WO2016120810A1 - Anti-transthyretin antibodies - Google Patents

Anti-transthyretin antibodies Download PDF

Info

Publication number
WO2016120810A1
WO2016120810A1 PCT/IB2016/050415 IB2016050415W WO2016120810A1 WO 2016120810 A1 WO2016120810 A1 WO 2016120810A1 IB 2016050415 W IB2016050415 W IB 2016050415W WO 2016120810 A1 WO2016120810 A1 WO 2016120810A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
ttr
chain variable
humanized
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2016/050415
Other languages
English (en)
French (fr)
Inventor
Yue Liu
Tarlochan S. Nijjar
Avijit Chakrabartty
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University Health Network
Prothena Biosciences Ltd
Original Assignee
University Health Network
Prothena Biosciences Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201680010882.7A priority Critical patent/CN107406499B/zh
Priority to UAA201708667A priority patent/UA122142C2/uk
Priority to JP2017539650A priority patent/JP6748086B2/ja
Priority to DK16702812.5T priority patent/DK3250592T3/da
Priority to CU2017000097A priority patent/CU24480B1/es
Priority to LTEPPCT/IB2016/050415T priority patent/LT3250592T/lt
Priority to EA201791712A priority patent/EA036080B1/ru
Priority to MYPI2017702751A priority patent/MY193688A/en
Priority to BR112017016330-6A priority patent/BR112017016330B1/pt
Priority to HRP20221538TT priority patent/HRP20221538T1/hr
Priority to KR1020237037602A priority patent/KR102677203B1/ko
Priority to AU2016210888A priority patent/AU2016210888C1/en
Priority to SI201631652T priority patent/SI3250592T1/sl
Priority to KR1020177023749A priority patent/KR102598180B1/ko
Priority to FIEP16702812.5T priority patent/FI3250592T3/fi
Priority to IL284022A priority patent/IL284022B2/en
Priority to MX2017009806A priority patent/MX394170B/es
Priority to PL16702812.5T priority patent/PL3250592T3/pl
Application filed by University Health Network, Prothena Biosciences Ltd filed Critical University Health Network
Priority to EP16702812.5A priority patent/EP3250592B1/en
Priority to RS20221170A priority patent/RS63906B1/sr
Priority to NZ733896A priority patent/NZ733896B2/en
Priority to ES16702812T priority patent/ES2934656T3/es
Priority to CA2974912A priority patent/CA2974912A1/en
Priority to SG11201706124VA priority patent/SG11201706124VA/en
Priority to EP22195219.5A priority patent/EP4134379A1/en
Publication of WO2016120810A1 publication Critical patent/WO2016120810A1/en
Priority to PH12017501318A priority patent/PH12017501318B1/en
Priority to IL253633A priority patent/IL253633B/en
Anticipated expiration legal-status Critical
Priority to ZA2017/05663A priority patent/ZA201705663B/en
Priority to CONC2017/0008476A priority patent/CO2017008476A2/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/24Antidepressants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the antibodies are a humanized or chimeric 9D5 or 14G8 antibody that specifically binds to transthyretin, wherein 9D5 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 1 and a mature light chain variable region of SEQ ID NO: 16, and 14G8 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70.
  • 9D5 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 1 and a mature light chain variable region of SEQ ID NO: 16
  • 14G8 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70.
  • positions L8, L9, LI 8, L19, L36, L39, L60, L70, and L74 are occupied by A, P, S, V, F, R, S, A, and R, respectively.
  • positions HI and H47 are occupied by E and L, respectively.
  • position L36 is occupied by F.
  • at least one of the following positions is occupied by the amino acid as specified: position H3 is occupied by K, position H105 is occupied by T, position L8 is occupied by A, position L9 is occupied by P, position L19 is occupied by V, position L26 is occupied by S, position L60 is occupied by S, and position L70 is occupied by A.
  • positions H3 and HI 05 are occupied by K and T, respectively.
  • positions L8, L9, L19, and L70 are occupied by A, P, V, and A, respectively.
  • the invention further provides nucleic acids encoding the heavy chain and/or light chain of any of the above antibodies, such as any one of SEQ ID NOS: 40, 42, 44-56, 87, 89, 91- 96, and 106-108.
  • the invention further provides a method of inhibiting or reducing aggregation of transthyretin in a subject having or at risk of developing a transthyretin- mediated amyloidosis, comprising administering to the subject an effective regime of any of the above antibodies, thereby inhibiting or reducing aggregation of transthyretin in the subject.
  • the invention further provides a method of inhibiting or reducing transthyretin fibril formation in a subject having or at risk of developing a transthyretin-mediated amyloidosis, comprising administering to the subject an effective regime of any of the above antibodies, thereby inhibiting or reducing transthyretin accumulation in the subject.
  • SEQ ID NO: 7 sets forth the amino acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 2b (Hu9D5VHv2b).
  • SEQ ID NO: 24 sets forth the amino acid sequence of Kabat CDR-Ll of the mouse 9D5 antibody.
  • SEQ ID NO: 44 sets forth the nucleic acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 1 (Hu9D5VHvl).
  • SEQ ID NO: 47 sets forth the nucleic acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 3 (Hu9D5VHv3).
  • SEQ ID NO: 70 sets forth the amino acid sequence of the light chain variable region of the mouse 14G8 antibody.
  • SEQ ID NO: 82 sets forth the amino acid sequence of humanized 14G8 heavy chain version 2.
  • SEQ ID NO: 84 sets forth the amino acid sequence of humanized 14G8 light chain version 1.
  • SEQ ID NO: 96 sets forth the nucleic acid sequence of the light chain variable region of the humanized 14G8 antibody version 3 (Hul4G8VLv3).
  • SEQ ID NO: 114 sets forth the amino acid sequence of a potential transthyretin immunogen.
  • the two different heavy/light chain pairs include a humanized 9D5 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 9D5.
  • the two different heavy/light chain pairs include a humanized 14G8 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 14G8.
  • [00171 ] Competition between antibodies is determined by an assay in which an antibody under test inhibits specific binding of a reference antibody to a common antigen (see, e.g., Junghans et al., Cancer Res. 50: 1495, 1990).
  • a test antibody competes with a reference antibody if an excess of a test antibody (e.g., at least 2x, 5x, lOx, 20x or lOOx) inhibits binding of the reference antibody by at least 50% as measured in a competitive binding assay.
  • Some test antibodies inhibit binding of the references antibody by at least 75%, 90% or 99%.
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
  • pharmaceutically acceptable means that the carrier, diluent, excipient, or auxiliary is compatible with the other ingredients of the formulation and not substantially deleterious to the recipient thereof.
  • biological sample refers to a sample of biological material within or obtainable from a biological source, for example a human or mammalian subject. Such samples can be organs, organelles, tissues, sections of tissues, bodily fluids, peripheral blood, blood plasma, blood serum, cells, molecules such as proteins and peptides, and any parts or
  • a humanized antibody comprises a humanized heavy chain and a humanized light chain.
  • a CDR in a humanized antibody is substantially from a corresponding CDR in a non- human antibody when at least 85%, 90%, 95% or 100% of corresponding residues (as defined by any conventional definition but preferably defined by Kabat) are identical between the respective CDRs.
  • the variable region framework sequences of an antibody chain or the constant region of an antibody chain are substantially from a human variable region framework sequence or human constant region respectively when at least 85%, 90%, 95% or 100% of corresponding residues defined by any conventional definition but preferably defined by Kabat are identical.
  • the human acceptor antibody sequences can optionally be selected from among the many known human antibody sequences to provide a high degree of sequence identity (e.g., 65- 85% identity) between a human acceptor sequence variable region frameworks and corresponding variable region frameworks of a donor antibody chain.
  • positions in which these two acceptors differ include positions H82a (N or S), H83 (R or K), H84 (A or S), and H89 (V or M).
  • Humanized versions of the 14G8 heavy chain variable region can include either amino acid at any of these positions.
  • framework residues that are candidates for substitution are residues creating a potential glycosylation site. Still other candidates for substitution are acceptor human framework amino acids that are unusual for a human immunoglobulin at that position. These amino acids can be substituted with amino acids from the equivalent position of the mouse donor antibody or from the equivalent positions of more typical human immunoglobulins.
  • Exemplified Hu9D5 antibodies include any permutations or combinations of the exemplified mature heavy and light chain variable regions (e.g., VHvl/VLvl or H1L1 ,
  • positions H82 and H82b in the Vh region are occupied by S and L, respectively, as in Hu9D5VHv4.
  • positions H42, H47, and H82b in the Vh region are occupied by E, L, and L, respectively, as in Hu9D5VHv5.
  • at least one of positions L8, L9, LI 8, L19, L36, L39, L60, L70, and L74 in the Vk region is occupied by A, P, S, V, F, R, S, A, and R, respectively.
  • position L36 in the Vk region is occupied by F, as in
  • Hu9D5VLv3 positions L8, L9, L19, L36, L39, L60, L70, and L74 in the Vk region are occupied by A, P, V, F, R, S, A, and R, respectively, as in Hu9D5VLv4.
  • positions L8, L9, L18, L19, L36, L39, L60, L70, and L74 in the Vk region are occupied by A, P, S, V, F, R, S, A, and R, respectively, as in Hu9D5VLv5.
  • the CDR regions of such humanized antibodies can be identical or substantially identical to the CDR regions of the 9D5 mouse donor antibody or any of the above exemplified humanized 9D5 antibodies.
  • the CDR regions can be defined by any conventional definition (e.g., Chothia, or composite of Chothia and Kabat) but are preferably as defined by Kabat.
  • Variable regions framework positions are in accordance with Kabat numbering unless otherwise stated. Other such variants typically differ from the sequences of the exemplified Hu9D5 heavy and light chains by a small number (e.g., typically no more than 1 , 2, 3, 5, 10, or 15) of replacements, deletions or insertions. Such differences are usually in the framework but can also occur in the CDRs.
  • Coding sequences of nucleic acids can be operably linked with regulatory sequences to ensure expression of the coding sequences, such as a promoter, enhancer, ribosome binding site, transcription termination signal, and the like.
  • the nucleic acids encoding heavy and light chains can occur in isolated form or can be cloned into one or more vectors.
  • the nucleic acids can be synthesized by, for example, solid state synthesis or PCR of overlapping oligonucleotides.
  • immunomodulator can be any agent that stimulates or inhibits the development or maintenance of an immunologic response. If such therapeutic moieties are coupled to an antibody specific for monomeric, misfolded, aggregated, or fibril forms of TTR, such as the antibodies described herein, the coupled therapeutic moieties will have a specific affinity for non-native, pathogenic forms of TTR over native tetrameric forms of TTR. Consequently, administration of the conjugated antibodies directly targets tissues comprising pathogenic forms of TTR with minimal damage to surrounding normal, healthy tissue. This can be particularly useful for therapeutic moieties that are too toxic to be administered on their own. In addition, smaller quantities of the therapeutic moieties can be used.
  • the antibodies disclosed herein can also be coupled or conjugated to one or more other antibodies (e.g., to form antibody heteroconjugates). Such other antibodies can bind to different epitopes within TTR or a portion thereof or can bind to a different target antigen.
  • Linkage of radioisotopes to antibodies may be performed with conventional bifunction chelates.
  • sulfur-based linkers may be used for radiosilver- 111 and radiosilver-199 linkage. See Hazra et al., Cell Biophys. 24-25: 1-7 (1994).
  • Linkage of silver radioisotopes may involve reducing the immunoglobulin with ascorbic acid.
  • Therapeutic moieties, other proteins, other antibodies, and/or detectable labels may be coupled or conjugated, directly or indirectly through an intermediate (e.g., a linker), to an antibody of the invention.
  • an intermediate e.g., a linker
  • Therapeutic moieties, other proteins, other antibodies, and/or detectable labels may be coupled or conjugated, directly or indirectly through an intermediate (e.g., a linker), to an antibody of the invention.
  • the frequency of administration depends on the half- life of the antibody in the circulation, the condition of the patient and the route of administration among other factors.
  • the frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the disorder being treated.
  • An exemplary frequency for intravenous administration is between weekly and quarterly over a continuous cause of treatment, although more or less frequent dosing is also possible.
  • an exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
  • the identification of the subject can occur in a clinical setting, or elsewhere, such as in the subject's home, for example, through the subject's own use of a self-testing kit.
  • the subject can be identified based on various symptoms such as peripheral neuropathy (sensory and motor), autonomic neuropathy, gastrointestinal impairment, cardiomyopathy, nephropathy, or ocular deposition. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013).
  • the subject can also be identified by increased levels of non-native forms of TTR in plasma samples from the subject compared to control samples, as disclosed in the examples.
  • TTR fibril formation in a subject having or at risk of a condition associated with TTR accumulation; reducing or clearing TTR deposits or aggregated TTR in a subject having or at risk of a condition associated with TTR accumulation; stabilizing non-toxic conformations of TTR in a subject having or at risk of a condition associated with TTR accumulation; inhibiting toxic effects of TTR aggregates, fibrils or deposits in a subject having or at risk of a condition associated with TTR accumulation; diagnosing the presence or absence of TTR amyloid accumulation in a tissue suspected of comprising the amyloid accumulation; determining a level of TTR deposits in a subject by detecting the presence of bound antibody in the subject following administration of the antibody; detecting the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in a subject; monitoring and evaluating the efficacy of therapeutic agents being used to treat patients diagnosed with a TTR amyloidosis; inducing an immune response comprising antibodies to TTR in a subject; delaying the
  • Diagnosis is performed by comparing the number, size, and/or intensity of labeled loci to corresponding base line values.
  • the base line values can represent the mean levels in a population of undiseased individuals. Base line values can also represent previous levels determined in the same subject. For example, base line values can be determined in a subject before beginning treatment, and measured values thereafter compared with the base line values. A decrease in values relative to base line generally signals a positive response to treatment.
  • the antibodies can be used for detecting monomeric, misfolded, aggregated, or fibril forms of transthyretin (TTR), or fragments thereof, in the context of clinical diagnosis or treatment or in research.
  • TTR transthyretin
  • the antibodies can be used to detect the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in a biological sample as an indication that the biological sample comprises TTR amyloid deposits.
  • Binding of the antibodies to the biological sample can be compared to binding of the antibodies to a control sample.
  • the control sample and the biological sample can comprise cells of the same tissue origin. Control samples and biological samples can be obtained from the same individual or different individuals and on the same occasion or on different occasions.
  • vernier/CDR foundation residues include residues 4, 35, 46, 49, 66, 68, and 69 by Kabat numbering in Table 8.
  • K74R R appears to stabilize the loop compared to K at this position, so
  • H84 (A or S): S and A are present in the two frameworks considered, so each residue was tried in separate versions.
  • H89 (V or M) V and M are present in the two frameworks considered, so each was tried in separate versions.
  • Hu9D5VL version 4 (P8A, L9P, A19V, Y36F, K39R, D60S, D70A, and K74R substitutions in lowercase):
  • Table 12 summarizes the Biacore association rate (k a ), dissociation rate (kd), and binding affinity constant (K D ) of the murine, chimeric, and humanized 9D5 variants for recombinant human TTR F87M/L110M.
  • Examples of canonical/CDR interacting residues include residues 2, 48, 64, and 71 by Kabat numbering in Table 14.
  • Examples of interface/packing (VH+VL) residues include residues 36, 38, 44, 47, 87, and 98 by Kabat numbering in Table 14.
  • D70A D is much more frequent than A in human IgG frameworks. However, D will form ionic bond with R24 in light chain CDR1, so both A and D were included in separate versions.
  • Hul4G8VL version 1 (P8A, L9P, A19V, Y36F, D70A substitutions in lowercase):
  • Hul4G8VH version 3 (Q1E and W47L substitutions in lowercase): e VQLVES GGGLVQPGGS LKLS C A AS GFTFS S YTMS WVRQTPEKRLE1V AEINNS GDTT Y Y PDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARHYYYGGGYGGWFFDVWGQ GTLVTVSS (SEQ ID NO: 66)
  • Table 18 summarizes the association rate (k a ), dissociation rate (kd), and binding affinity constant (KD) of the mouse 14G8, chimeric- 14G8, Hul4G8 H2L1, Hul4G8 H2L2, Hul4G8H2L3, and Hul4G8 H3L1 for recombinant human TTR F87M/L110M.
  • KD binding affinity constant
  • Hybridoma selection was based on the following ELISA screen: 96-well ELISA plates were coated with chicken anti-His, 1 ⁇ g/mL PBS and incubated for 1 hour. Plates were blocked with of 1% BS A/PBS solution, 200 uL/well for 15 minutes then 0.5 ⁇ g/mL pH4-TTR, 50 lL/we ⁇ was added and incubated for 1 hour. pH4-TTR is TTR that has been subjected to low pH (50 mM sodium acetate, pH 4.0) in order to dissociate/aggregate TTR, exposing the TTR89- 97 epitope. Plates were washed twice with TBS-T.
  • E. coli (BL21-A1) cells were transformed with a pET21a(+) plasmid containing a TTR insert (Met-hTTR-(His)e or a TTR variant containing an F87M/L110M double mutation. Cells were grown in 2YT broth containing 100 g/ml ampicillin. Expression of TTR was induced overnight at 20°C in the presence of ImM IPTG and 005% arabinose.
  • Immunohistochemistry was performed on lightly paraformaldheyde-fixed, 10 ⁇ slide-mounted cryosections and on 5 ⁇ paraffin sections.
  • the immunoperoxidase method was the principal detection system, which was performed on the Leica Bond Rx (Leica Biosystems, Buffalo Grove, IL) using the Bond Polymer Refine Detection Kit (DS980, Leica Biosystems).
  • the primary antibodies were incubated for one hour (according to concentrations in Table 2) followed by incubation with anti-mouse and anti-rabbit polymeric HRP-linker antibody conjugates.
  • the staining was visualized with a DAB chromogen, which produced a brown deposit.
  • THP-1 human monocytes were cultured in cell culture media (RMPI, 10% low IgG serum, pen/strep). A 20 ⁇ g/mL aliquot of pHrodo-labeled TTR was separately pre-incubated with 40 ⁇ g/mL antibody at 37°C in cell culture media for 30 min prior to the addition of 5E+04 THP-1 cells in a 1 : 1 volumetric ratio. After tissue culture incubation (3 h), cells were washed with cell culture media three times, incubated in media for 10 min, then washed twice with and resuspended in FACS buffer (1% FBS in PBS). Red pHrodo fluorescence intensity was detected using Texas Red channel filters.
  • RMPI 10% low IgG serum, pen/strep
  • TTR-F87M/L110M was covalently labeled with the pH-sensitive fluorescent dye pHrodo.
  • the pHrodo tag has minimal fluorescence under physiological pH, but fluorescence is enhanced upon engulfment into the low pH environments of endocytic vesicles and thus marks cellular uptake of tagged particles.
  • THP-1 monocytes were added to pHrodo-tagged TTR (native or non-native, TTR-F87M/L110M) after treatment with either 14G8 or the isotype control antibody. Low levels of fluorescence were observed with either antibody incubated with native TTR, and after incubation of the control antibody with non-native TTR.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biomedical Technology (AREA)
  • Psychiatry (AREA)
  • Pain & Pain Management (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Hospice & Palliative Care (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/IB2016/050415 2015-01-28 2016-01-28 Anti-transthyretin antibodies Ceased WO2016120810A1 (en)

Priority Applications (29)

Application Number Priority Date Filing Date Title
MX2017009806A MX394170B (es) 2015-01-28 2016-01-28 Anticuerpos anti-transtiretina
JP2017539650A JP6748086B2 (ja) 2015-01-28 2016-01-28 抗トランスサイレチン抗体
DK16702812.5T DK3250592T3 (en) 2015-01-28 2016-01-28 Anti-transthyretin-antistoffer
CU2017000097A CU24480B1 (es) 2015-01-28 2016-01-28 Anticuerpos anti-transtiretina
LTEPPCT/IB2016/050415T LT3250592T (lt) 2015-01-28 2016-01-28 Antikūnai prieš transtiretiną
EA201791712A EA036080B1 (ru) 2015-01-28 2016-01-28 Антитела к транстиретину
MYPI2017702751A MY193688A (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
BR112017016330-6A BR112017016330B1 (pt) 2015-01-28 2016-01-28 Anticorpo humanizado, composição farmacêutica, ácido nucleico e uso de um regime e de uma quantidade eficaz do anticorpo humanizado
HRP20221538TT HRP20221538T1 (hr) 2015-01-28 2016-01-28 Anti-transtiretinska antitijela
KR1020237037602A KR102677203B1 (ko) 2015-01-28 2016-01-28 항-트랜스타이레틴 항체
AU2016210888A AU2016210888C1 (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
SI201631652T SI3250592T1 (sl) 2015-01-28 2016-01-28 Anti-transtiretin protitelesa
KR1020177023749A KR102598180B1 (ko) 2015-01-28 2016-01-28 항-트랜스타이레틴 항체
FIEP16702812.5T FI3250592T3 (fi) 2015-01-28 2016-01-28 Transtyretiinin vastaisia vasta-aineita
IL284022A IL284022B2 (en) 2015-12-11 2016-01-28 Anti-transthyretin antibodies
CN201680010882.7A CN107406499B (zh) 2015-01-28 2016-01-28 抗甲状腺素运载蛋白抗体
UAA201708667A UA122142C2 (uk) 2015-01-28 2016-01-28 Антитіло до транстиретину
PL16702812.5T PL3250592T3 (pl) 2015-01-28 2016-01-28 Przeciwciała przeciwko transtyretynie
EP16702812.5A EP3250592B1 (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
RS20221170A RS63906B1 (sr) 2015-01-28 2016-01-28 Anti-transtiretin antitela
NZ733896A NZ733896B2 (en) 2016-01-28 Anti-transthyretin antibodies
ES16702812T ES2934656T3 (es) 2015-01-28 2016-01-28 Anticuerpos antitranstiretina
CA2974912A CA2974912A1 (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
SG11201706124VA SG11201706124VA (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
EP22195219.5A EP4134379A1 (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies
PH12017501318A PH12017501318B1 (en) 2015-01-28 2017-07-20 Anti-transthyretin antibodies
IL253633A IL253633B (en) 2015-01-28 2017-07-24 Anti-transthyretin antibodies
ZA2017/05663A ZA201705663B (en) 2015-01-28 2017-08-21 Anti-transthyretin antibodies
CONC2017/0008476A CO2017008476A2 (es) 2015-01-28 2017-08-22 Anticuerpos anti-transtiretina

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562109002P 2015-01-28 2015-01-28
US62/109,002 2015-01-28
US201562266556P 2015-12-11 2015-12-11
US62/266,556 2015-12-11

Publications (1)

Publication Number Publication Date
WO2016120810A1 true WO2016120810A1 (en) 2016-08-04

Family

ID=55299694

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2016/050415 Ceased WO2016120810A1 (en) 2015-01-28 2016-01-28 Anti-transthyretin antibodies

Country Status (31)

Country Link
US (1) US20160251418A1 (enExample)
EP (2) EP3250592B1 (enExample)
JP (2) JP6748086B2 (enExample)
KR (2) KR102677203B1 (enExample)
CN (1) CN107406499B (enExample)
AU (1) AU2016210888C1 (enExample)
CA (1) CA2974912A1 (enExample)
CL (2) CL2017001924A1 (enExample)
CO (1) CO2017008476A2 (enExample)
CU (1) CU24480B1 (enExample)
DK (1) DK3250592T3 (enExample)
EA (1) EA036080B1 (enExample)
ES (1) ES2934656T3 (enExample)
FI (1) FI3250592T3 (enExample)
HR (1) HRP20221538T1 (enExample)
HU (1) HUE060878T2 (enExample)
IL (1) IL253633B (enExample)
LT (1) LT3250592T (enExample)
MX (1) MX394170B (enExample)
PE (1) PE20180217A1 (enExample)
PH (1) PH12017501318B1 (enExample)
PL (1) PL3250592T3 (enExample)
PT (1) PT3250592T (enExample)
RS (1) RS63906B1 (enExample)
SA (1) SA517382002B1 (enExample)
SG (2) SG10202101763VA (enExample)
SI (1) SI3250592T1 (enExample)
TW (2) TWI718122B (enExample)
UA (1) UA122142C2 (enExample)
WO (1) WO2016120810A1 (enExample)
ZA (1) ZA201705663B (enExample)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9879080B2 (en) 2015-01-28 2018-01-30 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2018007922A3 (en) * 2016-07-02 2018-02-15 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2019071206A1 (en) 2017-10-06 2019-04-11 Prothena Biosciences Limited METHODS OF DETECTING TRANSTHYRETIN
WO2019108689A1 (en) 2017-11-29 2019-06-06 Prothena Biosciences Limited Lyophilized formulation of a monoclonal antibody against transthyretin
US10464999B2 (en) 2015-01-28 2019-11-05 Prothena Biosciences Limited Anti-transthyretin antibodies
US10633433B2 (en) 2015-01-28 2020-04-28 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2020094883A1 (en) 2018-11-09 2020-05-14 Neurimmune Ag Patient-derived amyloid xenograft non-human animal model
WO2021185961A1 (en) 2020-03-18 2021-09-23 Al-S Pharma Ag Misfolded sod1 assay
WO2021228987A1 (en) 2020-05-12 2021-11-18 Neurimmune Ag Combination therapy for ttr amyloidosis
US11267877B2 (en) 2017-10-06 2022-03-08 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2023099788A1 (en) 2021-12-03 2023-06-08 Neurimmune Ag Novel potency assay for antibody-based drugs and useful means therefor
WO2024105062A1 (en) 2022-11-15 2024-05-23 Neurimmune Ag Methods for treating or preventing transthyretin-mediated amyloidosis
WO2024197157A1 (en) * 2023-03-21 2024-09-26 Biograph 55, Inc. Cd19/cd38 multispecific antibodies
EP4237005A4 (en) * 2020-10-28 2024-10-09 Novo Nordisk A/S ANTI-TRANSTHYRETIN ANTIBODIES AND METHODS OF USE THEREOF
WO2024240562A1 (en) 2023-05-19 2024-11-28 Neurimmune Ag Novel immunotherapy for musculoskeletal disorders and conditions
WO2025104243A1 (en) 2023-11-15 2025-05-22 Neurimmune Ag Anti-transthyretin antibody, compositions comprising said antibody and methods for treating or preventing transthyretin-mediated amyloidosis
WO2025125544A1 (en) 2023-12-15 2025-06-19 Novo Nordisk A/S Stable liquid formulations
WO2025238147A1 (en) 2024-05-15 2025-11-20 Neurimmune Ag Maintenance treatment of cardiac ttr amyloidosis using anti-transthyretin antibodies

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230340089A1 (en) * 2020-05-14 2023-10-26 City Of Hope Smc1a antibodies and uses thereof
CN113845593B (zh) * 2021-10-27 2023-03-10 福州迈新生物技术开发有限公司 抗α-SMA蛋白单克隆抗体、细胞系及其应用
KR20250084971A (ko) * 2022-10-19 2025-06-11 아이바이오, 인크. 케모킨 수용체 8(ccr8) 항체

Citations (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634666A (en) 1984-01-06 1987-01-06 The Board Of Trustees Of The Leland Stanford Junior University Human-murine hybridoma fusion partner
US4634664A (en) 1982-01-22 1987-01-06 Sandoz Ltd. Process for the production of human mono-clonal antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1993012227A1 (en) 1991-12-17 1993-06-24 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5304489A (en) 1987-02-17 1994-04-19 Genpharm International, Inc. DNA sequences to target proteins to the mammary gland for efficient secretion
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5741957A (en) 1989-12-01 1998-04-21 Pharming B.V. Transgenic bovine
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US5849992A (en) 1993-12-20 1998-12-15 Genzyme Transgenics Corporation Transgenic production of antibodies in milk
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5858657A (en) 1992-05-15 1999-01-12 Medical Research Council Methods for producing members of specific binding pairs
US5871907A (en) 1991-05-15 1999-02-16 Medical Research Council Methods for producing members of specific binding pairs
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5877218A (en) 1994-01-10 1999-03-02 Teva Pharmaceutical Industries, Ltd. Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5888809A (en) 1997-05-01 1999-03-30 Icos Corporation Hamster EF-1α transcriptional regulatory DNA
US6063598A (en) 1995-10-24 2000-05-16 Dr. Karl Thomae Gmbh Strong homologous promoter obtained from hamsters
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
WO2003057838A2 (en) 2001-12-28 2003-07-17 Abgenix, Inc. Antibodies against the muc18 antigen
US6624821B1 (en) 1999-02-05 2003-09-23 Samsung Electronics Co., Ltd. Image texture retrieving method and apparatus thereof
WO2004050884A2 (de) 2002-11-29 2004-06-17 Boehringer Ingelheim Pharma Gmbh & Co. Kg Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen
US20050009150A1 (en) 1998-11-30 2005-01-13 Elan Pharmaceuticals, Inc. Humanized antibodies that recognize beta amyloid peptide
WO2005019442A2 (de) 2003-08-19 2005-03-03 Boehringer Ingelheim Pharma Gmbh & Co. Kg Verfahren zur reklonierung von produktionszellen
US6881557B2 (en) 2001-07-12 2005-04-19 Arrowsmith Technologies Llp Super humanized antibodies
WO2008012142A1 (de) 2006-07-26 2008-01-31 Boehringer Ingelheim Pharma Gmbh & Co. Kg Regulatorische nukleinsäureelemente
WO2008107388A1 (en) 2007-03-02 2008-09-12 Boehringer Ingelheim Pharma Gmbh & Co. Kg Improvement of protein production
WO2009027471A1 (de) 2007-08-29 2009-03-05 Boehringer Ingelheim Pharma Gmbh & Co. Kg Verfahren zur steigerung von proteintitern
US7569339B2 (en) 2004-11-10 2009-08-04 Boehringer Ingelheim Pharma Gmbh & Co., Kg Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells
US20110008255A1 (en) 2006-04-21 2011-01-13 The Department Of Health And Human Services Beta-amyloid pet imaging agents
US8455622B2 (en) 2006-12-01 2013-06-04 Seattle Genetics, Inc. Variant target binding agents and uses thereof
US20140056904A1 (en) 2012-08-24 2014-02-27 University Health Network Antibodies to TTR and Methods of Use
WO2014124334A2 (en) * 2013-02-08 2014-08-14 Misfolding Diagnostics, Inc. Transthyretin antibodies and uses thereof
WO2015010118A2 (en) * 2013-07-19 2015-01-22 The University Of Texas Transthyretin amyloid-selective and polyreactive catabodies
WO2019071206A1 (en) 2017-10-06 2019-04-11 Prothena Biosciences Limited METHODS OF DETECTING TRANSTHYRETIN

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI20115165A0 (fi) * 2011-02-21 2011-02-21 Polysackaridforskning I Uppsala Ab Terapeuttisia ja diagnostisia menetelmiä

Patent Citations (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634664A (en) 1982-01-22 1987-01-06 Sandoz Ltd. Process for the production of human mono-clonal antibodies
US4634666A (en) 1984-01-06 1987-01-06 The Board Of Trustees Of The Leland Stanford Junior University Human-murine hybridoma fusion partner
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5304489A (en) 1987-02-17 1994-04-19 Genpharm International, Inc. DNA sequences to target proteins to the mammary gland for efficient secretion
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5741957A (en) 1989-12-01 1998-04-21 Pharming B.V. Transgenic bovine
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5871907A (en) 1991-05-15 1999-02-16 Medical Research Council Methods for producing members of specific binding pairs
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
WO1993012227A1 (en) 1991-12-17 1993-06-24 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5858657A (en) 1992-05-15 1999-01-12 Medical Research Council Methods for producing members of specific binding pairs
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US5849992A (en) 1993-12-20 1998-12-15 Genzyme Transgenics Corporation Transgenic production of antibodies in milk
US5877218A (en) 1994-01-10 1999-03-02 Teva Pharmaceutical Industries, Ltd. Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives
US5786464C1 (en) 1994-09-19 2012-04-24 Gen Hospital Corp Overexpression of mammalian and viral proteins
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US6063598A (en) 1995-10-24 2000-05-16 Dr. Karl Thomae Gmbh Strong homologous promoter obtained from hamsters
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6114148C1 (en) 1996-09-20 2012-05-01 Gen Hospital Corp High level expression of proteins
US5888809A (en) 1997-05-01 1999-03-30 Icos Corporation Hamster EF-1α transcriptional regulatory DNA
US20050009150A1 (en) 1998-11-30 2005-01-13 Elan Pharmaceuticals, Inc. Humanized antibodies that recognize beta amyloid peptide
US6624821B1 (en) 1999-02-05 2003-09-23 Samsung Electronics Co., Ltd. Image texture retrieving method and apparatus thereof
US6881557B2 (en) 2001-07-12 2005-04-19 Arrowsmith Technologies Llp Super humanized antibodies
WO2003057838A2 (en) 2001-12-28 2003-07-17 Abgenix, Inc. Antibodies against the muc18 antigen
WO2004050884A2 (de) 2002-11-29 2004-06-17 Boehringer Ingelheim Pharma Gmbh & Co. Kg Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen
WO2005019442A2 (de) 2003-08-19 2005-03-03 Boehringer Ingelheim Pharma Gmbh & Co. Kg Verfahren zur reklonierung von produktionszellen
US7569339B2 (en) 2004-11-10 2009-08-04 Boehringer Ingelheim Pharma Gmbh & Co., Kg Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells
US20110008255A1 (en) 2006-04-21 2011-01-13 The Department Of Health And Human Services Beta-amyloid pet imaging agents
WO2008012142A1 (de) 2006-07-26 2008-01-31 Boehringer Ingelheim Pharma Gmbh & Co. Kg Regulatorische nukleinsäureelemente
US8455622B2 (en) 2006-12-01 2013-06-04 Seattle Genetics, Inc. Variant target binding agents and uses thereof
WO2008107388A1 (en) 2007-03-02 2008-09-12 Boehringer Ingelheim Pharma Gmbh & Co. Kg Improvement of protein production
WO2009027471A1 (de) 2007-08-29 2009-03-05 Boehringer Ingelheim Pharma Gmbh & Co. Kg Verfahren zur steigerung von proteintitern
US20140056904A1 (en) 2012-08-24 2014-02-27 University Health Network Antibodies to TTR and Methods of Use
WO2014124334A2 (en) * 2013-02-08 2014-08-14 Misfolding Diagnostics, Inc. Transthyretin antibodies and uses thereof
WO2015010118A2 (en) * 2013-07-19 2015-01-22 The University Of Texas Transthyretin amyloid-selective and polyreactive catabodies
WO2019071206A1 (en) 2017-10-06 2019-04-11 Prothena Biosciences Limited METHODS OF DETECTING TRANSTHYRETIN

Non-Patent Citations (80)

* Cited by examiner, † Cited by third party
Title
"Fundamental Immunology", 1989, RAVEN PRESS
"Molecular Medicine and Medicinal Chemistry", 1 January 2011, article OLIVIER LÉGER ET AL: "Antibody Drug Discovery Chapter 1: "Humanization of Antibodies"", pages: 1 - 23, XP055119233 *
"Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16
AKAHORI ET AL.: "Construction and characterization of antibody libraries: isolation of therapeutic human antibodies and application to functional genomics", DIRECT SUBMISSION, 25 July 2001 (2001-07-25)
ALMAGRO JUAN C ET AL: "Humanization of antibodies", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 13, 1 January 2008 (2008-01-01), pages 1619 - 1633, XP009126790, ISSN: 1093-9946 *
ALMEIDA; SARAIVA, FEBS LETTERS, vol. 586, 2012, pages 2891 - 2896
ANDO ET AL., ORPHANET JOURNAL OF RARE DISEASES, vol. 8, 2013, pages 31
ANDO ET AL., ORPHANET JOURNAL OF RARE DISEASES, vol. 8, pages 31
ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56
ATWAL ET AL., SCI. TRANS. MED., vol. 3, 2011, pages 84RA43
BANNER ET AL., ACTA. CRYSTALLOGR. D. BIOL. CRYSTALLOGR., vol. 69, 2013, pages 1124 - 1137
BERTSCHINGER ET AL., PROTEIN ENG. DES. SEL., vol. 20, 2007, pages 57 - 68
BRACK ET AL., MOL. CANCER THER., vol. 13, 2014, pages 2030 - 2039
CARDOSO; SARAIVA, FASEB J, vol. 20, no. 2, 2006, pages 234 - 239
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA, J. MOL. BIOL., vol. 196, 1987, pages 901
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CO ET AL., J. IMMUNOL., vol. 148, 1992, pages 1149
COVACEUSZACH ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR, vol. 57, 2001, pages 1307 - 1309
DAMAS; SARAIVA, J. STRUCT. BIOL., vol. 130, pages 290 - 299
DESHPANDE ET AL., NUCLEIC ACIDS RES., vol. 33, 2005, pages D233 - 7
DWULET; BENSON, BIOCHEM. BIOPHYS. RES. COMMUN, vol. 114, 1983, pages 657 - 662
DWULET; BENSON, BIOCHEM. BIOPHYS. RES. COMMUN., vol. 114, 1983, pages 657 - 662
ELLEN ROSE: "Protena discontinues development of NEOD001 for AL Amyloidosis", PROTENA - PRESS RELEASE, 23 April 2018 (2018-04-23), XP055672663, Retrieved from the Internet <URL:http://ir.prothena.com/news-releases/news-release-details/prothena-discontinues-development-neod001-al-amyloidosis>
FOOTE; WINTER, J. MOL. BIOL, vol. 224, 1992, pages 487 - 499
GOLDSTEINS G ET AL: "Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 96, no. 6, 16 March 1999 (1999-03-16), pages 3108 - 3113, XP002987251, ISSN: 0027-8424, DOI: 10.1073/PNAS.96.6.3108 *
GONZALES ET AL., MOL. IMMUNOL., vol. 41, 2004, pages 863
GRABULOVSKI ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 3196 - 3204
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, CSHP
HAZRA ET AL., CELL BIOPHYS, vol. 24-25, 1994, pages 1 - 7
HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53
HINTON ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 6213
INOUE ET AL.: "Specific pathogen free conditions prevent transthyretin amyloidosis in mouse models", TRANSGENIC RESEARCH, vol. 17, 2008, pages 817 - 826, XP019616159
ITO; MAEDA: "Recent Advances in Transthyretin Evolution, Structure, and Biological Functions", 2009, SPRINGER, article "Mouse Models of Transthyretin Amyloidosis", pages: 261 - 280
IWAHASHI ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 1079 - 1091
JIANG ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 11442 - 11452
JOHNSON ET AL., J. MOL. BIOL., vol. 421, no. 2-3, 2012, pages 185 - 203
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KABAT: "Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH
KOHNO ET AL., AM. J. PATH., vol. 150, no. 4, 1997, pages 1497 - 1508
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 53
LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 4005
LUNDQUIST ET AL., INFECT. IMMUN., vol. 74, no. 6, 2006, pages 3222 - 3231
MARTIN; THORNTON, J MOL. BIOL., vol. 263, 1996, pages 800 - 15
MARTIN; THORNTON, J. MOL. BIOL., vol. 263, 1996, pages 800 - 15
MONICHAN PHAY ET AL: "Transthyretin Aggregate-Specific Antibodies Recognize Cryptic Epitopes on Patient-Derived Amyloid Fibrils", REJUVENATION RESEARCH, vol. 17, no. 2, 1 April 2014 (2014-04-01), US, pages 97 - 104, XP055256411, ISSN: 1549-1684, DOI: 10.1089/rej.2013.1524 *
NAGATA ET AL., J. BIOCHEM., vol. 117, 1995, pages 169 - 175
NEUBERGER, NAT. BIOTECHNOL., vol. 14, 1996, pages 826
OESTBERG ET AL., HYBRIDOMA, vol. 2, 1983, pages 361 - 367
OSTERMEIER ET AL., PROTEINS, vol. 21, no. 1, 1995, pages 74 - 77
PASCALIS ET AL., J. IMMUNOL., vol. 169, 2002, pages 3076
PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 4771 - 4775
QUEEN ET AL., IMMUNOL. REV, vol. 89, 1986, pages 49
RUBERG; BERK, CIRCULATION, vol. 126, 2012, pages 1286 - 1300
RUZHEINIKOV ET AL., J. MOL. BIOL., vol. 332, no. 2, 2003, pages 423 - 435
SANTOS ET AL., NEUROBIOLOGY OF AGING, vol. 31, 2010, pages 280 - 289
SARAIVA, FEBS LETTERS, vol. 498, 2001, pages 201 - 203
SARAIVA, HUM. MUTAT., vol. 17, no. 6, 2001, pages 493 - 503
SCHLATTER ET AL., MABS, vol. 4, 2011, pages 497 - 508
SCIENCE, vol. 259, 1993, pages 373 - 377
SCOPES: "Protein Purification", 1982, SPRINGER-VERLAG
SHIMADA ET AL., MOL. BIOL. MED., vol. 6, 1989, pages 333 - 343
SHIRAI ET AL., FEBS LETT., vol. 455, 1999, pages 188 - 97
SHRINER ET AL., VACCINE, vol. 24, no. 49-50, 2006, pages 7159 - 7166
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
SOUSA ET AL., AM. J. PATH., vol. 161, 2002, pages 1935 - 1948
TAMURA ET AL., J. IMMUNOL., vol. 164, 2000, pages 1432 - 1441
TENG ET AL., LAB. INVEST., vol. 81, no. 3, 2001, pages 385 - 396
TENG ET AL., LABORATORY INVESTIGATIONS, vol. 81, 2001, pages 385 - 396
THORNTON; MARTIN, J. MOL. BIOL., vol. 263, 1996, pages 800 - 815
THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58
THORPE ET AL.: "Monoclonal Antibodies 84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506
VAJDOS ET AL., J. OF MOL. BIOL., vol. 320, 2002, pages 415 - 428
WAKASUGI ET AL., PROC. JAPAN ACAD., vol. 63B, 1987, pages 344 - 347
WALL ET AL., ISNM ANNUAL MEETING, 2011
WANG ET AL., MABS, vol. 1, no. 3, 2009, pages 254 - 267
WINNACKER: "From Genes to Clones", 1987, VCH PUBLISHERS
WITZIG, CANCER CHEMOTHER. PHARMACOL., vol. 48, no. 1, 2001, pages 591 - S95
WU ET AL.: "Antibody Engineering", 2010, SPRINGER, article "Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-IgTM) Molecule"
YU ET AL., SCI. TRANS. MED., vol. 3, 2011, pages 84RA44

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11267878B2 (en) 2015-01-28 2022-03-08 Neotope Neuroscience Limited Anti-transthyretin antibodies
US11912759B2 (en) 2015-01-28 2024-02-27 Novo Nordisk A/S Anti-transthyretin antibodies
US11629185B2 (en) 2015-01-28 2023-04-18 Novo Nordisk A/S Anti-transthyretin antibodies
US10669330B2 (en) 2015-01-28 2020-06-02 Prothena Biosciences Limited Anti-transthyretin antibodies
US10464999B2 (en) 2015-01-28 2019-11-05 Prothena Biosciences Limited Anti-transthyretin antibodies
US10494426B2 (en) 2015-01-28 2019-12-03 Prothena Biosciences Limited Anti-transthyretin antibodies
US10633433B2 (en) 2015-01-28 2020-04-28 Prothena Biosciences Limited Anti-transthyretin antibodies
US11028158B2 (en) 2015-01-28 2021-06-08 Prothena Biosciences Limited Anti-transthyretin antibodies
US9879080B2 (en) 2015-01-28 2018-01-30 Prothena Biosciences Limited Anti-transthyretin antibodies
US10906967B2 (en) 2015-01-28 2021-02-02 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2018007922A3 (en) * 2016-07-02 2018-02-15 Prothena Biosciences Limited Anti-transthyretin antibodies
US11267877B2 (en) 2017-10-06 2022-03-08 Prothena Biosciences Limited Anti-transthyretin antibodies
WO2019071206A1 (en) 2017-10-06 2019-04-11 Prothena Biosciences Limited METHODS OF DETECTING TRANSTHYRETIN
CN111757730A (zh) * 2017-10-06 2020-10-09 普罗塞纳生物科学有限公司 检测甲状腺素运载蛋白的方法
US12247985B2 (en) 2017-10-06 2025-03-11 Novo Nordisk A/S Methods of detecting transthyretin
JP2021504372A (ja) * 2017-11-29 2021-02-15 プロセナ バイオサイエンシーズ リミテッド トランスサイレチンに対するモノクローナル抗体の凍結乾燥製剤
EP3717512A4 (en) * 2017-11-29 2021-08-25 Prothena Biosciences Limited LYOPHILIZED FORMULATION OF A MONOCLONAL ANTIBODY AGAINST TRANSTHYRETIN
US11873332B2 (en) 2017-11-29 2024-01-16 Novo Nordisk A/S Lyophilized formulation of a monoclonal antibody against transthyretin
JP7337057B2 (ja) 2017-11-29 2023-09-01 ノボ ノルディスク エー/エス トランスサイレチンに対するモノクローナル抗体の凍結乾燥製剤
WO2019108689A1 (en) 2017-11-29 2019-06-06 Prothena Biosciences Limited Lyophilized formulation of a monoclonal antibody against transthyretin
WO2020094883A1 (en) 2018-11-09 2020-05-14 Neurimmune Ag Patient-derived amyloid xenograft non-human animal model
WO2021185961A1 (en) 2020-03-18 2021-09-23 Al-S Pharma Ag Misfolded sod1 assay
WO2021228987A1 (en) 2020-05-12 2021-11-18 Neurimmune Ag Combination therapy for ttr amyloidosis
EP4237005A4 (en) * 2020-10-28 2024-10-09 Novo Nordisk A/S ANTI-TRANSTHYRETIN ANTIBODIES AND METHODS OF USE THEREOF
WO2023099788A1 (en) 2021-12-03 2023-06-08 Neurimmune Ag Novel potency assay for antibody-based drugs and useful means therefor
WO2024105062A1 (en) 2022-11-15 2024-05-23 Neurimmune Ag Methods for treating or preventing transthyretin-mediated amyloidosis
WO2024197157A1 (en) * 2023-03-21 2024-09-26 Biograph 55, Inc. Cd19/cd38 multispecific antibodies
US12173081B2 (en) 2023-03-21 2024-12-24 Biograph 55, Inc. CD19/CD38 multispecific antibodies
WO2024240562A1 (en) 2023-05-19 2024-11-28 Neurimmune Ag Novel immunotherapy for musculoskeletal disorders and conditions
WO2025104243A1 (en) 2023-11-15 2025-05-22 Neurimmune Ag Anti-transthyretin antibody, compositions comprising said antibody and methods for treating or preventing transthyretin-mediated amyloidosis
WO2025125544A1 (en) 2023-12-15 2025-06-19 Novo Nordisk A/S Stable liquid formulations
WO2025238147A1 (en) 2024-05-15 2025-11-20 Neurimmune Ag Maintenance treatment of cardiac ttr amyloidosis using anti-transthyretin antibodies

Also Published As

Publication number Publication date
CU20170097A7 (es) 2018-03-13
SG10202101763VA (en) 2021-04-29
AU2016210888B2 (en) 2021-11-04
SG11201706124VA (en) 2017-08-30
EA036080B1 (ru) 2020-09-23
ZA201705663B (en) 2018-08-29
US20160251418A1 (en) 2016-09-01
KR20170106469A (ko) 2017-09-20
SA517382002B1 (ar) 2021-11-25
HRP20221538T1 (hr) 2023-03-03
NZ733896A (en) 2024-11-29
EP3250592A1 (en) 2017-12-06
JP6748086B2 (ja) 2020-09-02
PH12017501318A1 (en) 2018-02-05
EA201791712A1 (ru) 2017-12-29
SI3250592T1 (sl) 2023-03-31
CA2974912A1 (en) 2016-08-04
RS63906B1 (sr) 2023-02-28
TWI786505B (zh) 2022-12-11
DK3250592T3 (en) 2023-01-09
JP2018506277A (ja) 2018-03-08
PT3250592T (pt) 2022-12-28
TWI718122B (zh) 2021-02-11
HUE060878T2 (hu) 2023-04-28
KR102677203B1 (ko) 2024-06-20
CN107406499B (zh) 2021-10-22
CL2017001924A1 (es) 2018-04-27
EP4134379A1 (en) 2023-02-15
CL2022003027A1 (es) 2023-06-09
PL3250592T3 (pl) 2023-06-19
IL253633B (en) 2021-06-30
JP7028923B2 (ja) 2022-03-02
BR112017016330A2 (pt) 2018-04-03
TW201632554A (zh) 2016-09-16
LT3250592T (lt) 2023-02-10
MX2017009806A (es) 2018-08-15
PE20180217A1 (es) 2018-01-31
IL253633A0 (en) 2017-09-28
ES2934656T3 (es) 2023-02-23
KR102598180B1 (ko) 2023-11-03
MX394170B (es) 2025-03-24
PH12017501318B1 (en) 2018-02-05
AU2016210888C1 (en) 2022-06-02
TW202124436A (zh) 2021-07-01
AU2016210888A1 (en) 2017-08-10
UA122142C2 (uk) 2020-09-25
CN107406499A (zh) 2017-11-28
CU24480B1 (es) 2020-03-04
CO2017008476A2 (es) 2018-01-16
FI3250592T3 (fi) 2023-01-13
KR20230156164A (ko) 2023-11-13
EP3250592B1 (en) 2022-10-05
JP2020185009A (ja) 2020-11-19

Similar Documents

Publication Publication Date Title
US20240141025A1 (en) Anti-transthyretin antibodies
EP3250592B1 (en) Anti-transthyretin antibodies
EP3250593B1 (en) Anti-transthyretin antibodies
EP3250594B1 (en) Anti-transthyretin antibodies
US10906967B2 (en) Anti-transthyretin antibodies
US11267878B2 (en) Anti-transthyretin antibodies
WO2018007922A2 (en) Anti-transthyretin antibodies
WO2018007923A2 (en) Anti-transthyretin antibodies
WO2018007924A2 (en) Anti-transthyretin antibodies
HK40086865A (en) Anti-transthyretin antibodies
HK1240248A1 (en) Anti-transthyretin antibodies
HK1240248B (en) Anti-transthyretin antibodies
HK1240249B (en) Anti-transthyretin antibodies
HK1240247A1 (en) Anti‐transthyretin antibodies
HK1240247B (en) Anti‐transthyretin antibodies

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16702812

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 12017501318

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 253633

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2974912

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017539650

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 001287-2017

Country of ref document: PE

REEP Request for entry into the european phase

Ref document number: 2016702812

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 11201706124V

Country of ref document: SG

Ref document number: MX/A/2017/009806

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016210888

Country of ref document: AU

Date of ref document: 20160128

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2017/0008476

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20177023749

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201791712

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201708667

Country of ref document: UA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017016330

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112017016330

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170728

WWG Wipo information: grant in national office

Ref document number: 733896

Country of ref document: NZ