mutations, at most 8 amino acid mutations, at most 9 amino acid mutations, at most 10 amino acid mutations, or another suitable number as compared to the sequence of the venom or toxin that the peptide is derived from.
  • a peptide, or a functional fragment thereof comprises at least 1 amino acid mutation, at least 2 amino acid mutations, at least 3 amino acid mutations, at least 4 amino acid mutations, at least 5 amino acid mutations, at least 6 amino acid mutations, at least 7 amino acid mutations, at least 8 amino acid mutations, at least 9 amino acid mutations, at least 10 amino acid mutations, or another suitable number as compared to the sequence of the venom or toxin that the peptide is derived from.
  • mutations can be engineered within a peptide to provide a peptide that has a desired charge or stability at physiological pH.
  • charge can play a role in cartilage homing.
  • the interaction of a peptide of this disclosure in solution and in vivo can be influenced by the isoelectric point (pi) of the knottin peptide and/or the pH of the solution or the local environment it is in.
  • the charge of a peptide in solution can impact the solubility of the protein as well as parameters such as biodistribution, bioavailability, and overall pharmacokinetics.
  • positively charged molecules can interact with negatively charged molecules.
  • Positively charged molecules such as the peptides disclosed herein can interact and bind with negatively charged molecules such as the negatively charged extracellular matrix molecules in the cartilage including hyaluranon and aggrecan.
  • Positively charged residues can also interact with specific regions of other proteins and molecules, such as negatively charged residues of receptors or electronegative regions of an ion channel pore on cell surfaces.
  • the pi of a peptide can influence whether a peptide of this disclosure can efficiently home to cartilage. Identifying a correlation between pi and cartilage homing can be an important strategy in identifying lead peptide candidates of the present disclosure.
  • the pi of a peptide can be calculated using a number of different methods including the Expasy pi calculator and the Sillero method.
  • the Expasy pi can be determined by calculating pKa values of amino acids as described in Bjellqvist et al., which were defined by examining polypeptide migration between pH 4.5 to pH 7.3 in an immobilized pH gradient gel environment with 9.2M and 9.8M urea at 15°C or 25°C (Bjellqvist et al. Electrophoresis. 14(10): 1023-31 (1993)).
  • the Sillero method of calculating pi can involve the solution of a polynomial equation and the individual pKas of each amino acid. This method does not use denaturing conditions (urea) (Sillero et al.
  • a peptide with a pi above biological pH can exhibit efficient homing to cartilage.
  • a peptide with a pi of at least 8, at least 9, at least 10, or at least 11 can efficiently home to cartilage.
  • a peptide with a pi of 11 - 12 can home most efficiently to cartilage.
  • a peptide can have a pi of about 9.
  • a peptide can have a pi of 8 - 10. In some embodiments, more basic peptides can home more efficiently to cartilage. In other embodiments, a high pi alone may not be sufficient to cause cartilage homing of a peptides.
  • the tertiary structure and electrostatics of a peptide of the disclosure can impact cartilage homing.
  • Structural analysis or analysis of charge distribution can be a strategy to predict residues important in biological function, such as cartilage homing.
  • several peptides of this disclosure that home to cartilage can be grouped into a structural class defined herein as "hitchins," and can share the properties of disulfide linkages between C1-C4, C2-C5, and C3-C6.
  • the folding topologies of peptides knotted through three disulfide linkages (C1-C4, C2-C5, and C3-C6), can be broken down into structural families based on the three-dimensional arrangement of the disulfides.
  • Knottins have the C3-C6 disulfide linkage passing through the macrocycle formed by the Cl- C4 and C2-C5 disulfide linkages
  • hitchins have the C2-C5 disulfide linkage passing through the macrocycle formed by the C1-C4 and C3-C6 disulfide linkages
  • yet other structural families have the C1-C4 disulfide linkage passing through the macrocycle formed by the C2- C5 and C3-C6 disulfide linkages.
  • Variants of "hitchin" class peptides with preserved disulfide linkages at these cysteine residues, primary sequence identity, and/or structural homology can be a method of identifying or predicting other potential knottin peptide candidates that can home to cartilage.
  • Calcin peptides are structurally a subset of the knottin peptides, with knottin disulfide connectivity and topology, but are further classified on the basis of functioning to bind and activate ryanodine receptors (RyRs). These receptors are calcium channels that act to regulate the influx and efflux of calcium in muscle (Schwartz et al. Br J Pharmacol 157(3):392-403. (2009)). Variants of the calcin family of peptides with preserved key residues can be one way to predict promising candidates that can home to cartilage.
  • structural analysis of a peptide of this disclosure can be determined by evaluating peptides for resistance to degradation in buffers with various proteases or reducing agents. Structural analysis of the distribution of charge density on the surface of a peptide can also be a strategy for predicting promising candidates that can home to cartilage. Peptides with large patches of positive surface charge (when at pH 7.5) can home to cartilage.
  • the NMR solution structures, x-ray crystallography, or crystal structures of related structural homo logs can be used to inform mutational strategies that can improve the folding, stability, and manufacturability, while maintaining the ability of a peptide to home to cartilage. They can be used to predict the 3D pharmacophore of a group of structurally homologous scaffolds, as well as to predict possible graft regions of related proteins to create chimeras with improved properties. For example, this strategy can be used to identify critical amino acid positions and loops that can be used to design drugs with improved properties or to correct deleterious mutations that complicate folding and manufacturability for the peptides. These key amino acid positions and loops can be retained while other residues in the peptide sequences can be mutated to improve, change, remove, or otherwise modify function, homing, and activity of the peptide.
  • the comparison of the primary sequences and the tertiary sequences of two or more peptides can be used to reveal sequence and 3D folding patterns that can be leveraged to improve the peptides and parse out the biological activity of these peptides.
  • comparing two different peptide scaffolds that home to cartilage can lead to the identification of conserved pharmacophores that can guide engineering strategies, such as designing variants with improved folding properties.
  • Important pharmacophore for example, can comprise aromatic residues or basic residues, which can be important for binding.
  • Improved peptides can also be engineered based upon immieuxicity information, such as immunogenicity information predicted by TEPITOPE and TEPITOPEpan.
  • TEPITOPE is a computational approach which uses position specific scoring matrix to provide prediction rules for whether a peptide will bind to 51 different HLA-DR alleles
  • TEPITOPEpan is method that uses TEPITOPE to extrapolate from HLA-DR molecules with known binding specificities to HLA-DR molecules with unknown binding specificities based on pocket similarity.
  • TEPITOPE and TEPITOPEpan can be used to determine immunogenicity of peptides that home to cartilage. Comparison of peptides with high immunogenecity to peptides with low immunogenicity can guide engineering strategies for designing variants with decreased immunogenicity.
  • a peptide of this disclosure can bind to sodium channels.
  • the peptide can bind to calcium channels.
  • the peptide can block potassium channels and/or sodium channels.
  • the peptide can block calcium channels.
  • the peptide can activate potassium channels and/or sodium channels. In other embodiments, the peptide can activate calcium channels.
  • the peptide can be a potassium channel agonist, a potassium channel antagonist, a portion of a potassium channel, a sodium channel agonist, a sodium channel antagonist, a calcium channel agonist, a calcium channel antagonist, a hadrucalcin, a theraphotoxin, a huwentoxin, a kaliotoxin, a cobatoxin or a lectin.
  • the lectin can be SHL-Ib2.
  • the peptide can interact with, binds, inhibits, inactivates, or alters expression of ion channels or chloride channels.
  • the peptide can interact with an Navl.7 ion channel.
  • the peptide can interact with a Kv 1.3 ion channel.
  • the peptide interacts with proteases, matrix metalloproteinase, inhibits cancer cell migration or metastases, has antimicrobial activity, or has antitumor activity.
  • the peptide can interact with other possible proteases (e.g., elastases).
  • the peptide has other therapeutic effects on the cartilage or structures thereof or nearby.
  • Beta defensin expression in articular cartilage can be correlated with immunomodulatory functions as we well as osteoarthritis, autoimmune rheumatic disorders such as systemic lupus erythematosus and rheumatoid arthritis (Vordenbaumen and Schneider 2011, Varoga 2004 and Varoga 2005).
  • the peptides or their mutants inhibit beta defensins, supplement beta defensins, are competitive inhibitors of beta defensins, active or block activation of beta defensin targets, and are used as immune modulators, or to treat autoimmune, arthritis, infections, and other articular disorders.
  • the present disclosure can also encompass multimers of the various peptides described herein.
  • multimers include dimers, trimers, tetramers, pentamers, hexamers, heptamers, and so on.
  • a multimer can be a homomer formed from a plurality of identical subunits or a heteromer formed from a plurality of different subunits.
  • a peptide of the present disclosure is arranged in a multimeric structure with at least one other peptide,or two, three, four, five, six, seven, eight, nine, ten, or more other peptides.
  • the peptides of a multimeric structure each have the same sequence. In alternative embodiments, some or all of the peptides of a multimeric structure have different sequences.
  • the present disclosure further includes peptide scaffolds that, e.g., can be used as a starting point for generating additional peptides.
  • these scaffolds can be derived from a variety of knotted peptides or knottins.
  • Suitable peptides for scaffolds can include, but are not limited to, chlorotoxin, brazzein, circulin, stecrisp, hanatoxin, midkine, hefutoxin, potato carboxypeptidase inhibitor, bubble protein, attractin, oc-GI, oc- GID, ⁇ - ⁇ , ⁇ -MVIIA, ⁇ -CVID, ⁇ -MrIA, p-TIA, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, GsMTx4, margatoxin, shK, toxin K, chymotrypsin inhibitor (CTI), and EGF epiregulin core.
  • CTI chymotrypsin inhibitor
  • the peptide sequences of the disclosure are flanked by additional amino acids.
  • One or more additional amino acids can, for example, confer a desired in vivo charge, isoelectric point, chemical conjugation site, stability, or physiologic property to a peptide.
  • Identifying sequence homology can be important for determining key residues that preserve cartilage homing function. For example, in some embodiments identification of conserved positively charged residues can be important in preserving cartilage homing in any homologous variants that are made. In other embodiments, identification of basic or aromatic dyads, can be important in preserving interaction and activity with Kv ion channels in homologous variants.
  • Two or more peptides can share a degree of homology and share similar properties in vivo.
  • a peptide can share a degree of homology with a peptide of the present disclosure.
  • a peptide of the disclosure can have up to about 20% pairwise homology, up to about 25% pairwise homology, up to about 30% pairwise homology, up to about 35% pairwise homology, up to about 40% pairwise homology, up to about 45% pairwise homology, up to about 50% pairwise homology, up to about 55% pairwise homology, up to about 60% pairwise homology, up to about 65% pairwise homology, up to about 70% pairwise homology, up to about 75% pairwise homology, up to about 80% pairwise homology, up to about 85% pairwise homology, up to about 90% pairwise homology, up to about 95% pairwise homology, up to about 96% pairwise homology, up to about 97% pairwise homology, up to about 98% pairwise homology, up to about
  • a peptide of the disclosure can have at least about 20% pairwise homology, at least about 25% pairwise homology, at least about 30% pairwise homology, at least about 35% pairwise homology, at least about 40% pairwise homology, at least about 45% pairwise homology, at least about 50% pairwise homology, at least about 55% pairwise homology, at least about 60% pairwise homology, at least about 65% pairwise homology, at least about 70% pairwise homology, at least about 75% pairwise homology, at least about 80% pairwise homology, at least about 85% pairwise homology, at least about 90% pairwise homology, at least about 95% pairwise homology, at least about 96% pairwise homology, at least about 97% pairwise homology, at least about 98% pairwise homology, at least about 99% pairwise homology, at least about 99.5% pairwise homology, at least about 99.9% pairwise homology with a second peptide.
  • Various methods and software programs can be used to determine the homology between two or more peptide
  • the variant nucleic acid molecules of a peptide of any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432 can be identified by either a determination of the sequence identity or homology of the encoded peptide amino acid sequence with the amino acid sequence of any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432, or by a nucleic acid hybridization assay.
  • Such peptide variants can include nucleic acid molecules (1) that remain hybridized with a nucleic acid molecule having the nucleotide sequence of any one of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432 (or any complement of the previous sequences) under stringent washing conditions, in which the wash stringency is equivalent to 0.5x-2xSSC with 0.1% SDS at 55-65° C, and (2) that encode a peptide having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity or homology to the amino acid sequence of any one SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, S
  • peptide variants of any one SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432 can be characterized as nucleic acid molecules (1) that remain hybridized with a nucleic acid molecule having the nucleotide sequence of any one SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198-216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432 (or any complement of the previous sequences) under highly stringent washing conditions, in which the wash stringency is equivalent to 0.1x-0.2xSSC with 0.1% SDS at 50-65° C, and (2) that encode a peptide having at least 70%
  • Percent sequence identity or homology can be determined by conventional methods. See, for example, Altschul et al., Bull. Math. Bio. 48:603 (1986), and Henikoff and
  • FASTA similarity search algorithm of Pearson and Lipman is a suitable protein alignment method for examining the level of sequence identity or homology shared by an amino acid sequence of a peptide disclosed herein and the amino acid sequence of a peptide variant.
  • the FASTA algorithm is described by Pearson and
  • the trimmed initial regions are examined to determine whether the regions can be joined to form an approximate alignment with gaps.
  • the highest scoring regions of the two amino acid sequences are aligned using a modification of the Needleman-Wunsch-Sellers algorithm (Needleman and Wunsch, J. Mol. Biol. 48:444 (1970); Sellers, Siam J. Appl. Math. 26:787 (1974)), which allows for amino acid insertions and deletions.
  • FASTA can also be used to determine the sequence identity or homology of nucleic acid molecules using a ratio as disclosed above.
  • the ktup value can range between one to six, preferably from three to six, most preferably three, with other parameters set as described above.
  • ⁇ amino acids that are a "conservative amino acid substitution” are illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
  • the BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff and Henikoff, Proc. Nat'l Acad. Sci.
  • the BLOSUM62 substitution frequencies can be used to define conservative amino acid substitutions that may be introduced into the amino acid sequences of the present invention.
  • conservative amino acid substitution preferably refers to a substitution represented by a BLOSUM62 value of greater than -1.
  • an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
  • preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
  • Determination of amino acid residues that are within regions or domains that are critical to maintaining structural integrity can be determined. Within these regions one can determine specific residues that can be more or less tolerant of change and maintain the overall tertiary structure of the molecule.
  • Methods for analyzing sequence structure include, but are not limited to, alignment of multiple sequences with high amino acid or nucleotide identity or homology and computer analysis using available software (e.g., the Insight II.RTM. viewer and homology modeling tools; MSI, San Diego, Calif.), secondary structure propensities, binary patterns, complementary packing and buried polar interactions (Barton, G.J., Current Opin. Struct. Biol. 5:372-6 (1995) and Cordes, M.H. et al., Current Opin.
  • Pairwise sequence alignment is used to identify regions of similarity that may indicate functional, structural and/or evolutionary relationships between two biological sequences (protein or nucleic acid).
  • MSA multiple sequence alignment
  • homology can be inferred and the evolutionary relationship between the sequences assessed.
  • sequence homology and sequence identity and “percent ( ) sequence identity” and “percent ( ) sequence homology” have been used interchangeably to mean the sequence relatedness or variation, as appropriate, to a reference polynucleotide or amino acid sequence.
  • a peptide can be chemically modified one or more of a variety of ways.
  • the peptide can be mutated to add function, delete function, or modify the in vivo behavior.
  • One or more loops between the disulfide linkages can be modified or replaced to include active elements from other peptides (such as described in Moore and Cochran, Methods in Enzymology, 503, p.223-251, 2012).
  • Amino acids can also be mutated, such as to increase half-life, modify, add or delete binding behavior in vivo, add new targeting function, modify surface charge and hydrophobicity, or allow conjugation sites.
  • N-methylation is one example of methylation that can occur in a peptide of the disclosure.
  • the peptide can be modified by methylation on free amines. For example, full methylation can be accomplished through the use of reductive methylation with formaldehyde and sodium cyanoborohydride.
  • a chemical modification can, for instance, extend the half-life of a peptide or change the biodistribution or pharmacokinetic profile.
  • a chemical modification can comprise a polymer, a polyether, polyethylene glycol, a biopolymer, a polyamino acid, a fatty acid, a dendrimer, an Fc region, a simple saturated carbon chain such as palmitate or myristolate, or albumin.
  • the chemical modification of a peptide with an Fc region can be a fusion Fc- peptide.
  • a polyamino acid can include, for example, a polyamino acid sequence with repeated single amino acids (e.g., polyglycine), and a polyamino acid sequence with mixed polyamino acid sequences (e.g., gly-ala-gly-ala) that can or can not follow a pattern , or any combination of the foregoing.
  • a polyamino acid sequence with repeated single amino acids e.g., polyglycine
  • a polyamino acid sequence with mixed polyamino acid sequences e.g., gly-ala-gly-ala
  • the peptides of the present disclosure may be modified such that the modification increases the stability and/or the half-life of the peptides.
  • the attachment of a hydrophobic moiety, such as to the N-terminus, the C- terminus, or an internal amino acid can be used to extend half-life of a peptide of the present disclosure.
  • the peptide of the present disclosure can include post- translational modifications (e.g., methylation and/or amidation), which can affect, e.g., serum half-life.
  • simple carbon chains e.g., by myristoylation and/or palmitylation
  • the simple carbon chains may render the fusion proteins or peptides easily separable from the unconjugated material.
  • methods that may be used to separate the fusion proteins or peptides from the unconjugated material include, but are not limited to, solvent extraction and reverse phase chromatography.
  • the lipophilic moieties can extend half-life through reversible binding to serum albumin.
  • the conjugated moieties can, e.g., be lipophilic moieties that extend half-life of the peptides through reversible binding to serum albumin.
  • the lipophilic moiety can be cholesterol or a cholesterol derivative including cholestenes, cholestanes, cholestadienes and oxysterols.
  • the peptides can be conjugated to myristic acid (tetradecanoic acid) or a derivative thereof. In other embodiments, the peptides of the present disclosure are coupled (e.g., conjugated) to a half- life modifying agent.
  • half- life modifying agents include but are not limited to: a polymer, a polyethylene glycol (PEG), a hydroxyethyl starch, polyvinyl alcohol, a water soluble polymer, a zwitterionic water soluble polymer, a water soluble poly( amino acid), a water soluble polymer of proline, alanine and serine, a water soluble polymer containing glycine, glutamic acid, and serine, an Fc region, a fatty acid, palmitic acid, or a molecule that binds to albumin.
  • PEG polyethylene glycol
  • a hydroxyethyl starch polyvinyl alcohol
  • a water soluble polymer a zwitterionic water soluble polymer
  • a water soluble poly( amino acid) a water soluble poly( amino acid)
  • proline a water soluble polymer of proline
  • alanine and serine a water soluble polymer containing glycine, gluta
  • the first two N-terminal amino acids (GS) of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, or SEQ ID NO: 198 - SEQ ID NO: 216 can serve as a spacer or linker in order to facilitate conjugation or fusion to another molecule, as well as to facilitate cleavage of the peptide from such conjugated or fused molecules.
  • the fusion proteins or peptides of the present disclosure can be conjugated to other moieties that, e.g., can modify or effect changes to the properties of the peptides. Active Agent Conjugates
  • Peptides according to the present disclosure can be conjugated or fused to an agent for use in the treatment of cartilage diseases, disorders, or injuries.
  • a peptide as described herein can be fused to another molecule, such as an active agent that provides a functional capability.
  • a peptide can be fused with an active agent through expression of a vector containing the sequence of the peptide with the sequence of the active agent.
  • the sequence of the peptide and the sequence of the active agent are expressed from the same Open Reading Frame (ORF).
  • ORF Open Reading Frame
  • the sequence of the peptide and the sequence of the active agent can comprise a contiguous sequence.
  • the peptide and the active agent can each retain similar functional capabilities in the fusion peptide compared with their functional capabilities when expressed separately.
  • the peptides described herein are attached to another molecule, such as an active agent that provides a functional capability.
  • an active agent that provides a functional capability.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 active agents can be linked to a peptide.
  • Multiple active agents can be attached by methods such as conjugating to multiple lysine residues and/or the N-terminus, or by linking the multiple active agents to a scaffold, such as a polymer or dendrimer and then attaching that agent-scaffold to the peptide (such as described in Yurkovetskiy, A. V., Cancer Res 75(16): 3365-72 (2015).
  • active agents include but are not limited to: a peptide, an oligopeptide, a polypeptide, a
  • pep tido mimetic a polynucleotide, a polyribonucleotide, a DNA, a cDNA, a ssDNA, a RNA, a dsRNA, a micro RNA, an oligonucleotide, an antibody, a single chain variable fragment (scFv), an antibody fragment, an aptamer, a cytokine, an interferon, a hormone, an enzyme, a growth factor, a checkpoint inhibitor, a PD-1 inhibitor, a PD-Ll inhibitor, a CTLA4 inhibitor, a CD antigen, aa chemokine, a neurotransmitter, an ion channel inhibitor, a G-protein coupled receptor inhibitor, a G-protein coupled receptor activator, a chemical agent, a radio sensitizer, a radioprotectant, a radionuclide, a therapeutic small molecule, a steroid, a corticosteroid, an ant i-
  • TAC1/TNFRSF13B TAC1/TNFRSF13B
  • BAFF-R BAFF receptor/TNFRSF13C
  • HVEM herpes virus entry mediator/TNFRSF14
  • nerve growth factor receptor/TNFRS F 16 BCMA (B cell maturation antigen/TNFRSF17), GITR (glucocorticoid-induced TNF
  • TNF receptor superfamily ligand including - TNF alpha, lymphotoxin-a, tumor necrosis factor membrane form, tumor necrosis factor shed form, LIGHT, lymphotoxin ⁇ 2 ⁇ heterotrimer, OX-40 ligand, compound 1 [PMID: 24930776], CD40 ligand, Fas ligand, TLIA, CD70, CD30 ligand, TRAFl, TRAF2, TRAF3, TRAIL, RANK ligand, APRIL, BAFF, B and T lymphocyte attenuator, NGF, BDNF, neurotrophin-3, neurotrophin-4, TL6,
  • a cytotoxic chemical e.g. imatinib mesylate
  • protons bevacuzimab (antivascular agent), erlotinib (EGFR inhibitor)
  • an anti- infective agent an antibiotic, an anti- viral agent, an anti-fungal agent, an aminoglycoside, a nonsteroidal anti- inflammatory drug (NSAID), a statin, a nanoparticle, a liposome, a polymer, a biopolymer, a polysaccharide, a proteoglycan, a glycosaminoglycan, polyethylene glycol, a lipid, a dendrimer, a fatty acid, or an Fc domain or an Fc region, or an active fragment or a modification thereof.
  • a tyrosine kinase inhibitor e.g. imatinib mesylate
  • protons e.g. imatinib mesylate
  • bevacuzimab (antivascular agent) antivascular
  • any combination of the above active agents can be co-delivered with peptides or peptide conjugates of this disclosure.
  • other co-therapies such as proton therapy or ablative radiotherapy can be administered to a subject in need thereof along with peptides or peptide conjugates of this disclosure.
  • the peptide is covalently or non-covalently linked to an active agent, e.g., directly or via a linker.
  • TNF blockers suppress the immune system by blocking the activity of TNF, a substance in the body that can cause inflammation and lead to immune-system diseases, such as Crohn's disease, ulcerative colitis, rheumatoid arthritis, ankylosing spondylitis, psoriatic arthritis and plaque psoriasis.
  • the drugs in this class include Remicade (infliximab), Enbrel (etanercept), Humira (adalimumab), Cimzia (certolizumab pegol) and Simponi (golimumab).
  • the peptide disclosed herein can be used to home, distribute to, target, directed to, is retained by, accumulate in, migrate to, and/or bind to cartilage, and thus also be used for localizing the attached or fused active agent.
  • knotted chlorotoxin peptide can be internalized in cells (Wiranowska, M., Cancer Cell Int., 11: 27 (2011)). Therefore, cellular internalization, subcellular localization, and intracellular trafficking after internalization of the active agent peptide conjugate or fusion peptide can be important factors in the efficacy of an active agent conjugate or fusion. (Ducry, L., Antibody Drug Conjugates (2013); and Singh, S. K., Pharm Res. 32(11): 3541-3571 (2015)).
  • the peptides or fusion peptides of the present disclosure can also be conjugated to other moieties that can serve other roles, such as providing an affinity handle (e.g., biotin) for retrieval of the peptides from tissues or fluids.
  • an affinity handle e.g., biotin
  • peptides or fusion peptides of the present disclosure can also be conjugated to biotin.
  • biotin could also act as an affinity handle for retrieval of peptides or fusion peptides from tissues or other locations.
  • fluorescent biotin conjugates that can act both as a detectable label and an affinity handle can be used.
  • Non limiting examples of commercially available fluorescent biotin conjugates include Atto 425-Biotin, Atto 488-Biotin, Atto 520- Biotin, Atto-550 Biotin, Atto 565-Biotin, Atto 590-Biotin, Atto 610-Biotin, Atto 620-Biotin, Atto 655-Biotin, Atto 680-Biotin, Atto 700-Biotin, Atto 725-Biotin, Atto 740-Biotin, fluorescein biotin, biotin-4-fluorescein, biotin-(5-fluorescein) conjugate, and biotin-B- phycoerythrin, Alexa fluor 488 biocytin, Alexa flour 546, Alexa Fluor 549, lucifer yellow cadaverine biotin-X, Lucifer yellow biocytin, Oregon green 488 biocytin, biotin-rhodamine and tetramethylrho
  • the conjugates could include chemiluminescent compounds, colloidal metals, luminescent compounds, enzymes, radioisotopes, and paramagnetic labels.
  • the peptide described herein can be attached to another molecule.
  • the peptide sequence also can be attached to another active agent (e.g., small molecule, peptide, polypeptide, polynucleotide, antibody, aptamer, cytokine, growth factor, neurotransmitter, an active fragment or modification of any of the preceding, fluorophore, radioisotope, radionuclide chelator, acyl adduct, chemical linker, or sugar, etc.).
  • the peptide can be fused with, or covalently or non-covalently linked to an active agent.
  • peptide sequence derived from a toxin or venom can be present on or fused with a particular peptide.
  • a peptide can be incorporated into a biomolecule by various techniques.
  • a peptide can be incorporated by a chemical
  • a peptide can be incorporated, for example, by solid phase or solution phase peptide synthesis.
  • a peptide can be incorporated by preparing a nucleic acid sequence encoding the biomolecule, wherein the nucleic acid sequence includes a subsequence that encodes the peptide. The subsequence can be in addition to the sequence that encodes the biomolecule, or can substitute for a subsequence of the sequence that encodes the biomolecule.
  • a peptide can be conjugated to an agent used in imaging, research, therapeutics, theranostics, pharmaceuticals, chemotherapy, chelation therapy, targeted drug delivery, and radiotherapy.
  • the agent can be a detectable agent.
  • a knottin peptide is conjugated to detectble agents, such as a metal, a radioisotope, a dye, fluorophore, or another suitable material that can be used in imaging.
  • radioisotopes include alpha emitters, beta emitters, positron emitters, and gamma emitters.
  • the metal or radioisotope is selected from the group consisting of actinium, americium, bismuth, cadmium, cesium, cobalt, europium, gadolinium, iridium, lead, lutetium, manganese, palladium, polonium, radium, ruthenium, samarium, strontium, technetium, thallium, and yttrium.
  • the metal is actinium, bismuth, lead, radium, strontium, samarium, or yttrium.
  • the radioisotope is actinium- 225 or lead-212.
  • the fluorophore is a fluorescent agent emitting
  • the fluorophore is a fluorescent agent is selected from the group consisting of Non- limiting examples of fluorescent dyes that could be used as a conjugating molecule in the present disclosure include DyLight-680, DyLight- 750, VivoTag-750, DyLight-800, IRDye-800, VivoTag-680, Cy5.5, or indocyanine green (ICG). In some embodiments, near infrared dyes often include cyanine dyes.
  • Suitable fluorescent dyes include, but are not limited to, fluorescein and fluorescein dyes (e.g., fluorescein isothiocyanine or FITC, naphthofluorescein, 4', 5'-dichloro-2',7' - dimethoxyfluorescein, 6-carboxyfluorescein or FAM, etc.), carbocyanine, merocyanine, styryl dyes, oxonol dyes, phycoerythrin, erythrosin, eosin, rhodamine dyes (e.g., fluorescein and fluorescein dyes (e.g., fluorescein isothiocyanine or FITC, naphthofluorescein, 4', 5'-dichloro-2',7' - dimethoxyfluorescein, 6-carboxyfluorescein or FAM, etc.), carbocyanine, merocyanine, sty
  • carboxytetramethyl-rhodamine or TAMRA carboxyrhodamine 6G, carboxy-X-rhodamine (ROX), lissamine rhodamine B, rhodamine 6G, rhodamine Green, rhodamine Red, tetramethylrhodamine (TMR), etc.), coumarin and coumarin dyes (e.g., methoxycoumarin, dialkylaminocoumarin, hydroxycoumarin, aminomethylcoumarin (AMCA), etc.), Oregon Green Dyes (e.g., Oregon Green 488, Oregon Green 500, Oregon Green 514., etc.), Texas Red, Texas Red-X, SPECTRUM RED, SPECTRUM GREEN, cyanine dyes (e.g., CY-3, Cy- 5, CY-3.5, CY-5.5, etc.), ALEXA FLUOR dyes (e.g., ALEXA FLUOR 350, ALEXA FLUOR 4
  • radioisotopes include alpha emitters, beta emitters, positron emitters, and gamma emitters.
  • the metal or radioisotope is selected from the group consisting of actinium, americium, bismuth, cadmium, cesium, cobalt, europium, gadolinium, iridium, lead, lutetium, manganese, palladium, polonium, radium, ruthenium, samarium, strontium, technetium, thallium, and yttrium.
  • the metal is actinium, bismuth, lead, radium, strontium, samarium, or yttrium.
  • the radioisotope is actinium- 225 or lead-212.
  • radio sensitizers include but are not limited to: ABT-263, ABT-199, WEHI-539, paclitaxel, carboplatin, cisplatin, oxaliplatin, gemcitabine, etanidazole, misonidazole, tirapazamine, and nucleic acid base derivatives (e.g., halogenated purines or pyrimidines, such as 5-fluorodeoxyuridine).
  • photo sensitizers include but are not limited to: fluorescent molecules or beads that generate heat when illuminated, porphyrins and porphyrin derivatives (e.g., chlorins, bacteriochlorins, isobacteriochlorins, phthalocyanines, and naphthalocyanines), metalloporphyrins, metallophthalocyanines, angelicins, chalcogenapyrrillium dyes, chlorophylls, coumarins, flavins and related compounds such as alloxazine and riboflavin, fuUerenes, pheophorbides, pyropheophorbides, cyanines (e.g., merocyanine 540), pheophytins, sapphyrins, texaphyrins, purpurins, porphycenes, phenothiaziniums, methylene blue derivatives, naphthalimides, nile blue derivatives, quinones, perylene
  • the peptide is covalently or non-covalently linked to the agent, e.g., directly or via a linker.
  • Peptides according to the present disclosure that home, target, migrate to, are retained by, accumulate in, and/or bind to, or are directed to the cartilage can be attached to another moiety (e.g., an active agent), such as a small molecule, a second peptide, a protein, an antibody, an antibody fragment, an aptamer, polypeptide, polynucleotide, a fluorophore, a radioisotope, a radionuclide chelator, a polymer, a biopolymer, a fatty acid, an acyl adduct, a chemical linker, or sugar or other active agent described herein through a linker, or directly in the absence of a linker.
  • an active agent such as a small molecule, a second peptide, a protein, an antibody, an antibody fragment, an aptamer, polypeptide, polynucleotide, a fluorophore, a radioisotope, a radionu
  • a peptide can be directly attached to another molecule by a covalent attachment.
  • the peptide is attached to a terminus of the amino acid sequence of a larger polypeptide or peptide molecule, or is attached to a side chain, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a no n- natural amino acid residue, or glutamic acid residue.
  • the attachment can be via an amide bond, an ester bond, an ether bond, a carbamate bond, a carbon-nitrogen bond, a triazole, a macrocycle, an oxime bond, a hydrazone bond, a carbon-carbon single double or triple bond, a disulfide bond, or a thioether bond.
  • similar regions of the disclosed peptide(s) itself can be used to link other molecules.
  • an amino acid side chain such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a no n- natural amino acid residue, or glutamic acid residue
  • an amide bond, an ester bond, an ether bond, a carbamate bond, a carbon-nitrogen bond, a triazole, a macrocycle, an oxime bond, a hydrazone bond, a carbon- carbon single double or triple bond, a disulfide bond, or a thioether bond, or linker as described herein can be used to link other molecules.
  • Attachment via a linker can involve incorporation of a linker moiety between the other molecule and the peptide.
  • the peptide and the other molecule can both be covalently attached to the linker.
  • the linker can be cleavable, non-cleavable, self- immolating, hydrophilic, or hydrophobic.
  • the linker can have at least two functional groups with one bonded to the peptide, the other bonded to the other molecule, and a linking portion between the two functional groups.
  • Non-limiting examples of the functional groups for attachment can include functional groups capable of forming an amide bond, an ester bond, an ether bond, a carbonate bond, a carbamate bond, or a thioether bond.
  • Non-limiting examples of functional groups capable of forming such bonds can include amino groups; carboxyl groups; hydroxyl groups; aldehyde groups; azide groups; alkyne and alkene groups; ketones; hydrazides; acid halides such as acid fluorides, chlorides, bromides, and iodides; acid anhydrides, including symmetrical, mixed, and cyclic anhydrides; carbonates; carbonyl functionalities bonded to leaving groups such as cyano, succinimidyl, and N-hydroxysuccinimidyl; hydroxyl groups; sulfhydryl groups; and molecules possessing, for example, alkyl, alkenyl, alkynyl, allylic, or benzylic leaving groups, such as halides, me
  • Non-limiting examples of the linking portion can include alkylene, alkenylene, alkynylene, polyether, such as polyethylene glycol (PEG), hydroxy carboxylic acids, polyester, polyamide, polyamino acids, polypeptides, cleavable peptides, valine-citrulline, aminobenzylcarbamates, D-amino acids, and polyamine, any of which being unsubstituted or substituted with any number of substituents, such as halogens, hydroxyl groups, sulfhydryl groups, amino groups, nitro groups, nitroso groups, cyano groups, azido groups, sulfoxide groups, sulfone groups, sulfonamide groups, carboxyl groups, carboxaldehyde groups, imine groups, alkyl groups, halo-alkyl groups, alkenyl groups, halo-alkenyl groups, alkynyl groups, halo-alkynyl groups,
  • Non- limiting exam les of linkers include:
  • each n is independently 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, or about 50.
  • m is 1 to about 1,000; 1 to about 500; 1 to about 250; 1 to about 200; 1 to about 150; 1 to about 100; 1 to about 50; 1 to about 40; 1 to about 30; 1 to about 25; 1 to about 20; 1 to about 15; 1 to about 10; or 1 to about 5.
  • m is 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, or about 50.
  • a linker can be a succinic linker, and a drug can be attached to a peptide via an ester bond or an amide bond with two methylene carbons in between.
  • a linker can be any linker with both a hydroxyl group and a carboxylic acid, such as hydroxy hexanoic acid or lactic acid.
  • the linker can be a cleavable or a noncleavable linker.
  • a cleavable linker permits release of the conjugated moiety (e.g., a therapeutic agent) from the peptide, e.g., after targeting to the cartilage.
  • the linker is enzyme cleavable, e.g., a valine- citrulline linker.
  • the linker contains a self- immolating portion.
  • the linker includes one or more cleavage sites for a specific protease, such as a cleavage site for matrix metalloproteases (MMPs), thrombin, or cathepsin.
  • MMPs matrix metalloproteases
  • the linker is cleavable by other mechanisms, such as via pH, reduction, or hydrolysis.
  • a hydrolytically labile linker (amongst other cleavable linkers described herein) can be advantageous in terms of releasing active agents from the peptide.
  • an active agent in a conjugate form with the peptide may not be active, but upon release from the conjugate after targeting to the cartilage, the active agent is active.
  • the rate of hydrolysis of the linker can be tuned. For example, the rate of hydrolysis of linkers with unhindered esters is faster compared to the hydrolysis of linkers with bulky groups next an ester carbonyl.
  • a bulky group can be a methyl group, an ethyl group, a phenyl group, a ring, or an isopropyl group, or any group that provides steric bulk.
  • the steric bulk can be provided by the drug itself, such as by ketorolac when conjugated via its carboxylic acid.
  • the rate of hydrolysis of the linker can be tuned according to the residency time of the conjugate in the cartilage.
  • the linker when a peptide is cleared from the cartilage relatively quickly, the linker can be tuned to rapidly hydro lyze. In contrast, for example, when a peptide has a longer residence time in the cartilage, a slower hydrolysis rate can allow for extended delivery of an active agent. This can be important when the peptide is used to deliver a drug to the cartilage.
  • "Programmed hydrolysis in designing paclitaxel prodrug for nanocarrier assembly" Sci Rep 2015, 5, 12023 Fu et al., provides an example of modified hydrolysis rates.
  • a peptide of the present disclosure can be stable in various biological conditions.
  • any peptide of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 can exhibit resistance to reducing agents, proteases, oxidative conditions, or acidic conditions.
  • biologic molecules such as peptides and proteins
  • the GI tract can contain a region of low pH (e.g. pH ⁇ 1), a reducing environment, or a protease-rich environment that can degrade peptides and proteins.
  • a region of low pH e.g. pH ⁇ 1
  • a reducing environment e.g. a reducing environment
  • a protease-rich environment e.g. a protease-rich environment that can degrade peptides and proteins.
  • Proteolytic activity in other areas of the body such as the mouth, eye, lung, intranasal cavity, joint, skin, vaginal tract, mucous membranes, and serum, can also be an obstacle to the delivery of functionally active peptides and polypeptides.
  • the half-life of peptides in serum can be very short, in part due to proteases, such that the peptide can be degraded too quickly to have a lasting therapeutic effect when administering reasonable dosing regimens.
  • proteolytic activity in cellular compartments such as lysosomes and reduction activity in lysosomes and the cytosol can degrade peptides and proteins such that they may be unable to provide a therapeutic function on intracellular targets. Therefore, peptides that are resistant to reducing agents, proteases, and low pH may be able to provide enhanced therapeutic effects or enhance the therapeutic efficacy of co-formulated or conjugated active agents in vivo.
  • oral delivery of drugs can be desirable in order to target certain areas of the body (e.g., disease in the GI tract such as colon cancer, irritable bowel disorder, infections, metabolic disorders, and constipation) despite the obstacles to the delivery of functionally active peptides and polypeptides presented by this method of administration.
  • oral delivery of drugs can increase compliance by providing a dosage form that is more convenient for patients to take as compared to parenteral delivery.
  • Oral delivery can be useful in treatment regimens that have a large therapeutic window. Therefore, peptides that are resistant to reducing agents, proteases, and low pH can allow for oral delivery of peptides without nullifying their therapeutic function.
  • Peptides of this disclosure can contain one or more cysteines, which can participate in disulfide bridges that can be integral to preserving the folded state of the peptide. Exposure of peptides to biological environments with reducing agents can result in unfolding of the peptide and loss of functionality and bioactivity.
  • glutathione GSH is a reducing agent that can be present in many areas of the body and in cells, and can reduce disulfide bonds.
  • a peptide can become reduced upon cellular
  • a peptide can become reduced upon exposure to various parts of the GI tract.
  • the GI tract can be a reducing environment, which can inhibit the ability of therapeutic molecules with disulfide bonds to have optimal therapeutic efficacy, due to reduction of the disulfide bonds.
  • a peptide can also be reduced upon entry into a cell, such as after internalization by endosomes or lysosomes or into the cytosol, or other cellular
  • a peptide that is resistant to reduction can remain intact and can impart a functional activity for a longer period of time in various compartments of the body and in cells, as compared to a peptide that is more readily reduced. .
  • the peptides of this disclosure can be analyzed for the characteristic of resistance to reducing agents to identify stable peptides.
  • the peptides of this disclosure can remain intact after being exposed to different molarities of reducing agents such as 0.00001M - 0.0001M, 0.0001M - 0.001M, 0.001M - 0.01M, 0.01 M - 0.05 M, 0.05 M - 0.1 M, for greater 15 minutes or more.
  • the reducing agent used to determine peptide stability can be dithiothreitol (DTT), Tris(2-carboxyethyl)phosphine HC1 (TCEP), 2-Mercaptoethanol, (reduced) glutathione (GSH), or any combination thereof.
  • proteases can be enzymes that can degrade peptides and proteins by breaking bonds between adjacent amino acids. Families of proteases with specificity for targeting specific amino acids can include serine proteases, cysteine proteases, threonine proteases, aspartic proteases, glutamic proteases, esterases, serum proteases, and asparagine proteases. Additionally,
  • metalloproteases can also digest peptides and proteins.
  • Proteases can be present at high concentration in blood, in mucous membranes, lungs, skin, the GI tract, the mouth, nose, eye, and in compartments of the cell. Misregulation of proteases can also be present in various diseases such as rheumatoid arthritis and other immune disorders. Degradation by proteases can reduce bioavailability, biodistribution, half- life, and bioactivity of therapeutic molecules such that they are unable to perform their therapeutic function. In some
  • peptides that are resistant to proteases can better provide therapeutic activity at reasonably tolerated concentrations in vivo.
  • peptides of this disclosure can resist degradation by any class of protease.
  • peptides of this disclosure resist degradation by pepsin (which can be found in the stomach), trypsin (which can be found in the duodenum), serum proteases, or any combination thereof.
  • peptides of this disclosure can resist degradation by lung proteases (e.g., serine, cysteinyl, and aspartyl proteases, metalloproteases, neutrophil elastase, alpha- 1 antitrypsin, secretory leucoprotease inhibitor, elafin), or any combination thereof.
  • the proteases used to determine peptide stability can be pepsin, trypsin, chymotrypsin, or any combination thereof. In some embodiments, at least 5%-10%, at least 10%-20%, at least 20%-30%, at least 30%-40%, at least 40%-50%, at least 50%-60%, at least 60%-70%, at least 70%-80%, at least 80%-90%, or at least 90%- 100% of the peptide remains intact after exposure to a protease.
  • Peptides of SEQ ID NO: 212, SEQ ID NO: 24, and SEQ ID NO: 111 can have particular structural qualities, which make them more resistant to protease degradation. For example, peptide of SEQ ID NO: 24 and SEQ ID NO: 112 exhibit the "hitchin" topology as described previously, which can be associated with resistance to protease and chemical degradation.
  • Peptides of this disclosure can be administered in biological environments that are acidic.
  • peptides can experience acidic environmental conditions in the gastric fluids of the stomach and gastrointestinal (GI) tract.
  • the pH of the stomach can range from -1-4 and the pH of the GI tract ranges from acidic to normal physiological pH descending from the upper GI tract to the colon.
  • the vagina, late endosomes, and lysosomes can also hav acidic pH values, such as less than pH 7. These acidic conditions can lead to denaturation of peptides and proteins into unfolded states.
  • Unfolding of peptides and proteins can lead to increased susceptibility to subsequent digestion by other enzymes as well as loss of biological activity of the peptide.
  • the peptides of this disclosure can resist denaturation and degradation in acidic conditions and in buffers, which simulate acidic conditions.
  • peptides of this disclosure can resist denaturation or degradation in buffer with a pH less than 1, a pH less than 2, a pH less than 3, a pH less than 4, a pH less than 5, a pH less than 6, a pH less than 7, or a pH less than 8.
  • peptides of this disclosure remain intact at a pH of 1-3.
  • the peptides of this disclosure can be resistant to denaturation or degradation in simulated gastric fluid (pH 1-2).
  • low pH solutions such as simulated gastric fluid or citrate buffers can be used to determine peptide stability.
  • Peptides of this disclosure can be administered in biological environments with high temperatures.
  • peptides can experience high temperatures in the body.
  • Body temperature can range from 36°C to 40°C.
  • High temperatures can lead to denaturation of peptides and proteins into unfolded states. Unfolding of peptides and proteins can lead to increased susceptibility to subsequent digestion by other enzymes as well as loss of biological activity of the peptide.
  • a peptide of this disclosure can remain intact at temperatures from 25 °C to 100°C. High temperatures can lead to faster degradation of peptides. Stability at a higher temperature can allow for storage of the peptide in tropical environments or areas where access to refrigeration is limited.
  • 5%-100% of the peptide can remain intact after exposure to 25 °C for 6 months to 5 years. 5%-100% of a peptide can remain intact after exposure to 70°C for 15 minutes to 1 hour. 5%-100% of a peptide can remain intact after exposure to 100°C for 15 minutes to 1 hour. In other embodiments, at least 5%-10%, at least 10%-20%, at least 20%-30%, at least 30%-40%, at least 40%-50%, at least 50%-60%, at least 60%-70%, at least 70%-80%, at least 80%-90%, or at least 90%- 100% of the peptide remains intact after exposure to 25 °C for 6 months to 5 years.
  • the pharmacokinetics of any of the peptides of this disclosure can be determined after administration of the peptide via different routes of administration.
  • the pharmacokinetic parameters of a peptide of this disclosure can be quantified after
  • Peptides of the present disclosure can be analyzed by using tracking agents such as radiolabels or fluorophores.
  • a radiolabeled peptides of this disclosure can be administered via various routes of administration.
  • Peptide concentration or dose recovery in various biological samples such as plasma, urine, feces, any organ, skin, muscle, and other tissues can be determined using a range of methods including HPLC, fluorescence detection techniques (TECAN),
  • the methods and compositions described herein can relate to pharmacokinetics of peptide administration via any route to a subject.
  • Pharmacokinetics can be described using methods and models, for example, compartmental models or noncompartmental methods.
  • Compartmental models include but are not limited to monocompartmental model, the two compartmental model, the multicompartmental model or the like.
  • Models can be divided into different compartments and can be described by the corresponding scheme. For example, one scheme is the absorption, distribution, metabolism and excretion (ADME) scheme. For another example, another scheme is the liberation, absorption, distribution, metabolism and excretion (LADME) scheme.
  • ADME absorption, distribution, metabolism and excretion
  • LADME liberation, absorption, distribution, metabolism and excretion
  • metabolism and excretion can be grouped into one compartment referred to as the elimination compartment.
  • liberation can include liberation of the active portion of the composition from the delivery system, absorption includes absorption of the active portion of the composition by the subject, distribution includes distribution of the composition through the blood plasma and to different tissues, metabolism, which includes metabolism or inactivation of the composition and finally excretion, which includes excretion or elimination of the composition or the products of metabolism of the composition.
  • Compositions administered intravenously to a subject can be subject to multiphasic pharmacokinetic profiles, which can include but are not limited to aspects of tissue distribution and metabolism/excretion.
  • the decrease in plasma or serum concentration of the composition is often biphasic, including, for example an alpha phase and a beta phase, occasionally a gamma, delta or other phase is observed
  • Pharmacokinetics includes determining at least one parameter associated with administration of a peptide to a subject.
  • parameters include at least the dose (D), dosing interval ( ⁇ ), area under curve (AUC), maximum concentration (C max ), minimum concentration reached before a subsequent dose is administered (Cmi n ), minimum time (Tmin), maximum time to reach Cmax (T max ), volume of distribution (V d ), steady-state volume of distribution (V ss ), back-extrapolated concentration at time 0 (Co), steady state concentration (Css), elimination rate constant (k e ), infusion rate (kj n ), clearance (CL), bioavailability (f), fluctuation (%PTF) and elimination half-life (ti /2 ).
  • the peptides of any of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 exhibit optimal pharmacokinetic parameters after oral administration.
  • the peptides of any of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 exhibit optimal pharmacokinetic parameters after any route of administration, such as oral administration, inhalation, intranasal administration, topical administration, intravenous administration, subcutaneous administration, intra-articular administration, intramuscular administration, intraperitoneal administration, or any combination thereof.
  • any peptide of SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 exhibits an average T max of 0.5 - 12 hours, or 1-48 hours at which the C max is reached, an average bioavailability in serum of 0.1% - 10% in the subject after administering the peptide to the subject by an oral route, an average bioavailability in serum of less than 0.1% after oral administration to a subject for delivery to the GI tract, an average
  • bioavailability in serum of 10-100% after parenteral administration an average t 1 ⁇ 2 of 0.1 hours - 168 hours, or 0.25 hours - 48 hours in a subject after administering the peptide to the subject, an average clearance (CL) of 0.5-100 L/hour or 0.5 - 50 L/hour of the peptide after administering the peptide to a subject, an average volume of distribution (V d ) of 200 - 20,000 mL in the subject after systemically administering the peptide to the subject, or optionally no systemic uptake, any combination thereof.
  • CL average clearance
  • V d average volume of distribution
  • Various expression vector/host systems can be utilized for the production of the recombinant expression of peptides described herein.
  • Non- limiting examples of such systems include microorganisms such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing a nucleic acid sequence encoding peptides or peptide fusion proteins/chimeric proteins described herein, yeast transformed with recombinant yeast expression vectors containing the aforementioned nucleic acid sequence, insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing the aforementioned nucleic acid sequence, plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus (CaMV), tobacco mosaic virus (TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the aforementioned nucleic acid sequence, or animal cell systems inf
  • a host cell can be adapted to express one or more peptides described herein.
  • the host cells can be prokaryotic, eukaryotic, or insect cells.
  • host cells are capable of modulating the expression of the inserted sequences, or modifying and processing the gene or protein product in the specific fashion desired. For example, expression from certain promoters can be elevated in the presence of certain inducers (e.g., zinc and cadmium ions for metallothionine promoters).
  • inducers e.g., zinc and cadmium ions for metallothionine promoters.
  • modifications e.g., phosphorylation
  • processing e.g., cleavage
  • Host cells can have characteristic and specific mechanisms for the post-translational processing and modification of a peptide.
  • the host cells used to express the peptides secretes minimal amounts of proteolytic enzymes.
  • organisms can be treated prior to purification to preserve and/or release a target polypeptide.
  • the cells are fixed using a fixing agent.
  • the cells are lysed.
  • the cellular material can be treated in a manner that does not disrupt a significant proportion of cells, but which removes proteins from the surface of the cellular material, and/or from the interstices between cells.
  • cellular material can be soaked in a liquid buffer or, in the case of plant material, can be subjected to a vacuum, in order to remove proteins located in the
  • the cellular material is a microorganism
  • proteins can be extracted from the microorganism culture medium.
  • the peptides can be packed in inclusion bodies. The inclusion bodies can further be separated from the cellular components in the medium.
  • the cells are not disrupted.
  • a cellular or viral peptide that is presented by a cell or virus can be used for the attachment and/or purification of intact cells or viral particles.
  • Peptides can also be synthesized in a cell- free system using a variety of known techniques employed in protein and peptide synthesis.
  • a host cell produces a peptide that has an attachment point for a drug.
  • An attachment point could comprise a lysine residue, an N-terminus, a cysteine residue, a cysteine disulfide bond, or a non-natural amino acid.
  • the peptide could also be produced synthetically, such as by solid-phase peptide synthesis, or solution-phase peptide synthesis.
  • the peptide could be folded (formation of disulfide bonds) during synthesis or after synthesis or both.
  • Peptide fragments could be produced synthetically or recombinantly and then joined together synthetically, recombinantly, or via an enzyme.
  • FIG. 10 illustrates a schematic of a method of manufacturing a construct that expresses a peptide of the disclosure, such as the constructs illustrated in FIG. 9 and as described throughout the disclosure and in SEQ ID NO: 1 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 provided herein.
  • the peptides of the present disclosure can be prepared by
  • a pharmaceutical composition of the disclosure can be a combination of any peptide described herein with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, antioxidants, solubilizers, buffers, osmolytes, salts, surfactants, amino acids, encapsulating agents, bulking agents,
  • cryoprotectants and/or excipients.
  • the pharmaceutical composition facilitates administration of a peptide described herein to an organism.
  • Pharmaceutical compositions can be administered in therapeutically-effective amounts as pharmaceutical compositions by various forms and routes including, for example, intravenous, subcutaneous, intramuscular, rectal, aerosol, parenteral, ophthalmic, pulmonary, transdermal, vaginal, optic, nasal, oral, sublingual, inhalation, dermal, intrathecal, intranasal, and topical administration.
  • a pharmaceutical composition can be administered in a local or systemic manner, for example, via injection of the peptide described herein directly into an organ, optionally in a depot.
  • Parenteral injections can be formulated for bolus injection or continuous infusion.
  • the pharmaceutical compositions can be in a form suitable for parenteral injection as a sterile suspension, solution or emulsion in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • Pharmaceutical formulations for parenteral administration include aqueous solutions of a peptide described herein in water soluble form. Suspensions of peptides described herein can be prepared as oily injection suspensions.
  • Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
  • Aqueous injection suspensions can contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
  • the suspension can also contain suitable stabilizers or agents which increase the solubility and/or reduces the aggregation of such peptides described herein to allow for the preparation of highly concentrated solutions.
  • the peptides described herein can be lyophilized or in powder form for re-constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • a purified peptide is administered intravenously.
  • a peptide of the disclosure can be applied directly to an organ, or an organ tissue or cells, such as brain or brain tissue or cancer cells, during a surgical procedure.
  • the recombinant peptides described herein can be administered topically and can be formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams, and ointments.
  • Such pharmaceutical compositions can contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.
  • therapeutically- effective amounts of the peptide described herein described herein can be administered in pharmaceutical compositions to a subject suffering from a condition that affects the immune system.
  • the subject is a mammal such as a human.
  • a therapeutically- effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors.
  • compositions can be formulated using one or more physiologically- acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations that can be used pharmaceutically. Formulation can be modified depending upon the route of administration chosen.
  • Pharmaceutical compositions comprising a peptide described herein can be manufactured, for example, by expressing the peptide in a recombinant system, purifying the peptide, lyophilizing the peptide, mixing, dissolving, granulating, dragee- making, levigating, emulsifying, encapsulating, entrapping, or compression processes.
  • the pharmaceutical compositions can include at least one
  • Methods for the preparation of peptides described herein comprising the compounds described herein include formulating the peptide described herein with one or more inert, pharmaceutically-acceptable excipients or carriers to form a solid, semi-solid, or liquid composition.
  • Solid compositions include, for example, powders, tablets, dispersible granules, capsules, cachets, and suppositories. These compositions can also contain minor amounts of nontoxic, auxiliary substances, such as wetting or emulsifying agents, pH buffering agents, and other pharmaceutically-acceptable additives.
  • Non- limiting examples of pharmaceutically-acceptable excipients can be found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams &
  • a pharmaceutical composition of the disclosure can be a combination of any venom or toxin derived peptide described herein with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients.
  • the pharmaceutical composition facilitates administration of a peptide described herein to an organism.
  • Pharmaceutical compositions can be administered in therapeutically- effective amounts as pharmaceutical compositions by various forms and routes including, for example, intravenous, subcutaneous, intramuscular, rectal, aerosol, parenteral, ophthalmic, pulmonary, transdermal, vaginal, optic, nasal, oral, inhalation, dermal, intra-articular, intrathecal, intranasal, and topical administration.
  • a pharmaceutical composition can be administered in a local or systemic manner, for example, via injection of the peptide described herein directly into an organ, optionally in a depot.
  • Parenteral injections can be formulated for bolus injection or continuous infusion.
  • the pharmaceutical compositions can be in a form suitable for parenteral injection as a sterile suspension, solution or emulsion in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • Pharmaceutical formulations for parenteral administration include aqueous solutions of a peptide described herein in water-soluble form. Suspensions of peptides described herein can be prepared as oily injection suspensions.
  • Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
  • Aqueous injection suspensions can contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
  • the suspension can also contain suitable stabilizers or agents which increase the solubility and/or reduces the aggregation of such peptides described herein to allow for the preparation of highly concentrated solutions.
  • the peptides described herein can be lyophilized or in powder form for re-constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • a purified peptide is administered intravenously.
  • a peptide described herein can be administered to a subject, home, target, migrates to, is retained by, and/or binds to, or be directed to an organ, e.g., the cartilage.
  • a peptide of the disclosure can be applied directly to an organ, or an organ tissue or cells, such as cartilage or cartilage tissue or cells, during a surgical procedure.
  • the recombinant peptides described herein can be administered topically and can be formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams, and ointments.
  • Such pharmaceutical compositions can contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.
  • therapeutically- effective amounts of the peptide described herein described herein are administered in pharmaceutical compositions to a subject suffering from a condition.
  • the pharmaceutical composition will affect the physiology of the animal, such as the immune system, inflammatory response, or other physiologic affect.
  • the subject is a mammal such as a human.
  • a therapeutically-effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors.
  • compositions can be formulated using one or more physiologically- acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations that can be used pharmaceutically. Formulation can be modified depending upon the route of administration chosen.
  • Pharmaceutical compositions comprising a peptide described herein can be manufactured, for example, by expressing the peptide in a recombinant system, purifying the peptide, lyophilizing the peptide, mixing, dissolving, granulating, dragee- making, levigating, emulsifying, encapsulating, entrapping, or compression processes.
  • the pharmaceutical compositions can include at least one
  • Methods for the preparation of peptides described herein comprising the compounds described herein include formulating the peptide described herein with one or more inert, pharmaceutically-acceptable excipients or carriers to form a solid, semi-solid, or liquid composition.
  • Solid compositions include, for example, powders, tablets, dispersible granules, capsules, cachets, and suppositories. These compositions can also contain minor amounts of nontoxic, auxiliary substances, such as wetting or emulsifying agents, pH buffering agents, and other pharmaceutically-acceptable additives.
  • Non- limiting examples of pharmaceutically-acceptable excipients can be found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams &
  • the present disclosure generally relates to peptides that home, target, migrate to, are retained by, accumulate in, and/or bind to, or are directed to specific regions, tissues, structures, or cells within the body and methods of using such peptides.
  • These peptides have the ability to contact the cartilage, which makes them useful for a variety of applications.
  • the peptides can have applications in site-specific modulation of biomolecules to which the peptides are directed to.
  • End uses of such peptides can include, for example, imaging, research, therapeutics, theranostics, pharmaceuticals, chemotherapy, chelation therapy, targeted drug delivery, and radiotherapy. Some uses can include targeted drug delivery and imaging.
  • the present disclosure provides a method for detecting a cancer, cancerous tissue, or tumor tissue, the method comprising the steps of contacting a tissue of interest with a peptide of the present disclosure, wherein the peptide is conjugated to a detectable agent and measuring the level of binding of the peptide, wherein an elevated level of binding, relative to normal tissue, is indicative that the tissue is a cancer, cancerous tissue or tumor tissue.
  • the disclosure provides a method of imaging an organ or body region or region, tissue or structure of a subject, the method comprising administrating to the subject the peptide or a pharmaceutical composition disclosed herein and imaging the subject.
  • imaging is used to detect a condition associated with a function of the cartilage.
  • the condition is an inflammation, a cancer, a degradation, a growth disturbance, genetic, a tear or an injury, or another suitable condition.
  • the condition is a chondrodystrophy, a traumatic rupture or detachment, pain following surgery in regions of the body containing cartilage, costochondritis, herniation, polychondritis, arthritis, osteoarthritis, rheumatoid arthritis, ankylosing spondylitis (AS), Systemic Lupus Erythematosus (SLE or "Lupus”), Psoriatic Arthritis (PsA), gout, achondroplasia, or another suitable condition.
  • the condition is associated with a cancer or tumor of the cartilage.
  • the condition is a type of chondroma or chondrosarcoma, whether metastatic or not, or another suitable condition.
  • the imaging may be associated with surgical removal of the diseased region, tissue, structure or cell of a subject.
  • the present disclosure provides methods for intraoperative imaging and resection of a diseased or inflamed tissue, cancer, cancerous tissue, or tumor tissue using a peptide of the present disclosure conjugated with a detectable agent.
  • the diseased or inflamed tissue, cancer, cancerous tissue, or tumor tissue is detectable by fluorescence imaging that allows for intraoperative visualization of the cancer, cancerous tissue, or tumor tissue using a peptide of the present disclosure.
  • the peptide of the present disclosure is conjugated to one or more detectable agents.
  • the detectable agent comprises a fluorescent moiety coupled to the peptide.
  • the detectable agent comprises a radionuclide.
  • imaging is achieved during open surgery. In further embodiments, imaging is accomplished using endoscopy or other non-invasive surgical techniques.
  • the term "effective amount,” as used herein, can refer to a sufficient amount of an agent or a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result can be reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
  • Compositions containing such agents or compounds can be administered for prophylactic, enhancing, and/or therapeutic treatments.
  • An appropriate "effective" amount in any individual case can be determined using techniques, such as a dose escalation study.
  • the methods, compositions, and kits of this disclosure can comprise a method to prevent, treat, arrest, reverse, or ameliorate the symptoms of a condition.
  • the treatment can comprise treating a subject (e.g., an individual, a domestic animal, a wild animal or a lab animal afflicted with a disease or condition) with a peptide of the disclosure.
  • the peptide can contact the cartilage of a subject.
  • the subject can be a human.
  • a subject can be a human; a non-human primate such as a chimpanzee, or other ape or monkey species; a farm animal such as a cattle, horse, sheep, goat, swine; a domestic animal such as a rabbit, dog, and cat; a laboratory animal including a rodent, such as a rat, mouse and guinea pig, or the like.
  • a subject can be of any age.
  • a subject can be, for example, an elderly adult, adult, adolescent, pre-adolescens, child, toddler, infant, or fetus in utero.
  • Treatment can be provided to the subject before clinical onset of disease.
  • Treatment can be provided to the subject after clinical onset of disease.
  • Treatment can be provided to the subject after 1 day, 1 week, 6 months, 12 months, or 2 years or more after clinical onset of the disease.
  • Treatment may be provided to the subject for more than 1 day, 1 week, 1 month, 6 months, 12 months, 2 years or more after clinical onset of disease.
  • Treatment may be provided to the subject for less than 1 day, 1 week, 1 month, 6 months, 12 months, or 2 years after clinical onset of the disease.
  • Treatment can also include treating a human in a clinical trial.
  • a treatment can comprise administering to a subject a pharmaceutical composition, such as one or more of the pharmaceutical compositions described throughout the disclosure.
  • a treatment can comprise a once daily dosing.
  • a treatment can comprise delivering a peptide of the disclosure to a subject, either intravenously, subcutaneously, intramuscularly, by inhalation, dermally, intra-articular injection, orally, intrathecally, transdermally, intranasally, via a peritoneal route, or directly onto or into a joint, e.g., via topical, intra-articular injection route or injection route of application.
  • a treatment can comprise administering a peptide- active agent complex to a subject, either intravenously, intra-articular injection, parenterally, orally, via a peritoneal route, or directly onto, near or into the cartilage.
  • Types of cartilage diseases or conditions that can be treated with a peptide of the disclosure can include inflammation, pain management, anti-infective, pain relief, anti- cytokine, cancer, injury, degradation, genetic basis, remodeling, hyperplasia, surgical injury/trauma, or the like.
  • cartilage diseases or conditions that can be treated with a peptide of the disclosure include Costochondritis, Spinal disc herniation, Relapsing polychondritis, Injury to the articular cartilage, any manner of rheumatic disease (e.g., Rheumatoid Arthritis (RA), ankylosing spondylitis (AS), Systemic Lupus Erythematosus (SLE or "Lupus”), Psoriatic Arthritis (PsA), Osteoarthritis, Gout, and the like), Herniation, Achondroplasia, Benign or non-cancerous chondroma, Malignant or cancerous
  • chondrosarcoma Chondriodystrophies, Chondromalacia patella, Costochondritis, Halus rigidus, Hip labral tear, Osteochondritis dssecans, Osteochondrodysplasias, Torn meniscus, Pectus carinatum, Pectus excavatum, Chondropathy, Chondromalacia, Polychondritis, Relapsing Polychondritis, Slipped epiphysis, Osteochondritis Dissecans, Chondrodysplasia, Costochondritis, Perichondritis, Osteochondroma, Knee osteoarthritis, Finger osteoarthritis, Wrist osteoarthritis, Hip osteoarthritis, Spine osteoarthritis, Chondromalacia, Osteoarthritis Susceptibility, Ankle Osteoarthritis, Spondylosis, Secondary chondrosarcoma, Small and unstable nodules as seen in osteoarthritis,
  • chondrodysplasia Dysspondyloenchondromatosis, Achondroplasia regional - dysplasia abdominal muscle, Osteochondritis Dissecans, Familial Articular Chondrocalcinosis, Tracheobronchomalacia, Chondritis, Dyschondrosteosis, Jequier-Kozlowski- skeletal dysplasia, Chondrodystrophy, Cranio osteoarthropathy, Tietze's syndrome, Hip dysplasia - ecchondromata, Bessel-Hagen disease, Chondromatosis (benign), Enchondromatosis
  • Achondrogenesis type 3 Achondrogenesis type 4, Chondrocalcinosis 1, Chondrocalcinosis 2, Chondrocalcinosis familial articular, Diastrophic dysplasia, Fibrochondrogenesis,
  • a peptide or peptide conjugate of this disclosure can be administered to a subject in order to target,an arthritic joint. In other embodiments, a peptide or peptide conjugate of this disclosure can be administered to a subject in order to treat an arthritic joint.
  • the present disclosure provides a method for treating a cancer, the method comprising administering to a subject in need thereof an effective amount of a peptide of the present disclosure.
  • the present disclosure provides a method for treating a cancer, the method comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition comprising a peptide of the present disclosure and a
  • the peptides of the present disclosure can be used to treat chondrosarcoma.
  • Chondrosarcoma is a cancer of cartilage producing cells and is often found in bones and joints. It falls within the family of bone and soft-tissue sarcomas.
  • administration of a peptide or peptide conjugate of the present disclosure can be used to image and diagnose or target and treat a subject with chondrosarcoma.
  • the adminstration of a peptide or peptide conjugate of the present disclosure can be used in combination with ablative radiotherapy or proton therapy to treat chondrosarcoma.
  • the subject can be a human or an animal.
  • a peptide or peptide conjugate of this disclosure can be used to treat Chordoma.
  • administration of a peptide or peptide conjugate of the present disclosure can be used to image and diagnose or target and treat a subject with chordoma.
  • the adminstration of a peptide or peptide conjugate of the present disclosure can be used in combination with a tyrosine kinase inhibitor, such as imatinib mesylate, and ablative radiotherapy or proton therapy to treat chordoma.
  • the adminstration of a peptide or peptide conjugate of the present disclosure can be used in combination with an antivascular agent such as bevacizumab and an epidermal growth factor receptor inhibitor such as erlotinib to treat chordoma.
  • an antivascular agent such as bevacizumab
  • an epidermal growth factor receptor inhibitor such as erlotinib
  • the subject can be a human or an animal.
  • the present disclosure provides a method for inhibiting invasive activity of cells, the method comprising administering an effective amount of a peptide of the present disclosure to a subject.
  • the peptides of the present disclosure are conjugated to one or more therapeutic agents.
  • the therapeutic agent is a chemotherapeutic, anti-cancer drug, or anti-cancer agent selected from, but are not limited to: anti- inflammatories, such as for example a glucocorticoid, a corticosteroid, a protease inhibitor, such as for example coUagenase inhibitor or a matrix metalloprotease inhibitor (i.e., MMP-13 inhibitor), an amino sugar, vitamin (e.g., Vitamin D), and antibiotics, antiviral, or antifungal, a statin, an immune modulator, radioisotopes, toxins, enzymes, sensitizing drugs, nucleic acids, including interfering RNAs, antibodies, anti-angiogenic agents, cisplatin, antimetabolites, mitotic inhibitors, growth factor inhibitors, paclitaxel, temozolomide, topotecan, fluorouracil
  • anti- inflammatories such as for
  • Apoptosis can be induced by many active agents, including, for example, chemotherapeutics, ant i- inflammatories, corticosteroids, NSAIDS, tumor necrosis factor alpha (TNF-a) modulators, tumor necrosis factor receptor (TNFR) family modulators.
  • active agents including, for example, chemotherapeutics, ant i- inflammatories, corticosteroids, NSAIDS, tumor necrosis factor alpha (TNF-a) modulators, tumor necrosis factor receptor (TNFR) family modulators.
  • peptides of this disclosure can be used to target active agents to pathways of cell death or cell killing, such as caspases, apoptsis activators and inhibitors, XBP-1, Bcl-2, Bcl-Xl, Bcl-w, and other disclosed herein.
  • the therapeutic agent is any nonsteroidal anti- inflammatory drug (NSAID).
  • the NSAID can be any heterocyclic acetic acid derivatives such as ketorolac, indomethacin, etodolac, or tolemetin, any propionic acid derivatives such as naproxen, any enolic acid derivatives, any anthranilic acid derivatives, any selective COX-2 inhibitors such as celecoxib, any sulfonanilides, any salicylates, aceclofenac, nabumetone, sulindac, diclofenac, or ibuprofen.
  • the therapeutic agent is any steroid, such as
  • a treatment consists of administering a combination of any of the above therapeutic agents and a peptide conjugate, such as a treatment in which both a dexamethasone-peptide conjugate and an NSAID are administered to a patient.
  • Peptides of the current disclosure that target the cartilage can be used to treat the diseases conditions as described herein, for example, any diseases or conditions including tears, injuries (i.e., sports injuries), genetic factors, degradation, thinning, inflammation, cancer or any other disease or condition of the cartilage or to target therapeutically- active substances to treat these diseases amongst others.
  • a peptide of the disclosure can be used to treat traumatic rupture, detachment, chostochondritis, spinal disc herniation, relapsing and non-relapsing polychondritis, injury to the articular cartilage, osteoarthritis, arthritis or achondroplasia.
  • the peptide or peptide- active agent can be used to target cancer in the cartilage, for example benign chondroma or malignant chondrosarcoma, by contacting the cartilage by diffusion into chondrocytes and then having antitumor function, targeted toxicity, inhibiting metastases, etc.
  • such peptide or peptide- active agent can be used to label, detect, or image such cartilage lesions, including tumors and metastases amongst other lesions, which may be removed through various surgical techniques or by targeting with peptide- active agents that induce programmed cell death or kill cells.
  • Venom or toxin derived peptide(s), peptides, modified peptides, labeled peptides, peptide- active agent conjugates and pharmaceutical compositions described herein can be administered for prophylactic and/or therapeutic treatments.
  • the composition can be administered to a subject already suffering from a disease or condition, in an amount sufficient to cure or at least partially arrest the symptoms of the disease or condition, or to cure, heal, improve, or ameliorate the condition.
  • Such peptides described herein can also be administered to prevent (either in whole or in part), lessen a likelihood of developing, contracting, or worsening a condition. Amounts effective for this use can vary based on the severity and course of the disease or condition, previous therapy, the subject's health status, weight, response to the drugs, and the judgment of the treating physician.
  • Venom or toxin derived peptide(s), peptides, modified peptides, labeled peptides, peptide- active agent conjugates and pharmaceutical compositions described herein can allow for targeted homing of the peptide and local delivery of any conjugate.
  • a peptide conjugated to a steroid allows for local delivery of the steroid, which is significantly more effective and less toxic than traditional systemic steroids.
  • a peptide conjugated to an NSAID is another example.
  • the peptide conjugated to an NSAID allows for local delivery of the NSAID, which allows for administration of a lower NSAID dose and is subsequently less toxic.
  • Peptides of the current disclosure that target the cartilage can be used to treat or manage pain associated with a cartilage injury or disorder, or any other cartilage or joint condition as described herein.
  • the peptides can be used either directly or as carriers of active drugs, peptides, or molecules.
  • active drugs peptides, or molecules.
  • peptides that interact with ion channels can be used directly to reduce pain.
  • the peptide is conjugated to an active agent with ant i- inflammatory activity, in which the peptide acts as a carrier for the local delivery of the active agent to reduce pain.
  • the peptides described herein provide a method of treating a cartilage condition of a subject, the method comprising administering to the subject a therapeutically-effective amount of a peptide comprising the sequence SEQ ID NO: 1 or fragment thereof.
  • the peptides described herein provide a method of treating a cartilage condition of a subject, the method comprising administering to the subject a peptide of any one of SEQ ID NO: 2 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 or fragment thereof.
  • multiple functional fragments of peptides derived from toxins or venom can be administered in any order or simultaneously. If simultaneously, the multiple peptides described herein can be provided in a single, unified form, such as an intravenous injection, or in multiple forms, such as subsequent intravenous dosages.
  • kits can be packaged as a kit.
  • a kit includes written instructions on the use or administration of the peptides.
  • This example provides a method for generating knottin peptides.
  • Peptides derived from knottin peptides of scorpions and spiders were generated in mammalian cell culture using a published methodology. (A.D. Bannesayke, C. Correnti, B.Y. Ryu, M. Brault, R.K. Strong, D. Rawlings. 2011. Daedalus: a robust, turnkey platform for rapid production of decigram quantities of active recombinant proteins in human cell lines using novel lentiviral vectors. Nucleic Acids Research. (39)21, el43).
  • the peptide sequence was reverse-translated into DNA, synthesized, and cloned in- frame with siderocalin using standard molecular biology techniques. (M.R. Green, Joseph Sambrook. Molecular Cloning. 2012 Cold Spring Harbor Press.). The resulting construct was packaged into a lentivirus, transfected into HEK293 cells, expanded, isolated by immobilized metal affinity chromatography (IMAC), cleaved with tobacco etch virus protease, and purified to homogeneity by reverse-phase chromatography. Following purification, each peptide was lyophilized and stored frozen.
  • IMAC immobilized metal affinity chromatography
  • the labeled peptides were isolated via solid-phase extraction on Strata-X columns (Phenomenex 8B-S 100-AAK), rinsed with water with 5% methanol, and recovered in methanol with 2% formic acid. Solvent was subsequently removed in a blowdown evaporator with gentle heat and a stream of nitrogen gas.
  • This example describes a dosing scheme for administering knottin peptides to mice in conjunction with kidney ligation.
  • the sequence of thirteen cartilage homing peptides of SEQ ID NO: 21 - SEQ ID NO: 33 are shown in TABLE 1. The experiment was done in duplicates. The kidneys were ligated to prevent renal filtration of the peptides. Each peptide was radiolabeled by methylating lysines and the N-terminus, so the actual binding agent may contain methyl or dimethyl lysine(s) and a methylated or dimethylated amino terminus.
  • a target dosage of 50-100 nmol of each peptide carrying 10-25 uCi of 14 C was administered to Female Harlan athymic nude mice while anesthetized. Each peptide was allowed to freely circulate within the animal before the animals were euthanized and sectioned.
  • mice were frozen in a hexane/dry ice bath and then frozen in a block of carboxymethylcellulose. Whole animal sagittal slices were prepared that resulted in thin frozen sections being available for imaging.
  • Thin, frozen sections of animal including imaging of tissues such as brain, tumor, liver, kidney, lung, heart, spleen, pancreas, muscle, adipose, gall bladder, upper gastrointestinal tract, lower gastrointestinal tract, bone, bone marrow, reproductive track, eye, cartilage, stomach, skin, spinal cord, bladder, salivary gland, and other types of tissues were obtained with a microtome, allowed to desiccate in a freezer, and exposed to phosphoimager plates for about ten days.
  • FIG. 1 illustrates the tissue distribution in the cartilage for the peptides SEQ ID NO: 21 - SEQ ID NO: 33, 3 hours after administration in animals with ligated kidneys.
  • FIG. 2 identifies the locations of the SEQ ID NO: 24 peptide distribution in joint and other cartilage.
  • FIG. 3 identifies the locations of the SEQ ID NO: 24 peptide distribution in rib, spinal, and other cartilage.
  • FIG. 4 identifies the locations of the SEQ ID NO: 24 peptide distribution in nasal, spinal, tracheal, and other cartilage.
  • FIGURES 3-4 illustrate the homing of SEQ ID NO: 24 to hyaline cartilage such as articular cartilage and physeal cartilage, as well as fibrocartilage.
  • the peptide can be retained in cartilage for hours after treatment.
  • the SEQ ID NO: 24 peptide was radiolabeled as in Example 3 and 100 nmol of peptide was injected into a mouse with intact kidneys.
  • FIG. 5 illustrates the retention of and the tissue distribution in the cartilage of a peptide of SEQ ID NO: 24, 24 hours after administration.
  • FIG. 11 shows white light and corresponding autoradiographic images from a section of a mouse 24 hours after administration of 100 nmol of radiolabeled SEQ ID NO: 433 peptide, which did not home to cartilage and was seen in the bone marrow.
  • FIG. 11A illustrates a white light image of a frozen section of a mouse 24 hours after administration of 100 nmol of SEQ ID NO: 433.
  • FIG. 11B shows an autoradiographic image
  • TABLE 2 summarizes the net charge at neutral pH and migration of the peptides of SEQ ID NO: 21 - SEQ ID NO: 33 to the cartilage (C) and muscle (M) compared to the level in the blood 3 hours after administration.
  • the "cartilage" entries reflect the percentage of signal in the cartilage compared to the blood signal in the heart ventricle within the tissue slices.
  • Peptides that are cartilage homers have a cartilage signal of >170%
  • peptides that are efficient cartilage homers can have a cartilage signal of >300%
  • peptides that are strong cartilage homers have a cartilage signal of >500%.
  • SEQ ID NO: 484 corresponds to an amino acid sequence of
  • sequences with significant positive charge at physiological pH exhibited higher accumulation in cartilage.
  • Many of these sequences share common elements. These common elements may represent parts of the sequence that confer cartilage homing to the peptide by locating positive charge or other binding elements into certain parts of the three dimensional structure of the folded peptide. For instance, K or R residues might be preferentially located in certain parts of the sequence in order to locate positive charge on the correct surface areas for homing, especially with respect to the C residues which determine folding and loop location of the folded peptide. However, only parts of these sequences may be important for homing or other aspects of the sequences may be important for homing. [0262] Two example sequences containing common elements are
  • FIG. 12 shows a sequence alignment of SEQ ID NO: 9 with the peptide sequences from which the common element sequences were based on and a sequence alignment of SEQ ID NO: 10 with the peptide sequences from which the common element sequences were based on.
  • Sequence GSXVXXXVKCXGSKQCXXPCKRXXGXRXGKCINKKXCKCYXXX (SEQ ID NO: 9) is a sequence based on the most common elements found in the following sequences:
  • Sequence GSXXXGCVXXXXKCRPGXKXCCXPXKRCSRRFGXXXKKCKXXXXXX (SEQ ID NO: 10) is a sequence based on the most common elements found in the following sequences:
  • SEQ ID NO: 33 A dash, indicates that no amino acid is in that position.
  • the following residues may be independently interchanged in SEQ ID NO: 9 or SEQ ID NO: 10: any K and any R; any M, any I, any L, and any V; any G and any A; any S and any T; and any Q and any N.
  • These sets of interchangeable amino acids have similarities in properties that can allow for them to be interchangeable without inhibiting homing to cartilage.
  • any K can be interchanged with any R because K and R both provide a positive charge at physiological pH and thus may provide necessary charge for homing to cartilage
  • any S can be
  • N-terminal GS sequence may or may not be included between the peptides of the present disclosure.
  • GKCINKKCKC (SEQ ID NO: 316) fragment with the internal fragments KCIN (SEQ ID NO: 317) and KKCK (SEQ ID NO: 318), PCKR (SEQ ID NO: 319), KRCSRR (SEQ ID NO: 320), and GSKQC (SEQ ID NO: 321).
  • the following residues may be independently interchanged in SEQ ID NO: 101 - SEQ ID NO: 105 or SEQ ID NO: 316 - SEQ ID NO: 321: any K and any R; any M, any I, any L, and any V; and G and any A; any S and any T; and any Q and any N.
  • the peptides of SEQ ID NO: 21 and SEQ ID NO: 33 in TABLE 1 are derived from a scorpion toxin (e.g., Buthus martensii Karsh) that was found to migrate specifically to a region, tissue, structure or cells in the cartilage, potentially by diffusion.
  • FIGS. 6A and 6B illustrate the HPLC profiles of a peptide of SEQ ID NO: 23 and SEQ ID NO: 24.
  • This example describes certain exemplary therapeutic agents that are conjugated to a knottin peptide.
  • a peptide of the disclosure is expressed recombinantly or chemically synthesized and then is conjugated to an exemplary drug, such as paclitaxel or triamcinolone acetonide using techniques known in the art, such as those described in Bioconjugate
  • One or more drugs is conjugated per peptide, or an average of less than one drug is conjugated per peptide.
  • Coupling of these drugs to a peptide of any of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 targets the drug to the cartilage of the subject.
  • One or more drug-peptide conjugates are administered to a human or animal.
  • This example describes a method for treating osteoarthritis using peptides of the present disclosure. This method is used as a treatment for acute and/or chronic symptoms associated with osteoarthritis.
  • a peptide of the present disclosure is expressed recombinantly or chemically synthesized and then is used directly or conjugated to an anti- inflammatory compound, such as triamcinolone acetonide and dexamethasone.
  • the resulting peptide or peptide-drug conjugate is administered in a pharmaceutical composition subcutaneously, intravenously, or orally, or is injected directly into a joint of a patient and targeted to cartilage.
  • the formulation can be modified physically or chemically to increase the time of exposure in the cartilage.
  • the peptide is selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • One or more anti- inflammatory peptide conjugates are administered to a human or animal.
  • This example describes a method for treating and/or preventing cartilage degradation using a peptide of the present disclosure.
  • This method is used as a treatment for acute and/or chronic symptoms associated with cartilage degradation. Progressive degradation or thinning of the cartilage is difficult to treat in part because molecules such as small molecule drugs and antibodies typically do not reach the avascular cartilage.
  • a peptide of the present disclosure is used for its homing and/or native activity, or is mutated to generate activity such as MMP protease inhibition.
  • MMP13 collagenase (MMP-1), or other agent as described herein.
  • MMP-1 extracellular matrix targeting compound
  • the resulting peptide or peptide-drug conjugate is administered in a pharmaceutical composition subcutaneously, intravenously, or orally, or is injected directly into a joint of a patient and targeted to extracellular matrix.
  • the peptide is selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • One or more extracellular matrix targeting conjugates are administered to a human or animal.
  • This example describes a method for treating a cartilage injury using a peptide of the present disclosure.
  • a peptide of the present disclosure is expressed recombinantly or chemically synthesized and then is used directly or conjugated to a therapeutic compound, such as those described herein, including, but not limited to triamcinolone and dexamethasone.
  • the resulting peptide or peptide-drug conjugate is administered in a pharmaceutical composition to a patient and targeted to cartilage.
  • the peptide is selected from S SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • One or more therapeutic compound-peptide conjugates are administered to a human or animal.
  • This example describes a method for treating rheumatoid arthritis. This method is used as a treatment for acute and/or chronic symptoms associated with rheumatoid arthritis.
  • a peptide of the present disclosure is expressed recombinantly or chemically synthesized and then is used directly, or is conjugated to an ant i- inflammatory compound, such as
  • the peptide can, for example, bind or inhibit ion channels such as Kv 1.3.
  • the resulting peptide or peptide-drug conjugate is administered in a pharmaceutical composition to a patient and is targeted to cartilage.
  • the peptide is selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • One or more anti- inflammatory compound- peptide conjugates are administered to a human or animal subcutaneously, intravenously, or orally, or is injected directly into a joint
  • This example describes a method for treating gout using peptides of the present disclosure. This method is used as a treatment for acute and/or chronic symptoms associated with gout. A peptide of the present disclosure is expressed and administered in a
  • a peptide of the disclosure is recombinantly or chemically synthesized and then is used directly or conjugated to a nonsteroidal anti- inflammatory drugs, colchicine, a steroid, or uricase.
  • the peptide selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 is administered in a pharmaceutical composition to a patient and the peptide is targeted to the cartilage affected by gout.
  • One or more peptides are administered to a human or animal subcutaneously, intravenously, or orally, or is injected directly into a joint.
  • This example describes a method for treating or managing pain associated with a cartilage injury or disorder. This method is used as a treatment for acute and/or chronic symptoms associated with a cartilage injury or disorder.
  • a peptide of the disclosure is expressed and administered in a pharmaceutical composition to a patient as a therapeutic for pain as a result of injury or other cartilage or joint condition as described herein.
  • the peptide of the present disclosure inhibits ion channels, such as Nav 1.7.
  • the peptide is expressed recombinantly or chemically synthesized, wherein the peptide selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432.
  • the peptides of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216 or SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, SEQ ID NO: 414 - SEQ ID NO: 432 are mutated to maintain the cartilage homing function, but to add or increase ion channel inhibition, such as to Nav 1.7.
  • the peptide is used directly or conjugated to an NSAID.
  • the peptide targets to the cartilage affected by pain.
  • One or more peptides are administered to a human or animal subcutaneously, intravenously, or orally, or is injected directly into a joint.
  • This example describes the evaluation of immunogenicity for certain peptides of the present disclosure. Immunogenicity was predicted using the network-based alignment algorithm ("NN-align. An artificial neural network-based alignment algorithm for MHC class II peptide biding prediction", Nielsen et. al. BMC Bio informatics 2009 Vol 10, p296). The algorithm was applied to intact knottin proteins with sequences SEQ ID NO: 21 - SEQ ID NO: 33 against 24 alleles of HLA-DR, HLA-DP, HLA-DQ and H2-IAb MHCII classes.
  • FIG. 7 shows the MHC class II peptide binding prediction of peptides with the sequences SEQ ID NO: 21 - SEQ ID NO: 33 as listed in TABLE 1.
  • the y-axis shows the predicted affinity of MHC class II peptide binding prediction for a peptide with units of log(nM), where affinity ⁇ 50 nM predicts strong binding.
  • affinity ⁇ 50 nM predicts strong binding.
  • peptides with SEQ ID NO: 21 - SEQ ID NO: 33 82.3% (284/345) of the simulated bindings showed binding weaker than 50 nM between the peptide and MHC class II peptide.
  • the high content of weak binders indicates that the peptides are predicted to have lower immunogenicity when administered to humans.
  • knottin peptides were predicted to be strong binders of MHC class II, however excluding certain sequences known to have high immunogenicity such as C-terminal proline in a peptide of SEQ ID NO: 111 or glycine in a peptide of SEQ ID NO: 199 reduced binding to MHC II alleles.
  • peptides of SEQ ID NO: 209 - SEQ ID NO: 210 have 90% homology to a peptide of SEQ ID NO: 111 and SEQ ID NO: 110, respectively, and are less
  • a peptide of SEQ ID NO: 211 has 83% homology to a peptide of SEQ ID NO: 114 and is less
  • This example describes the conjugation of ketorolac to a knottin peptide using a lactic acid linker. As shown below in reaction scheme (I), a conjugate is produced from a mixture of ( ?,5)-ketorolac, lactic acid, and a knottin peptide:
  • the ketorolac-lactic acid linker conjugate depicted above is then reacted with a lysine or the N-terminus of a knottin peptide to create a ketorolac-lactic acid- peptide conjugate.
  • the knottin peptide is selected from the peptides of SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432.
  • Ketorolac is currently dosed as an enantiomeric mixture, in which enantiomers with a single racemic stereocenter are very difficult to separate.
  • a diastereomer with two chiral centers is created by the addition of a chiral linker such as L- lactic acid. Since diastereomers are easily separated, the active enantiomer of ketorolac conjugated to the lactic acid linker can be purified prior to conjugation to a knottin peptide.
  • the chemical synthesis can use any conjugation techniques known in the art, such as described in Bioconjugate Techniques by Greg Hermanson and in "Ketorolac-dextran conjugates: synthesis, in vitro, and in vivo evaluation:" Acta Pharm. 57 (2007) 441-450, Vyas, Trivedi, and Chaturvedi.
  • the conjugate can display ant i- inflammatory activity, or free ketorolac is released from the conjugate to provide anti- inflammatory activity.
  • the free ketorolac can result from hydrolysis that occurs after administration, such as hydrolysis at the ester bond.
  • This example describes the conjugation of ibuprofen to a knottin peptide using a PEG linker.
  • a conjugate is produced using ibuprofen and a PEG linker, which forms an ester bond that can hydro lyze as described in "In vitro and in vivo study of poly(ethylene glycol) conjugated ibuprofen to extend the duration of action," Scientia Pharmaceutica, 2011, 79:359-373, Nayak and Jain.
  • Fischer esterification is used to conjugate ibuprofen with a short PEG, e.g., with triethylene glycol, to yield ibuprofen-ester-PEG-OH.
  • the hydroxyl moiety of PEG is activated with ⁇ , ⁇ '-disuccinimidyl carbonate (DSC) to form ibuprofen- ester- PEG- succinimidyl carbonate, which is then reacted with a lysine or the N-terminus of a knottin peptide to form an ibuprofen-ester-PEG-peptide conjugate.
  • DSC ⁇ , ⁇ '-disuccinimidyl carbonate
  • the knottin peptide is selected from any one of the peptides of sequence SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432.
  • the conjugate can display antiinflammatory activity, or free ibuprofen is released from the conjugate to provide antiinflammatory activity.
  • the free ibuprofen can result from hydrolysis that occurs after administration, such as hydrolysis at the ester bond.
  • Ibuprofen-peptide conjugates are administered to a subject in need thereof.
  • the subject can be a human or a non-human animal.
  • This example describes different methods of conjugating dexamethasone with a peptide of this disclosure.
  • a peptide of SEQ ID NO: 111 was recombinantly expressed.
  • Dexamethasone was readily conjugated to a peptide of this disclosure using a dicarboxylic acid linker.
  • the peptide-dexamethasone conjugate was made by first converting
  • dexamethasone to a hemisuccinate by reacting it with succinic anhydride.
  • the hemisuccinate was then converted to a succinate carboxylic acid containing an active ester, using
  • DCC dicyclohexyl carbodiimide
  • EDC l-ethyl-3-(3-dimethylamninopropyl)carbodiimide
  • NHS N-hydroxy succinimide
  • Peptide-dexamethasone conjugates were prepared by coupling dexamethasone to the peptides of this disclosure using standard coupling-reagent chemistry.
  • dexamethasone conjugates were made by reacting dexamethasone hemigluterate with 1.05 molar equivalents of ⁇ , ⁇ -carbonyldiimidazole in anhydrous DMSO in an inert atmosphere. After 30 minutes, excess dexamethasone in anhydrous DMSO was added along with two molar equivalents of anhydrous trimethylamine.
  • the N-hydroxysuccinimide ester of the peptide-dexamethasone conjugate was generated to form a shelf- stable intermediate for later reaction with an amine-containing carrier.
  • the N-terminal dexamethasone-peptide conjugate (SEQ ID NO: 11 IB) was verified by electrospray mass spectrometry (ES-MS) within a 10 ppm error.
  • a knottin peptide of any of the sequences of this disclosure including SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432, are conjugated to dexamethasone using the methods described above.
  • This example describes preparation of knottin peptide conjugates having tunable hydrolysis rates.
  • the dexamethasone conjugate described in EXAMPLE 15 is synthesized with the modification that instead of using succinic anhydride, other molecules are used to provide steric hindrance to hydrolysis at the carbon adjacent to the final hydrolyzable ester.
  • the dexamethasone conjugate is synthesized with tetramethyl succinic anhydride to generate hindered esters, which causes a decreased rate of hydrolysis.
  • one methyl group is present at the adjacent carbon.
  • two methyl groups are present at the adjacent carbon.
  • one ethyl group is present at the adjacent carbon.
  • two ethyl groups are present at the adjacent carbon. The rate of hydrolysis in these exemplary conjugates is therefore adjusted as compared to the conjugates in EXAMPLE 15, preventing premature cleavage and ensuring that the majority of peptide- dexamethasone conjugates accumulate in cartilage.
  • Ion channels can be associated with pain and can be activated in disease states such as arthritis.
  • a peptide of the disclosure is expressed and administered in a pharmaceutical composition to a patient to treat a joint condition or disease associated with an ion channel and treatable by binding, blocking, or interacting with the ion channel.
  • Ion channels, such as Nav 1.7, are inhibited by peptides of the present disclosure.
  • a given peptide is expressed recombinantly or chemically synthesized, wherein the peptide selected from SEQ ID NO: 21 - SEQ ID NO: 194, SEQ ID NO: 196, SEQ ID NO: 198 - SEQ ID NO: 216, SEQ ID NO: 237 - SEQ ID NO: 410, SEQ ID NO: 412, or SEQ ID NO: 414 - SEQ ID NO: 432.
  • the peptide is used directly or conjugated to a therapeutic compound, such as those described herein.
  • a peptide of the present disclosure selectively interacts with ion channels, or is mutated in order to interact with ion channels.
  • a peptide of this disclosure is bound to Nav 1.7 or Nav 1.7 is blocked by a peptide of this disclosure.
  • Nav 1.7 signaling is reduced in the tissues in proximity to the joints, and pain relief is thereby provided.
  • This example describes a dosing scheme for administering knottin peptides to mice without kidney ligation.
  • the peptide administered had the sequence of SEQ ID NO: 24 as shown in TABLE 1.
  • the peptide was radiolabeled by methylating lysines and the N- terminus, so the actual binding agent may contain methyl or dimethyl lysine(s) and a methylated or dimethylated amino terminus.
  • a target dosage of 100 nmol of each peptide carrying 10-25 ⁇ of 14 C was administered to Female Harlan athymic nude mice by a tail vein injection. Each peptide was allowed to freely circulate within the animal for either 4 hours or 24 hours before the animals were euthanized and sectioned.
  • mice were frozen in a hexane/dry ice bath and then frozen in a block of carboxymethylcellulose. Whole animal sagittal slices were prepared that resulted in thin frozen sections being available for imaging.
  • Thin, frozen sections of animal including imaging of tissues such as brain, tumor, liver, kidney, lung, heart, spleen, pancreas, muscle, adipose, gall bladder, upper gastrointestinal track, lower gastrointestinal track, bone, bone marrow, reproductive track, eye, cartilage, stomach, skin, spinal cord, bladder, salivary gland, and other types of tissues were obtained with a microtome, allowed to desiccate in a freezer, and exposed to phosphoimager plates for about ten days.
  • FIG. 13A A signal in tissue darker than the signal expected from blood in that tissue indicates peptide accumulation in a region, tissue, structure or cell.
  • the cartilage is avascular and contains minute amounts of blood.
  • FIG. 13A A signal in tissue darker than the signal expected from blood in that tissue indicates peptide accumulation in a region, tissue, structure or cell.
  • the cartilage is avascular and contains minute amounts of blood.
  • FIG. 13B illustrates an autoradiographic image corresponding to FIG. 13A in which the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 14A illustrates a white light image of a frozen section of a mouse 24 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 14B illustrates an autoradiographic image corresponding to FIG. 14A in which the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the cartilage of a mouse 24 hours after administration of 100 nmol.
  • FIG. 15A illustrates a white light image of a frozen section of a hind limb of a mouse 4 hours after administration 100 nmol of radiolabeled SEQ ID NO: 24 peptide.
  • FIG. 15B illustrates an autoradiographic image corresponding to FIG. 15A in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after administration of 100 nmol.
  • FIG. 15C illustrates an autoradiographic image in which the the 14 C signal identifies the radiolabeled SEQ ID NO: 24 peptide distribution in the ankle and digit cartilage of a mouse 4 hours after

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Insects & Arthropods (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Rheumatology (AREA)
  • Cell Biology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/US2016/051166 2015-09-09 2016-09-09 Cartilage-homing peptides Ceased WO2017044894A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CN201680053482.4A CN108135970B (zh) 2015-09-09 2016-09-09 软骨归巢肽
CA2994865A CA2994865A1 (en) 2015-09-09 2016-09-09 Cartilage-homing peptides
EP16845226.6A EP3347035A4 (en) 2015-09-09 2016-09-09 CARTON PEPTIDES
AU2016321342A AU2016321342A1 (en) 2015-09-09 2016-09-09 Cartilage-homing peptides
JP2018510741A JP6966424B2 (ja) 2015-09-09 2016-09-09 軟骨ホーミングペプチド
US15/758,320 US11090358B2 (en) 2015-09-09 2016-09-09 Cartilage-homing peptides
BR112018004536A BR112018004536A2 (pt) 2015-09-09 2016-09-09 peptídeos de endereçamento à cartilagem
IL257396A IL257396B (en) 2015-09-09 2018-02-07 Cartilage-targeting peptides
US17/353,447 US11648290B2 (en) 2015-09-09 2021-06-21 Cartilage-homing peptides
JP2021172263A JP7378449B2 (ja) 2015-09-09 2021-10-21 軟骨ホーミングペプチド
US18/177,642 US20230364183A1 (en) 2015-09-09 2023-03-02 Cartilage-homing peptides

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201562216331P 2015-09-09 2015-09-09
US62/216,331 2015-09-09
US201662278929P 2016-01-14 2016-01-14
US62/278,929 2016-01-14
US201662385734P 2016-09-09 2016-09-09
US62/385,734 2016-09-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/758,320 A-371-Of-International US11090358B2 (en) 2015-09-09 2016-09-09 Cartilage-homing peptides
US17/353,447 Continuation US11648290B2 (en) 2015-09-09 2021-06-21 Cartilage-homing peptides

Publications (2)

Publication Number Publication Date
WO2017044894A2 true WO2017044894A2 (en) 2017-03-16
WO2017044894A3 WO2017044894A3 (en) 2017-05-11

Family

ID=58240183

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/051166 Ceased WO2017044894A2 (en) 2015-09-09 2016-09-09 Cartilage-homing peptides

Country Status (9)

Country Link
US (3) US11090358B2 (cg-RX-API-DMAC7.html)
EP (1) EP3347035A4 (cg-RX-API-DMAC7.html)
JP (2) JP6966424B2 (cg-RX-API-DMAC7.html)
CN (1) CN108135970B (cg-RX-API-DMAC7.html)
AU (1) AU2016321342A1 (cg-RX-API-DMAC7.html)
BR (1) BR112018004536A2 (cg-RX-API-DMAC7.html)
CA (1) CA2994865A1 (cg-RX-API-DMAC7.html)
IL (1) IL257396B (cg-RX-API-DMAC7.html)
WO (1) WO2017044894A2 (cg-RX-API-DMAC7.html)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018049285A1 (en) 2016-09-09 2018-03-15 Fred Hutchinson Cancer Research Center Stable peptides and methods of use thereof
WO2018170480A1 (en) * 2017-03-16 2018-09-20 Blaze Bioscience, Inc. Cartilage-homing peptide conjugates and methods of use thereof
IT201700071296A1 (it) * 2017-06-26 2018-12-26 Alda S R L Nuovi reagenti per microscopia ottica
WO2019178573A1 (en) * 2018-03-16 2019-09-19 Blaze Bioscience, Inc. Truncated cartilage-homing peptides and peptide complexes and methods of use thereof
WO2019209662A1 (en) * 2018-04-23 2019-10-31 Fred Hutchinson Cancer Research Center Conjugates of cartilage-homing peptides
EP3638290A4 (en) * 2017-06-15 2021-04-07 Blaze Bioscience, Inc. KIDNEY HOMING PEPTIDE CONJUGATES AND METHOD OF USING THEREOF
US11090358B2 (en) 2015-09-09 2021-08-17 Fred Hutchinson Cancer Research Center Cartilage-homing peptides
EP3727146A4 (en) * 2017-12-19 2021-10-06 Blaze Bioscience, Inc. TUMOR HOMING AND CELL-PENETANT PEPTIDE IMMUNO-ONCOLOGY AGENT COMPLEX AND METHOD OF USE
US11428689B2 (en) 2016-05-05 2022-08-30 Massachusetts Institute Of Technology Methods and uses for remotely triggered protease activity measurements
US11448643B2 (en) 2016-04-08 2022-09-20 Massachusetts Institute Of Technology Methods to specifically profile protease activity at lymph nodes
US11519905B2 (en) 2017-04-07 2022-12-06 Massachusetts Institute Of Technology Methods to spatially profile protease activity in tissue and sections
US11549947B2 (en) 2011-03-15 2023-01-10 Massachusetts Institute Of Technology Multiplexed detection with isotope-coded reporters
US11549951B2 (en) 2009-03-02 2023-01-10 Massachusetts Institute Of Technology Methods and products for in vivo enzyme profiling
US11548923B2 (en) 2017-01-18 2023-01-10 Fred Hutchinson Cancer Center Peptide compositions and methods of use thereof for disrupting TEAD interactions
US11559580B1 (en) 2013-09-17 2023-01-24 Blaze Bioscience, Inc. Tissue-homing peptide conjugates and methods of use thereof
US11835522B2 (en) 2019-01-17 2023-12-05 Massachusetts Institute Of Technology Sensors for detecting and imaging of cancer metastasis
US11977074B2 (en) 2013-06-07 2024-05-07 Massachusetts Institute Of Technology Affinity-based detection of ligand-encoded synthetic biomarkers
US12173349B2 (en) 2018-09-25 2024-12-24 Massachusetts Institute Of Technology Lung protease nanosensors and uses thereof

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110357950B (zh) * 2019-07-29 2023-04-25 武汉大学 酸性氨基酸扫描法设计的免疫抑制多肽及应用
CN111454334B (zh) * 2020-03-30 2021-12-14 东北农业大学 一种抗酶解的抗菌肽ii4ii及制备方法和应用
CN111840512B (zh) * 2020-07-15 2023-06-09 广州领晟医疗科技有限公司 治疗软骨修复和/或骨关节炎的组合物
CN113332442A (zh) * 2021-06-10 2021-09-03 愈美明德(成都)生物医药科技有限公司 一种靶向递送分子、粒子及其制备方法、应用
CN118091163B (zh) * 2024-04-26 2024-07-02 山东省食品药品检验研究院 一种鉴别尖刺信使蝎的特征多肽及其应用
CN120865334A (zh) * 2025-03-26 2025-10-31 中山大学附属第五医院 一种靶向软骨的阳离子肽类化合物及其制备方法与应用

Family Cites Families (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK0932417T3 (da) 1996-10-17 2003-04-14 Immunomedics Inc Non-antigent toxinkonjugat og fusionsprotein af internaliserende receptorsystem
WO2001053342A1 (en) 2000-01-21 2001-07-26 The Burnham Institute Chimeric prostate-homing peptides with pro-apoptotic activity
WO2003020751A2 (en) 2001-09-05 2003-03-13 King's College London Homing peptides
AU2003224773B2 (en) 2002-03-26 2010-08-26 The General Hospital Corporation Combination therapy using trefoil peptides
US20060088899A1 (en) 2002-05-31 2006-04-27 Alvarez Vernon L Combination chemotherapy with chlorotoxin
FR2877946B1 (fr) 2004-11-12 2011-02-11 Commissariat Energie Atomique Peptides derives de la maurocalcine utilisables comme vecteurs pour l'adressage intracellulaire de molecules d'interet
CN101583370A (zh) 2005-09-27 2009-11-18 阿穆尼克斯公司 蛋白质药物及其用途
US7592009B2 (en) 2006-10-10 2009-09-22 Ecole Polytechnique Federale De Lausanne (Epfl) Polypeptide ligands for targeting cartilage and methods of use thereof
JP5463013B2 (ja) * 2007-06-19 2014-04-09 国立大学法人 岡山大学 軟骨マーカー
US20100215575A1 (en) 2007-10-12 2010-08-26 Transmolecular, Inc. Systemic Administration of Chlorotoxin Agents for the Diagnosis and Treatment of Tumors
CN102844044B (zh) 2010-02-04 2016-10-26 摩尔弗泰克有限公司 氯毒素多肽和结合物及其应用
EP3165533B1 (en) 2010-05-11 2020-04-08 Fred Hutchinson Cancer Research Center Chlorotoxin variants, conjugates and methods for their use
US20130280281A1 (en) 2010-07-02 2013-10-24 Jean-Paul Castaigne Short and d-amino acid-containing polypeptides for therapeutic conjugates and uses thereof
US10844106B2 (en) 2010-11-08 2020-11-24 The Board Of Trustees Of The Leland Stanford Junior University Fusion proteins comprising an engineered knottin peptide and uses thereof
US10426850B2 (en) 2011-11-22 2019-10-01 The Johns Hopkins University Collagen mimetic peptides for targeting collagen strands for in vitro and in vivo imaging and therapeutic use
WO2013078250A2 (en) 2011-11-22 2013-05-30 The Board Of Trustees Of The Leland Stanford Junior University Cystine knot peptides that bind alpha-v-beta-6 integrin
JP5724937B2 (ja) 2012-04-23 2015-05-27 ニプロ株式会社 腎臓集積性を示すペプチド、製剤
US8945553B2 (en) 2012-05-22 2015-02-03 Bristol-Myers Squibb Company Bispecific antibodies to IL-23 and IL-17A/F
CN104619727B (zh) 2012-06-25 2019-04-05 布里格姆及妇女医院股份有限公司 靶向治疗
US9587001B2 (en) 2012-10-19 2017-03-07 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
CA2913029A1 (en) * 2012-12-10 2014-06-19 Fred Hutchinson Cancer Research Center Lipocalin fusion partners
US20160084839A1 (en) 2013-04-02 2016-03-24 Marisa Dolled-Filhart Immunohistochemical assay for detecting expression of programmed death ligand 1 (pd-l1) in tumor tissue
CN105188728B (zh) 2013-05-07 2021-11-09 默克专利股份有限公司 用于肾靶向的肽和肽-活性物质-缀合物
US9937230B2 (en) * 2013-07-22 2018-04-10 Kineta One, Llc Ophthalmic uses of toxin-based therapeutic peptides and pharmaceutical compositions thereof
WO2015075699A1 (en) * 2013-11-25 2015-05-28 Sanofi Dotam derivatives for therapeutic use
WO2015100370A2 (en) 2013-12-23 2015-07-02 Kineta One, Llc Sustained release depot formulations of therapeutic proteins, and uses thereof
CA2949535C (en) 2014-05-21 2023-09-12 President And Fellows Of Harvard College Ras inhibitory peptides and uses thereof
CN107405388A (zh) 2015-01-08 2017-11-28 衣阿华大学研究基金会 用于体内关节软骨再生的方法
WO2016112208A2 (en) 2015-01-09 2016-07-14 Kineta One, Llp Topical applications of kv1.3 channel blocking peptides to treat skin inflammation
WO2016118859A1 (en) 2015-01-22 2016-07-28 Board Of Trustees Of The University Of Arkansas Compositions and methods for selectively depleting senescent cells comprising flip
CA2987636A1 (en) 2015-06-26 2016-12-29 Fred Hutchinson Cancer Research Center Therapeutic peptides and methods of use thereof
CN112574316A (zh) 2015-07-02 2021-03-30 博际生物医药科技(杭州)有限公司 用于肿瘤靶向治疗的白细胞介素-15融合蛋白
WO2017044894A2 (en) 2015-09-09 2017-03-16 Fred Hutchinson Cancer Research Center Cartilage-homing peptides
EP3386530A4 (en) 2015-12-11 2019-08-28 Fred Hutchinson Cancer Research Center PEPTIDES FOR KIDNEY THERAPY
WO2017143259A1 (en) 2016-02-19 2017-08-24 Dignity Health Antibody fusion protein and related compositions for targeting cancer
CA3033004A1 (en) 2016-09-09 2018-03-15 Fred Hutchinson Cancer Research Center Stable peptides and methods of use thereof
US20200188528A1 (en) 2016-12-19 2020-06-18 Fred Hutchinson Cancer Research Center Peptide-antibody compositions and methods of use thereof
WO2018136614A1 (en) 2017-01-18 2018-07-26 Fred Hutchinson Cancer Research Center Peptide compositions and methods of use thereof for disrupting tead interactions
EP3595699A4 (en) 2017-03-16 2020-12-23 Blaze Bioscience, Inc. PEPTIDIC CONJUGATES OF CARTILAGE ECOTROPISM AND THEIR METHODS OF USE
EP3638290A4 (en) 2017-06-15 2021-04-07 Blaze Bioscience, Inc. KIDNEY HOMING PEPTIDE CONJUGATES AND METHOD OF USING THEREOF

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11703510B2 (en) 2009-03-02 2023-07-18 Massachusetts Institute Of Technology Methods and products for in vivo enzyme profiling
US11549951B2 (en) 2009-03-02 2023-01-10 Massachusetts Institute Of Technology Methods and products for in vivo enzyme profiling
US11549947B2 (en) 2011-03-15 2023-01-10 Massachusetts Institute Of Technology Multiplexed detection with isotope-coded reporters
US11977074B2 (en) 2013-06-07 2024-05-07 Massachusetts Institute Of Technology Affinity-based detection of ligand-encoded synthetic biomarkers
US11559580B1 (en) 2013-09-17 2023-01-24 Blaze Bioscience, Inc. Tissue-homing peptide conjugates and methods of use thereof
US11090358B2 (en) 2015-09-09 2021-08-17 Fred Hutchinson Cancer Research Center Cartilage-homing peptides
US11648290B2 (en) 2015-09-09 2023-05-16 Fred Hutchinson Cancer Center Cartilage-homing peptides
US11448643B2 (en) 2016-04-08 2022-09-20 Massachusetts Institute Of Technology Methods to specifically profile protease activity at lymph nodes
US11428689B2 (en) 2016-05-05 2022-08-30 Massachusetts Institute Of Technology Methods and uses for remotely triggered protease activity measurements
EP3509615A4 (en) * 2016-09-09 2020-08-05 Fred Hutchinson Cancer Research Center STABLE PEPTIDES AND THEIR METHODS OF USE
WO2018049285A1 (en) 2016-09-09 2018-03-15 Fred Hutchinson Cancer Research Center Stable peptides and methods of use thereof
US11548923B2 (en) 2017-01-18 2023-01-10 Fred Hutchinson Cancer Center Peptide compositions and methods of use thereof for disrupting TEAD interactions
EP3595699A4 (en) * 2017-03-16 2020-12-23 Blaze Bioscience, Inc. PEPTIDIC CONJUGATES OF CARTILAGE ECOTROPISM AND THEIR METHODS OF USE
WO2018170480A1 (en) * 2017-03-16 2018-09-20 Blaze Bioscience, Inc. Cartilage-homing peptide conjugates and methods of use thereof
US11013814B2 (en) * 2017-03-16 2021-05-25 Blaze Bioscience, Inc. Cartilage-homing peptide conjugates and methods of use thereof
US12320801B2 (en) 2017-04-07 2025-06-03 Massachusetts Institute Of Technology Methods to spatially profile protease activity in tissue and sections
US11519905B2 (en) 2017-04-07 2022-12-06 Massachusetts Institute Of Technology Methods to spatially profile protease activity in tissue and sections
EP3638290A4 (en) * 2017-06-15 2021-04-07 Blaze Bioscience, Inc. KIDNEY HOMING PEPTIDE CONJUGATES AND METHOD OF USING THEREOF
US11331393B2 (en) 2017-06-15 2022-05-17 Blaze Bioscience, Inc. Renal-homing peptide conjugates and methods of use thereof
IT201700071296A1 (it) * 2017-06-26 2018-12-26 Alda S R L Nuovi reagenti per microscopia ottica
CN111194224A (zh) * 2017-06-26 2020-05-22 阿尔达责任有限公司 含抗体或Fab片段和荧光团的光学显微术试剂
WO2019003114A1 (en) * 2017-06-26 2019-01-03 Alda S.R.L. REAGENTS FOR OPTICAL MICROSCOPY COMPRISING FAB ANTIBODY OR FRAGMENT AND FLUOROPHORE
CN111194224B (zh) * 2017-06-26 2023-06-13 阿尔达责任有限公司 含抗体或Fab片段和荧光团的光学显微术试剂
US11860099B2 (en) 2017-06-26 2024-01-02 Alda S.R.L. Reagents for optical microscopy
US11866466B2 (en) 2017-12-19 2024-01-09 Blaze Bioscience, Inc. Tumor homing and cell penetrating peptide-immuno-oncology agent complexes and methods of use thereof
EP3727146A4 (en) * 2017-12-19 2021-10-06 Blaze Bioscience, Inc. TUMOR HOMING AND CELL-PENETANT PEPTIDE IMMUNO-ONCOLOGY AGENT COMPLEX AND METHOD OF USE
WO2019178573A1 (en) * 2018-03-16 2019-09-19 Blaze Bioscience, Inc. Truncated cartilage-homing peptides and peptide complexes and methods of use thereof
JP2021518357A (ja) * 2018-03-16 2021-08-02 ブレイズ バイオサイエンス, インコーポレイテッド 欠失した軟骨ホーミングペプチド、及び、ペプチド複合体、及び、それらの使用方法
WO2019209662A1 (en) * 2018-04-23 2019-10-31 Fred Hutchinson Cancer Research Center Conjugates of cartilage-homing peptides
JP2021522172A (ja) * 2018-04-23 2021-08-30 フレッド ハッチンソン キャンサー リサーチ センター 軟骨ホーミングペプチドの複合体
US12173349B2 (en) 2018-09-25 2024-12-24 Massachusetts Institute Of Technology Lung protease nanosensors and uses thereof
US11835522B2 (en) 2019-01-17 2023-12-05 Massachusetts Institute Of Technology Sensors for detecting and imaging of cancer metastasis

Also Published As

Publication number Publication date
BR112018004536A2 (pt) 2018-12-11
EP3347035A4 (en) 2019-05-01
US11090358B2 (en) 2021-08-17
US20190117728A1 (en) 2019-04-25
AU2016321342A1 (en) 2018-04-26
JP7378449B2 (ja) 2023-11-13
US20220016202A1 (en) 2022-01-20
IL257396A (en) 2018-04-30
CA2994865A1 (en) 2017-03-16
CN108135970B (zh) 2023-09-01
JP2022009342A (ja) 2022-01-14
US20230364183A1 (en) 2023-11-16
CN108135970A (zh) 2018-06-08
EP3347035A2 (en) 2018-07-18
JP6966424B2 (ja) 2021-11-17
IL257396B (en) 2020-06-30
WO2017044894A3 (en) 2017-05-11
US11648290B2 (en) 2023-05-16
JP2018527348A (ja) 2018-09-20

Similar Documents

Publication Publication Date Title
US11648290B2 (en) Cartilage-homing peptides
JP7280193B2 (ja) 軟骨ホーミングペプチドコンジュゲート及びその使用方法
US11331393B2 (en) Renal-homing peptide conjugates and methods of use thereof
WO2017100700A2 (en) Peptides for renal therapy
US11559580B1 (en) Tissue-homing peptide conjugates and methods of use thereof
JP2024015145A (ja) 欠失した軟骨ホーミングペプチド、及び、ペプチド複合体、及び、それらの使用方法
JP2024019603A (ja) 軟骨ホーミングペプチドの複合体

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16845226

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2994865

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 257396

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2018510741

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201680053482.4

Country of ref document: CN

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018004536

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2016845226

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2016321342

Country of ref document: AU

Date of ref document: 20160909

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16845226

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112018004536

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180307

WWW Wipo information: withdrawn in national office

Ref document number: 2016845226

Country of ref document: EP