WO2016110576A1 - Bispecific antibodies against cd3 and cd20 - Google Patents
Bispecific antibodies against cd3 and cd20 Download PDFInfo
- Publication number
- WO2016110576A1 WO2016110576A1 PCT/EP2016/050296 EP2016050296W WO2016110576A1 WO 2016110576 A1 WO2016110576 A1 WO 2016110576A1 EP 2016050296 W EP2016050296 W EP 2016050296W WO 2016110576 A1 WO2016110576 A1 WO 2016110576A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- region
- set forth
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to bispecific antibodies directed to CD3 and CD20 and to uses of such bispecific antibodies, in particular use thereof in the treatment of diseases in which specific targeting and T cell-mediated killing of cells that express CD20 is desired .
- CD3 has been known for many years and therefore has been subject of interest in many aspects. Specifically antibodies raised against CD3 or the T-cell Receptor Complex, which CD3 is part of, are known . An in vitro characterization of five humanized OKT3 effector function variant antibodies has been described (Xu et al. , 2000, Cell Immunol. 200( l) : 16-26) .
- Treatment with the anti-CD3 monoclonal antibody hOKT3gammal(Ala-Ala) results in improved C-peptide responses and clinical parameters for at least 2 years after onset of type 1 diabetes in absence of continued immunosuppressive medications (Herold et al. , 2005, Diabetes, 54(6) : 1763-9) .
- CD3 antibodies cross-reactive to cynomolgus and/or rhesus monkey CD3 have been described (WO2012162067, WO2008119567) .
- the CD20 molecule (also called human B-lymphocyte-restricted differentiation antigen or Bp35) is a hydrophobic transmembrane protein with a molecular weight of approximately 35 kD located on pre-B and mature B lymphocytes (Valentine et al. ( 1989) J . Biol. Chem. 264( 19) : 11282- 11287; and Einfield et al., ( 1988) EMBO J . 7(3) : 711-717) .
- CD20 is found on the surface of greater than 90% of B cells from peripheral blood or lymphoid organs and is expressed during early pre-B cell development and remains until plasma cell differentiation. CD20 is present on both normal B cells as well as malignant B cells.
- CD20 is expressed on greater than 90% of B cell non-Hodgkin's lymphomas (NHL) (Anderson et al. (1984) Blood 63(6) : 1424-1433), but is not found on hematopoietic stem cells, pro-B cells, normal plasma cells, or other normal tissues (Tedder et al. (1985) J. Immunol. 135(2) :973-979).
- NHL B cell non-Hodgkin's lymphomas
- the chimeric CD20 antibody rituximab has been used for or suggested for use in treating cancers such as non-Hodgkin's lymphoma (NHL), chronic lymphocytic leukemia (CLL) and small lymphocytic lymphoma (SLL).
- the human monoclonal CD20 antibody ofatumumab has been used for or suggested for use in treating among others various CLL indications, follicular lymphoma (FL), neuromyelitis optica (NMO), diffuse and relapsing-remitting multiple sclerosis (RRMS).
- the human monoclonal CD20 antibody obinutuzumab has been used for or suggested for use in treating CLL.
- the humanized CD20 antibody ocrelizumab is being developed for RRMS.
- WO2011090762 describes the generation of a CD3xCD20 polypeptide heterodimer.
- WO2011028952 describes amongst others the generation of CD3xCD20 bispecific molecules using Xencor's XmAb bispecific Fc domain technology.
- WO2014047231 describes REGN 1979 and other CD3xCD20 bispecific antibodies generated using the FcAAdp technology from Regeneron Pharmaceuticals.
- Bispecific antibodies that bind to both CD3 and CD20 may be useful in therapeutic settings in which specific targeting and T cell-mediated killing of cells that express CD20 is desired, and there is still a need for further efficient CD3xCD20 bispecific antibodies.
- the novel CD3xCD20 bispecific antibodies are useful in therapeutic settings in which specific targeting and T cell-mediated killing of cells that express CD20 is desired .
- the novel CD3xCD20 bispecific antibodies are highly efficient in killing CD20 expressing cells, including cells with low CD20 copy numbers, and have been shown to be highly potent in eradicating tumor cells in animal models.
- the novel CD3xCD20 bispecific antibodies are advantageous by inducing rapid and strong killing of cells at low dosing .
- the novel CD3xCD20 bispecific antibodies are furthermore capable of inducing cytotoxicity by both CD4 + T cells and CD8 + T cells which makes them suitable for engaging T cells for killing CD20 positive tumors and other diseases involving CD20 positive cells.
- the CD3xCD20 bispecific antibodies are efficient in depleting B cells from lymphoid structures. Accordingly, it is an object of the present invention to provide a bispecific CD3xCD20 antibody which is capable of inducing cytotoxicity by both CD4 + T cells and CD8 + T cells. It is a further object of the present invention to provide a bispecific CD3xCD20 antibody which is highly efficient in killing CD20 expressing cells such as CD20 expressing tumor cells. It is a further object of the present invention to provide a bispecific CD3xCD20 antibody which is highly efficient in killing CD20 expressing cancers.
- Figu re 1 Bind ing of bispecif ic CD3 x CD20 a nt ibod ies to Daud i ( A- F) a nd Ju rkat ( G- l ) ce lls.
- FEALxCD20-RTX-FEAR bsIgGl-huCD3-H 1L1-FEALXCD20-11B8-FEAR, bsIgGl-huCD3-HlLl- FEALxCD20-2C6-FEAR, bsIgGl-huCD3-HlLl-FEALxbl2-FEAR and monospecific, bivalent IgGl-huCD3-HlLl-FEAL to Jurkat cells (I) Binding of bsIgGl-huCLB-T3/4-FEALxCD20-7D8- FEAR, bsIgGl-huCLB-T3/4-FEALxCD20-2F2-FEAR.
- Figure 2 Concentration-dependent simultaneous binding of bsl gG1 -huCD3- H1 L1-FEALxCD20-7D8-FEAR (CD3xCD20) to T cells and B cells. Simultaneous binding of the bispecific antibody bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR (CD3xCD20) to B and T cells in blood was analyzed by flow cytometry. Data shown are from one representative experiment.
- Data shown are the number of double-positive (CD19 and CD4 [A] or CD19 and CD8 [B]) events, as determined by the number of events in the upper right quadrant of the CD4/CD19 or the CD8/CD19 flow cytometry dot-plot. Closed and open symbols indicate data from different healthy donors. IgGl-2F2 (2F2, CD20-specific) and bsIgGl-huCD3- HlLl-FEALxbl2-FEAR (CD3xbl2, CD3-specific) were included as negative control antibodies.
- FIG. 3 Induction of cytotoxicity in vitro by CD3xCD20 bispecific antibodies in human B-cell lymphoma and B cell leukemia cell Iines.
- Daudi cells were incubated with bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR (CD3x7D8), bsIgGl- huCD3-HlLl-FEALxCD20-HB8-FEAR (CD3xllB8), the monospecific CD20 antibodies IgGl- 7D8 (7D8), IgGl-7D8-FEAR (7D8-FEAR; with inactive Fc region), IgGl-llB8-F405L or IgGl-llB8-FEAR (11B8-FEAR; with inactive Fc region), and the bispecific control antibody bsIgGl-huCD3-HlLl-FEALxbl2-FEAR (CD3xbl2) PBMCs were used as effect
- B Daudi cells were incubated with BsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR (CD3x7D8), the monospecific CD20 antibody IgGl-7D8-FEAR (7D8-FEAR; with inactive Fc region) and bsIgGl-huCD3-HlLl-FEALxbl2-FEAR (CD3xbl2), purified T cells were used as effector cells.
- CD3xCD20 bispecific antibodies were incubated with CD3xCD20 bispecific antibodies based on two different CD3 arms (huCD3-HlLl-FEAL and huCLB-T3/4-FEAL Fab arm, represented by open and closed symbols, respectively) and four different CD20 arms: 7D8 (BsIgGl-huCD3-HlLl- FEALxCD20-7D8-FEAR and BsIgGl-huCLB-T3/4-FEALxCD20-7D8-FEAR; [C]), 11B8 (BsIgGl-huCD3-HlLl-FEALxCD20-llB8-FEAR and BsIgGl-huCLB-T3/4-FEALxCD20-llB8- FEAR; [D]), GA101 (BsIgGl-huCD3-HlLl-FEALxCD20-GA101-FEAR and BsIgGl-huCLB- T3
- CD3xCD20 bispecific antibodies contained the huCD3-HlLl-FEAL Fab arm and different CD20 Fab arms (7D8, 11B8, 2F2, GA101 or RTX) as indicated.
- CD3 antibody alone was IgGl-huCD3-HlLl. Purified T cells were used as effector cells.
- Daudi cells were incubated with bsIgGl-huCD3-HlLl- FEALxCD20-7D8-FEAR (CD3x7D8), bsIgGl-huCD3-H 1L1-FEALXCD20-2C6-FEAR (CD3x2C6) and bsIgGl-huCD3-HlLl-FEALxbl2-FEAR (CD3xbl2), purified T cells were used as effector cells. Data shown are mean percentages specific lysis ⁇ S.D of triplicate wells and data for each graph were obtained from one representative experiment.
- Figure 4 Dose-dependent induction of cytotoxicity in vitro by bslgGI- huCD3-H1 L1-FEALxCD20-7D8-FEAR using purified total T cells (CD3 + ), CD4 + T cells (CD3 + CD8 ) and CD8 + T cells (CD3 + CD8 + ) as effector cells.
- Daudi cells were incubated with the different T-cell subsets, as indicated, and a dilution series of bsIgGl-huCD3-HlLl- FEALxCD20-7D8-FEAR or the control antibodies IgGl-huCD3-HlLl-FEALxbl2-FEAR and IgGl-7D8-FEAR (data not shown).
- Data shown are mean percentages of tumor cell lysis ⁇ S.E.M. of triplicate wells (A, B).
- FIG. 5 Kinetics of bsl gG1 -huCLB-T3/ 4- FEALxCD20-7D8- FEAR- dependent cytoxicity in Daudi cells.
- Daudi cells were incubated with bsIgGl-huCLB-T3/4- FEALxCD20-7D8-FEAR in presence of purified T cells isolated from two different donors (A and B). Cytotoxicity was assessed after 4, 12, 24, 48 and 72 hours of incubation (A) or after 3, 16 and 24 hours of incubation (B). Data shown are percentages cell kill ⁇ S.D.
- CD3xCD20 bispecific antibodies included bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR (A), bsIgGl-huCD3-HlLl- FEALxCD20-l 1B8-FEAR (B), bsIgGl-huCD3-HlLl-FEALxCD20-GA101-FEAR (C), bsIgGl- huCD3-HlLl-FEALxCD20-RTX-FEAR (D) and bsIgGl-huCD3-HlLl-FEALxCD20-2F2-FEAR (E).
- A bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR
- B bsIgGl-huCD3-HlLl-FEALxCD20-l 1B8-FEAR
- B bsIgGl-huCD3
- bsIGl-huCLB-T3/4-FEALxbl2-FEAR was included at an E/T ratio of 10:1.
- Data shown are mean percentages lysis ⁇ S.D. of triplicate wells as determined in a cytotoxicity assay for one representative experiment. Each line represents a different E/T ratio (as indicated).
- Figure 7 Cytotoxic activivity of CD3xCD20 bispecific antibodies in the Raji- luc co-engraftm ent model in NOD-SCI D mice.
- A Average tumor size in mice that were treated with vehicle (PBS) or bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR at the indicated doses. Error bars indicate S.E.M.
- B Tumor size in individual mice after treatment with PBS or bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR on day 21 after tumor inoculation. Statistical analysis of data at day 21 was performed using Kruskal Wallis (Dunn's multiple comparison as post-test).
- E Tumor size in individual mice in the different treatment groups on day 25 after tumor inoculation. Statistical analysis was performed using Kruskal Wallis test (Dunn's multiple comparison as post-test) (F) Kaplan- Meier plots with tumorsize cut-off set at 500 mm 3 . Statistical significance of differences between treatment groups and the vehicle control group was analysed by Mantel Cox analysis. *p ⁇ 0.05, ** p ⁇ 0.01, n.s. not significant.
- G Average tumor size in mice that were treated with vehicle (PBS), bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR or bsIgGl- huCD3-HlLl-FEALxCD20-HB8-FEAR at the indicated doses. Error bars indicate S.E.M.
- H Tumor size in individual mice after treatment with PBS, or bsIgGl-huCD3-HlLl- FEALxCD20-7D8-FEAR or bsIgGl-huCD3-HlLl-FEALxCD20-HB8-FEAR on day 20 after tumor inoculation.
- Figure 8 Anti-tumor activity of bsl gG1 -huCD3-H1 L1 -FEALxCD20-7D8-FEAR in a Daudi-luc xenograft model in HIS mice.
- A Average tumor size in the Daudi-luc xenograft model in BRGS-HIS mice after treatment with PBS (vehicle control), bsIgGl- huCD3-HlLl-FEALxCD20-7D8-FEAR (mAb2) or the control bispecific antibody bsIgGl- huCD3-HlLl-FEALxbl2-FEAR (mAbl) at the indicated dose levels. Tumor burden was assessed by bioluminescence imaging.
- Figure 9 Study of effects of a single dose of bsl gG1 -huCD3-H1 L1 -FEALxCD20- 7D8-FEAR in cynomolgus monkeys.
- B-cell counts CD19 + CD21 + cells
- T-cell counts CD4 + plus CD8 + cells
- Days -18 and -11 show pre-dose B- and T-cell counts.
- the dotted line shows the predicted pharmacokinetic profile of IgGl, using a two-compartment model, with ki 0 (clearance constant) at 0.006 h "1 , Vc (plasma volume) 40 mL-kg "1 and 3.5 kg bodyweight.
- FIG. 10 Binding of bispecific CD3xCD20 antibodies to wild type CD20 and CD20- AxP expressed in HEK293F cells. Binding of CD3xCD20 bispecific antibodies (bsIgGl- huCD3-HlLl-FEALxCD20-7D8-FEAR [huCD3x7D8], bsIgGl-huCLB-T3/4-FEALxCD20-7D8- FEAR [huCLB-T3/4x7D8], bsIgGl-huCD3-HlLl-FEALxCD20-2F2-FEAR [huCD3x2F2], bsIgGl-huCLB-T3/4-FEALxCD20-2F2-FEAR [huCLB-T3/4x2F2], bsIgGl-huCD3-HlLl- FEALxCD20-l 1B8-FEAR [huCD3xllB8], b
- FEALxCD20-2C6-FEAR [huCD3x2C6]) to wild type CD20 (A) and CD20 mutant (CD20-AxP) (B) expressed in HEK293F cells was measured by flow cytometry. Data shown are mean fluorescence intensities of one representative experiment.
- Figure 11 T cell activation upon incubation of PBMC with bsl gG1 -huCD3-H1 L1 - FEALxCD20-7D8- FEAR.
- Healthy donor PBMC were incubated with bsIgGl-huCD3-HlLl-FEALxCD20-7D8-FEAR or positive and negative control antibodies, and T cell activation was assessed by measuring CD69 expression within the T cell population (CD28 + cells).
- T cell activation was assessed by measuring CD69 expression within the T cell population (CD28 + cells).
- CD3s DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGS
- SEQ ID NO: 70 IgGl heavy chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region - NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC F405L NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVF
- Xi is selected from V, H, F, T, P, L, Q, D, K, W,
- X 2 is selected from S, N, G, A, K, V, R, H, Q, P,
- X 3 is selected from F, H, N, M, W, G, Q, V, T,
- X 4 is selected from S, Y, Q, W, L, A, I, M, D, T,
- X 5 is selected from N, L, Y, W, H, M, G, F, K,
- X 6 is selected from A, S, V, N, K, L, T, I, P, Q,
- X 7 is selected from P, Q, A, Y, H, I, N, V, E, L,
- X 8 is selected from A, T, G, L, N, C, P, F, Q, H,
- X 9 is selected from H, S, F, N, W, T, C, A, I, L,
- Xi 0 is selected from S, A, G, R, V, F, I, E, M,
- Xn is selected from C, F, Y, I, T, V, M, A, S, N,
- X 12 is selected from D, K, Q, R, G, V, E, T, N,
- the CDR regions have been annotated according to the IMGT definitions.
- human CD3 refers to the human Cluster of Differentiation 3 protein which is part of the T-cell co-receptor protein complex and is composed of four distinct chains. CD3 is also found in other species, and thus, the term “CD3” may be used herein and is not limited to human CD3 unless contradicted by context.
- the complex contains a CD3y (gamma) chain (human CD3y chain UniProtKB/Swiss-Prot No P09693, or cynomolgus monkey CD3y UniProtKB/Swiss-Prot No Q95LI7), a CD36 (delta) chain (human CD36 UniProtKB/Swiss-Prot No P04234, or cynomolgus monkey CD36 UniProtKB/Swiss-Prot No Q95LI8), two CD3s (epsilon) chains (human CD3s UniProtKB/Swiss-Prot No P07766; cynomolgus CD3s UniProtKB/Swiss-Prot No Q95LI5; or rhesus CD3s UniProtKB/Swiss-Prot No G7NCB9), and a ⁇ 3 ⁇ - ⁇ ⁇ 3 ⁇ (zeta) chain (human CD3 ⁇ UniProtKB/Swis) chain
- human CD20 refers to human CD20 (UniProtKB/Swiss-Prot No P11836) and includes any variants, isoforms and species homologs of CD20 which are naturally expressed by cells, including tumor cells, or are expressed on cells transfected with the CD20 gene or cDNA.
- Species homologs include rhesus monkey CD20 (macaca mulatta; UniProtKB/Swiss-Prot No H9YXP1).
- chimeric antibody refers to an antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human.
- Chimeric antibodies may be generated by antibody engineering.
- Antibody engineering is a term used generic for different kinds of modifications of antibodies, and which is a well-known process for the skilled person.
- a chimeric antibody may be generated by using standard DNA techniques as described in Sambrook et al., 1989, Molecular Cloning : A laboratory Manual, New York: Cold Spring Harbor Laboratory Press, Ch. 15.
- the chimeric antibody may be a genetically or an enzymatically engineered recombinant antibody.
- Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody immunogenicity. They may typically contain non-human (e.g. murine) variable regions, which are specific for the antigen of interest, and human constant antibody heavy and light chain domains.
- variable region or “variable domains” as used in the context of chimeric antibodies, refers to a region which comprises the CDRs and framework regions of both the heavy and light chains of the immunoglobulin.
- humanized antibody refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains. This can be achieved by grafting of the six non-human antibody complementarity- determining regions (CDRs), which together form the antigen binding site, onto a homologous human acceptor framework region (FR) (see W092/22653 and EP0629240). In order to fully reconstitute the binding affinity and specificity of the parental antibody, the substitution of framework residues from the parental antibody (i.e. the non-human antibody) into the human framework regions (back-mutations) may be required.
- CDRs complementarity- determining regions
- FR homologous human acceptor framework region
- a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and fully human constant regions.
- additional amino acid modifications which are not necessarily back-mutations, may be applied to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties.
- human antibody refers to antibodies having variable and constant regions derived from human germline immunoglobulin sequences. Human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term “human antibody”, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- Human monoclonal antibodies of the invention can be produced by a variety of techniques, including conventional monoclonal antibody methodology, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature 256: 495 (1975). Although somatic cell hybridization procedures are preferred, in principle, other techniques for producing monoclonal antibody can be employed, e.g., viral or oncogenic transformation of B-lymphocytes or phage display techniques using libraries of human antibody genes.
- a suitable animal system for preparing hybridomas that secrete human monoclonal antibodies is the murine system.
- Hybridoma production in the mouse is a very well established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners ⁇ e.g., murine myeloma cells) and fusion procedures are also known.
- Human monoclonal antibodies can be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
- immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds.
- L light
- H heavy
- each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as V H or VH) and a heavy chain constant region (abbreviated herein as C H or CH).
- the heavy chain constant region typically is comprised of three domains, C H 1, C H 2, and C H 3.
- Each light chain typically is comprised of a light chain variable region (abbreviated herein as V L or VL) and a light chain constant region (abbreviated herein as C L or CL).
- the light chain constant region typically is comprised of one domain, Q_.
- the V H and V L regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
- CDRs complementarity determining regions
- Each V H and V L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J. Mol. Biol. 196, 901-917 (1987)).
- CDR sequences herein are identified according to IMGT rules (Brochet X., Nucl Acids Res. 2008;36 :W503-508 and Lefranc MP., Nucleic Acids Research 1999;27: 209-212; see also internet http address http://www.imgt.org/).
- antibody in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an effector activity).
- variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as Clq, the first component in the classical pathway of complement activation.
- the term antibody herein unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that are antigen-binding fragments, i. e. , retain the ability to specifically bind to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody.
- antigen- binding fragments encompassed within the term "antibody” include (i) a Fab' or Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H 1 domains, or a monovalent antibody as described in WO2007059782 (Genmab); (ii) F(ab') 2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting essentially of the V H and C H 1 domains; (iv) a Fv fragment consisting essentially of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 341 , 544-546 (1989)), which consists essentially of a V H domain and also called domain antibodies (Holt et al; Trends Biotechnol.
- V L and V H camelid or nanobodies
- CDR complementarity determining region
- Such single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. These and other useful antibody fragments in the context of the present invention, as well as bispecific formats of such fragments, are discussed further herein.
- antibody also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, and antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
- mAbs monoclonal antibodies
- antibody-like polypeptides such as chimeric antibodies and humanized antibodies
- antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
- An antibody as generated can possess any isotype.
- bispecific antibody in the context of the present invention refers to an antibody having two different antigen-binding regions defined by different antibody sequences.
- Fab-arm or “arm” refers to one heavy chain-light chain pair and is used interchangeably with “half molecules” herein.
- Fc region refers to an antibody region comprising at least a hinge region, a CH2 domain, and a CH3 domain.
- isotype refers to the immunoglobulin class (for instance IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) that is encoded by heavy chain constant region genes.
- monovalent antibody means in the context of the present invention that an antibody molecule is capable of binding a single molecule of the antigen, and thus is not capable of antigen crosslinking.
- CD20 antibody or "anti-CD20 antibody” is an antibody as described above, which binds specifically to the antigen CD20.
- CD3 antibody or "anti-CD3 antibody” is an antibody as described above, which binds specifically to the antigen CD3, in particular human CD3s (epsilon).
- CD3xCD20 antibody or "anti-CD3xCD20 antibody” is a bispecific antibody, which comprises two different antigen-binding regions, one of which binds specifically to the antigen CD20 and one of which binds specifically to CD3.
- the bispecific antibody of the invention is isolated.
- An "isolated bispecific antibody,” as used herein, is intended to refer to a bispecific antibody which is substantially free of other antibodies having different antigenic specificities (for instance an isolated bispecific antibody that specifically binds to CD20 and CD3 is substantially free of monospecific antibodies that specifically bind to CD20 or CD3).
- epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- the epitope may comprise amino acid residues directly involved in the binding and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked or covered by the specifically antigen binding peptide (in other words, the amino acid residue is within the footprint of the specifically antigen binding peptide).
- the term "monoclonal antibody” as used herein refers to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
- the human monoclonal antibodies may be generated by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
- binding in the context of the binding of an antibody to a predetermined antigen or epitope typically is a binding with an affinity corresponding to a K D of about 10 "7 M or less, such as about 10 "8 M or less, such as about 10 "9 M or less, about 10 "10 M or less, or about 10 "11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the antibody as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
- a non-specific antigen e.g., BSA, casein
- the amount with which the affinity is lower is dependent on the K D of the antibody, so that when the K D of the antibody is very low (that is, the antibody is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold.
- k d (sec 1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k off value.
- K D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction.
- heterodimeric interaction between the first and second CH3 regions refers to the interaction between the first CH3 region and the second CH3 region in a first-CH3/second-CH3 heterodimeric protein.
- homodimeric interactions of the first and second CH3 regions refers to the interaction between a first CH3 region and another first CH3 region in a first-CH3/first-CH3 homodimeric protein and the interaction between a second CH3 region and another second CH3 region in a second-CH3/second-CH3 homodimeric protein.
- reducing conditions or “reducing environment” refers to a condition or an environment in which a substrate, here a cysteine residue in the hinge region of an antibody, is more likely to become reduced than oxidized.
- the present invention also provides bispecific antibodies comprising functional variants of the V L regions, V H regions, or one or more CDRs of the bispecific antibodies of the examples.
- a functional variant of a V L , V H , or CDR used in the context of a bispecifc antibody still allows each arm of the bispecific antibody to retain at least a substantial proportion (at least about 50%, 60%, 70%, 80%, 90%, 95% or more) of the affinity and/or the specificity/selectivity of the parent bispecific antibody and in some cases such a bispecific antibody may be associated with greater affinity, selectivity and/or specificity than the parent bispecific antibody.
- the percent identity between two nucleotide or amino acid sequences may e.g. be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci 4, 11-17 (1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM 120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences may be determined using the Needleman and Wunsch, J. Mol. Biol. 48, 444-453 (1970) algorithm.
- Exemplary variants include those which differ from VH and/or VL and/or CDR regions of the parent bispecific antibody sequences mainly by conservative substitutions; for instance 10, such as 9, 8, 7, 6, 5, 4, 3, 2 or 1 of the substitutions in the variant are conservative amino acid residue replacements.
- conservative substitutions may be defined by substitutions within the classes of amino acids reflected in the following table:
- substitution of an amino acid in a given position is written as e.g. K409R which means a substitution of a Lysine in position 409 with an Arginine; and ii) for specific variants the specific three or one letter codes are used, including the codes Xaa and X to indicate any amino acid residue.
- K409R substitution of Lysine with Arginine in position 409
- K409X substitution of Lysine with any amino acid residue in position 409
- deletion of Lysine in position 409 it is indicated by K409*.
- Recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which an expression vector has been introduced, e.g. an expression vector encoding an antibody of the invention.
- Recombinant host cells include, for example, transfectomas, such as CHO, CHO-S, HEK, HEK293, HEK-293F, Expi293F, PER.C6 or NS0 cells , and lymphocytic cells.
- treatment refers to the administration of an effective amount of a therapeutically active bispecific antibody of the present invention with the purpose of easing, ameliorating, arresting or eradicating (curing) symptoms or disease states.
- an effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.
- a therapeutically effective amount of a bispecific antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the bispecifc antibody to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.
- anti-idiotypic antibody refers to an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody.
- the invention relates to a bispecific antibody comprising two different antigen-binding regions, one which has a binding specificity for CD3 and one which has a binding specificity for CD20.
- the invention relates to a bispecific antibody comprising (i) a first binding arm comprising a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- bispecific antibodies with variying binding affinities for CD3 epsilon are provided.
- the bindning affinity for CD3 is lower than it is for the parent anti-CD3 binding arm.
- Experimental data have shown that bispescific CD3xCD20 antibodies as described above in c) to i) having an anti-CD3 binding arm with a substitution which lower the binding affinity for CD3 epsilon maintains the tumor killing potency of the parent bispecific anti-CD3xCD20 antibody.
- the invention relates to a bispecific antibody comprising (i) a first binding arm comprising a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises (a) heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 or SEQ ID NO : 54, respectively, or (b) heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: 55, 56 and 57, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO : 58, the sequence DTS
- the invention relates to a bispecific antibody comprising a first binding arm comprising a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5, respectively.
- binding arm comprising an antigen-binding region means an antibody molecule or fragment that comprises an antigen-binding region.
- binding arm can be e.g. the six VH and VL CDR regions, the VH and VL sequences, the Fab fragment or a half- molecule antibody (i.e. comprising one heavy and one light chain).
- the first antigen-binding region comprises a first heavy chain variable sequence (VH), and a first light chain variable sequence (VL)
- the second antigen-binding region comprises a second heavy chain variable sequence (VH), and a second light chain variable sequence (VL).
- the first binding arm comprises a first heavy chain comprising a first heavy chain variable sequence (VH) and a first heavy chain constant sequence (CH), and a first light chain comprising a first light chain variable sequence (VL) and a first light chain constant sequence (CL), and (ii) the second binding arm comprises a second heavy chain comprising a second heavy chain variable sequence (VH) and a second heavy chain constant sequence (CH), and a second light chain comprising a second light chain variable sequence (VL) and a second light chain constant sequence (CL).
- the bispecific antibody is a full length antibody, such as a full length IgGl antibody, e.g. a full length IgGl,A (lambda), ⁇ (kappa) antibody or IgGl,K (kappa), ⁇ (kappa) antibody.
- a full length IgGl antibody e.g. a full length IgGl,A (lambda), ⁇ (kappa) antibody or IgGl,K (kappa), ⁇ (kappa) antibody.
- the first binding arm comprises a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- CDRl heavy chain variable region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: 74, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5, wherein X 3 of SEQ ID NO : 74 is A;
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- CDRl heavy chain variable
- CDR2 and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 78, respectively
- VL light chain variable
- CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4 the sequence GTN, and the sequence as set forth in SEQ ID NO : 5, wherein X 7 of SEQ ID NO :78 is P;
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- CDR2 heavy chain variable
- VL light chain variable
- the first binding arm comprises a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises (a) heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 or SEQ ID NO : 54, respectively, or (b) heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: 55, 56 and 57, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO : 58, the sequence DTS, and the sequence as set forth in SEQ ID NO: 59, respectively
- the first binding arm comprises a first antigen-binding region binding to human CD3s (epsilon), wherein said first antigen-binding region comprises heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO: 5, respectively.
- VH heavy chain variable
- CDR2 heavy chain variable
- CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively
- VL light chain variable
- the six CDR sequences as defined in (a) above are derived from a mouse antibody denoted SP34. Humanized versions of this antibody have been generated, and the humanized antibodies are denoted huCD3 herein and are further disclosed in WO2015001085 (Genmab).
- huCLB-T3/4 is a humanized version of the murine CD3 antibody CLB-T3/4 (Parren et al., Res Immunol. 1991, 142(9) : 749-63, hereby incorporated by reference in its entirety, including sequence disclosures). Briefly, the CLB-T3/4 murine VH and VL sequences as published in Parren et al. (1991) were aligned to the human VH and VL repertoires using the IMGT's V-QUEST.
- the closest human germlines that were found were IGHV3-21*01 for the VH gene and IGKV3-11*01(+IGKJ4*02) for the VL gene. All amino acid residues in the murine VH and VL sequences that differed were replaced by the human equivalent, except for those within the CDR regions of CLB-T3/4. As no related J-region was found for the VH sequence, the common WGQGTLVTVSS sequence was used for the FR4 region of the heavy chain. Both sequences were cloned into the relevant expression vectors and expressed by cotransfection in HEK293F cells.
- huCLB-T3/4 has a VH region comprising the sequence set forth in SEQ ID NO: 17 (VH huCLB-T3/4) and a VL region comprising the sequence set forth in SEQ ID NO : 18 (VL huCLB-T3/4).
- huCLB-T3/4 has the VH CDRl, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 55, 56 and 57, respectively, and the VL CDRl, CDR2 and CDR3 sequences set forth in SEQ ID NO : 58, the sequence DTS, and the sequence set forth in SEQ ID NO : 59, respectively.
- the various humanized huCD3 antibodies and huCLB-T3/4 bind to human CD3s (epsilon).
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first heavy chain variable sequence (VH), wherein said VH sequence has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in the VH sequences selected from the group consisting of:
- the VH sequence of the first antigen-binding region is selected from the group consisting of:
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first VL sequence of the first antigen-binding region, wherein said VL sequence has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in the VL sequences selected from the group consisting of:
- the VL sequence of the first antigen-binding region is selected from the group consisting of:
- VL sequence as set forth in SEQ ID NO : 10;
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first VH and VL sequences, wherein said VH and VL sequences of the first antigen-binding region are selected from the group consisting of:
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first VH and VL sequences, wherein said VH and VL sequences of the first antigen-binding region are selected from the group consisting of:
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first VH and VL sequences as set forth in SEQ ID Nos: 17 and 18.
- the bispecific antibody as defined in any of the embodiments disclosed comprises a first antigen-binding region having at least 90% sequence identity to the VH sequence is as set forth in SEQ ID NO: 6, and at least 90% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10.
- sequence deviations are in the framework sequences and not in the CDR sequences.
- the invention relates to a bispecific antibody comprising a first antigen-binding region having at least 90% sequence identity to the VH sequence is as set forth in SEQ ID NO : 6, and at least 90% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10 wherein the CDR sequences are as set forth in SEQ ID NOs: l, 2, and 3, for the heavy chain and as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 for the light chain so that the CDR sequences are unmutated.
- the bispecific antibody as defined in any of the embodiments disclosed comprises a first antigen-binding region having at least 95% sequence identity to the VH sequence is as set forth in SEQ ID NO: 6, and at least 95% sequence identity to the VL sequence is as set forth in SEQ ID NO: 10.
- the invention relates to a bispecific antibody comprising a first antigen-binding region having at least 95% sequence identity to the VH sequence is as set forth in SEQ ID NO : 6, and at least 95% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10 wherein the CDR sequences are as set forth in SEQ ID NOs: l, 2, and 3, for the heavy chain and as set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 for the light chain so that the CDR sequences are unmutated.
- the bispecific antibody as defined in any of the embodiments disclosed comprises a first antigen-binding region having at least 97% sequence identity to the VH sequence is as set forth in SEQ ID NO: 6, and at least 97% sequence identity to the VL sequence is as set forth in SEQ ID NO: 10.
- the invention relates to a bispecific antibody comprising a first antigen-binding region having at least 97% sequence identity to the VH sequence is as set forth in SEQ ID NO : 6, and at least 97% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10 wherein the CDR sequences are as set forth in SEQ ID NOs: l, 2, and 3, for the heavy chain and as set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 for the light chain so that the CDR sequences are unmutated.
- the bispecific antibody as defined in any of the embodiments disclosed comprises a first antigen-binding region having at least 98% sequence identity to the VH sequence is as set forth in SEQ ID NO: 6, and at least 98% sequence identity to the VL sequence is as set forth in SEQ ID NO: 10.
- the invention relates to a bispecific antibody comprising a first antigen-binding region having at least 98% sequence identity to the VH sequence is as set forth in SEQ ID NO : 6, and at least 98% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10 wherein the CDR sequences are as set forth in SEQ ID NOs: l, 2, and 3, for the heavy chain and as set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 for the light chain so that the CDR sequences are unmutated.
- the bispecific antibody as defined in any of the embodiments disclosed comprises a first antigen-binding region having at least 99% sequence identity to the VH sequence is as set forth in SEQ ID NO: 6, and at least 99% sequence identity to the VL sequence is as set forth in SEQ ID NO: 10.
- the invention relates to a bispecific antibody comprising a first antigen-binding region having at least 99% sequence identity to the VH sequence is as set forth in SEQ ID NO : 6, and at least 99% sequence identity to the VL sequence is as set forth in SEQ ID NO : 10 wherein the CDR sequences are as set forth in SEQ ID NOs: l, 2, and 3, for the heavy chain and as set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ ID NO : 5 for the light chain so that the CDR sequences are unmutated.
- VH and VL sequences may vary within at least 90% sequence identity to the parent sequences. It is preferred that the variants have the same properties as the parent antibodies. In certain embodiments the sequences only vary in the framework sequences so that the CDR sequences are identical to the parent CDR sequences.
- the first antigen-binding region comprises the VH sequence is as set forth in SEQ ID NO : 6, and the VL sequence is as set forth in SEQ ID NO : 10.
- the first binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a mouse antibody.
- the first binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a humanized antibody.
- the first binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a full-length antibody antibody.
- the first binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a full-length IgGl,A (lambda) or IgGl, ⁇ (kappa) antibody.
- CD20 antibodies for use as the second binding arm in the bispecific antibodies according to the invention are CD20 antibodies, which bind to an epitope on human CD20, which does not comprise or require the amino acid residues alanine at position 170 or proline at position 172, but which comprises or requires the amino acid residues asparagine at position 163 and asparagine at position 166.
- Examples of such antibodies are the antibodies denoted 2F2 and 7D8 as disclosed in WO2004035607 (Genmab) and the antibody denoted 2C6 as disclosed in WO2005103081 (Genmab) .
- the CDR sequences of 2F2, 7D8 and 2C6 are disclosed in Table 1.
- CD20 antibodies for use as the second binding arm in the bispecific antibodies according to the invention are CD20 antibodies, which bind to an epitope on human CD20, which does not comprise or require the amino acid residues alanine at position 170 or proline at position 172.
- An example of such an antibody is 11B8 as disclosed in WO2004035607 (Genmab) .
- the CDR sequences of 11B8 are disclosed in Table 1.
- CD20 antibodies for use as the second antigen-binding region in the bispecific antibodies according to the invention are CD20 antibodies with a low functional off-rate meaning that the antibodies are slowly dissociated from CD20 upon binding .
- the k d dissociation constant or k off rate may be determined by the method described under the heading "Dissociation rates of anti- CD20 F(ab) 2 fragments" in Example 5 of WO2004035607.
- the CD20 antibodies have a k d dissociation constant of 1.0 x "4 sec “1 or below, such as of 8.0 x 10 "5 sec “ 1 or below, such as in the range of 8.0 x 10 "5 sec “1 to 4.0 x 10 "5 sec “1 as determined by the above method .
- CD20 antibodies for use as the second binding arm in the bispecific antibodies according to the invention are CD20 antibodies having the six CDR sequences of the antibody denoted 11 B8 as disclosed in WO2004035607.
- the CDR sequences of 11B8 are disclosed in Table 1.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a second antigen-binding region which binds to human CD20, which second antigen-binding region comprises heavy chain variable (VH) region CDR1, CDR2, and CDR3 having the sequences selected from :
- VH heavy chain variable
- VH CDR3 region of SEQ ID NO:51 VH CDR3 region of SEQ ID NO:51.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a second antigen-binding region comprising the VH CDRl region of SEQ ID NO:32, the VH CDR2 region of SEQ ID NO:33, and the VH CDR3 region of SEQ ID NO:34.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a second antigen-binding region which binds to human CD20, which second antigen-binding region comprises heavy chain variable (VH) region CDRl, CDR2, and CDR3 and chain variable (LH) region CDRl, CDR2, and CDR3 sequences selected from:
- the bispecific antibody as defined in any of the embodiments as disclosed herein comprises a second antigen-binding region comprising the VH CDR1 region of SEQ ID NO : 32, the VH CDR2 region of SEQ ID NO: 33, the VH CDR3 region of SEQ ID NO : 34, the VL CDR1 region of SEQ ID NO : 35, the VL CDR2 region of DAS, and the VL CDR3 region of SEQ ID NO : 36.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:27, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:28.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :37, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO: 28.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :40, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:41.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :47, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:48.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :27, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:41.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :27, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:48.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :37, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:41.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :37, and a a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:48.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :40, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO: 28.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :40, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:48.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :47, and a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO: 28.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a VH sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO :47, and a a VL sequence which has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:41.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises second VH and VL sequences, wherein said VH and VL sequences of the second antigen-binding region are selected from the group consisting of:
- the second antigen-binding region comprises the VH sequence of SEQ ID NO :27, and the VL sequence of SEQ ID NO : 28.
- the second binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a human antibody.
- the second binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a full-length antibody antibody.
- the second binding arm of the bispecific antibody as defined in any of the embodiments disclosed herein is derived from a IgGl, ⁇ (kappa) antibody.
- the present invention provides bispecific CD3xCD20 antibodies which efficiently promote T cell-mediated killing of CD20-expressing tumor cells.
- particular antigen-binding regions can be selected from the set of antibodies or antigen-binding regions provided by the present invention.
- Many different formats and uses of bispecific antibodies are known in the art, and were reviewed by Kontermann; Drug Discov Today, 2015 Jul;20(7):838-47 and; MAbs, 2012 Mar- Apr;4(2): 182-97. .
- a bispecific antibody according to the present invention is not limited to any particular bispecific format or method of producing it.
- the bispecific antibody of the present invention is a diabody, a cross-body, or a bispecific antibody obtained via a controlled Fab-arm exchange (such as described in WO2011131746 (Genmab)).
- bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab-fragments are fused together, fused to heavy-chain constant-domains,
- IgG-like molecules with complementary CH3 domain molecules include but are not limited to the Triomab/Quadroma molecules (Trion Pharma/Fresenius Biotech; Roche, WO2011069104), the so-called Knobs-into-Holes molecules (Genentech, WO9850431), CrossMAbs (Roche, WO2011117329) and the electrostatically-matched molecules (Amgen, EP1870459 and WO2009089004; Chugai, US201000155133; Oncomed, WO2010129304), the LUZ-Y molecules (Genentech, Wranik et al. J. Biol. Chem.
- IgG-like dual targeting molecules examples include but are not limited to Dual Targeting (DT)-Ig molecules (WO2009058383), Two-in-one Antibody (Genentech; Bostrom, et al 2009. Science 323, 1610- 1614.), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star, WO2008003116), Zybody molecules (Zyngenia; LaFleur et al. MAbs.
- DT Dual Targeting
- WO2009058383 Two-in-one Antibody
- Genentech Bostrom, et al 2009. Science 323, 1610- 1614.
- Cross-linked Mabs Karmanos Cancer Center
- mAb2 F-Star, WO2008003116
- Zybody molecules Zyngenia; LaFleur et al. MAbs.
- IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-Ig molecules (Abbott, US7,612,181), Dual domain double head antibodies (Unilever; Sanofi Aventis, WO20100226923), IgG-like Bispecific molecules (ImClone/Eli Lilly, Lewis etal. Nat Biotechnol. 2014 Feb;32(2) : 191-8), Ts2Ab (Medlmmune/AZ; Dimasi et al. J Mol Biol.
- DVD Dual Variable Domain
- Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Pearce et al., Biochem Mol Biol Int. 1997 Sep;42(6) : 1179-88), SCORPION molecules (Emergent BioSolutions/Trubion, Blankenship JW, et al. AACR 100 th Annual meeting 2009 (Abstract # 5465); Zymogenetics/BMS, WO2010111625), Dual Affinity Retargeting Technology (Fc-DART) molecules (MacroGenics, WO2008157379, WO2010080538) and Dual(ScFv)2-Fab molecules (National Research Center for Antibody Medicine - China).
- Fab fusion bispecific antibodies include but are not limited to F(ab)2 molecules (Medarex/AMGEN; Deo et al J Immunol. 1998 Feb 15; 160(4) : 1677-86.), Dual- Action or Bis-Fab molecules (Genentech, Bostrom, et al 2009. Science 323, 1610-1614.), Dock-and-Lock (DNL) molecules (ImmunoMedics, WO2003074569, WO2005004809), Bivalent Bispecific molecules (Biotecnol, Schoonjans, J Immunol. 2000 Dec 15; 165(12) : 7050-7.) and Fab-Fv molecules (UCB-Celltech, WO 2009040562 Al).
- ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE) molecules (Micromet, WO2005061547), Tandem Diabody molecules (TandAb) (Affimed) Le Gall et al., Protein Eng Des Sel. 2004 Apr; 17(4) : 357-66.), Dual Affinity Retargeting Technology (DART) molecules (MacroGenics, WO2008157379, WO2010080538), Single-chain Diabody molecules (Lawrence, FEBS Lett.
- BiTE Bispecific T Cell Engager
- TandAb Tandem Diabody molecules
- DART Dual Affinity Retargeting Technology
- Single-chain Diabody molecules Single-chain Diabody molecules
- TCR-like Antibodies AIT, ReceptorLogics
- Human Serum Albumin ScFv Fusion Merrimack, WO2010059315
- COMBODY molecules Epigen Biotech, Zhu et al. Immunol Cell Biol. 2010 Aug;88(6) : 667-75.
- dual targeting nanobodies Ablynx, Hmila et al., FASEB J. 2010
- dual targeting heavy chain only domain antibodies
- the bispecific antibody of the invention comprises a first Fc-region comprising a first CH3 region, and a second Fc-region comprising a second CH3 region, wherein the sequences of the first and second CH3 regions are different and are such that the heterodimeric interaction between said first and second CH3 regions is stronger than each of the homodimeric interactions of said first and second CH3 regions. More details on these interactions and how they can be achieved are provided in WO2011131746 and WO2013060867 (Genmab), which are hereby incorporated by reference.
- a stable bispecific CD3xCD20 antibody can be obtained at high yield using a particular method on the basis of one homodimeric starting CD20 antibody and one homodimeric starting CD3 antibody containing only a few, fairly conservative, asymmetrical mutations in the CH3 regions.
- Asymmetrical mutations mean that the sequences of said first and second CH3 regions contain amino acid substitutions at non-identical positions.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first and second heavy chains, wherein each of said first and second heavy chain comprises at least a hinge region, a CH2 and CH3 region, wherein in said first heavy chain at least one of the amino acids in the positions corresponding to a positions selected from the group consisting of T366, L368, K370, D399, F405, Y407, and K409 in a human IgGl heavy chain has been substituted, and in said second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of T366, L368, K370, D399, F405, Y407, and K409 in a human IgGl heavy chain has been substituted, and wherein said first and said second heavy chains are not substituted in the same positions.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first and second heavy chains, wherein (i) the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in said first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in said second heavy chain, or (ii) the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in said first heavy chain, and the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in said second heavy chain.
- the first Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 405, 407 and 409
- the second Fc- region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 405, 407 and 409, and wherein the first and second Fc-regions are not substituted in the same positions.
- the first Fc-region has an amino acid substitution at position 366
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 368, 370, 399, 405, 407 and 409.
- the amino acid at position 366 is selected from Ala, Asp, Glu, His, Asn, Val, or Gin.
- the first Fc-region has an amino acid substitution at position 368
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 370, 399, 405, 407 and 409.
- the first Fc-region has an amino acid substitution at position 370
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 399, 405, 407 and 409.
- the first Fc-region has an amino acid substitution at position 399
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 405, 407 and 409.
- the first Fc-region has an amino acid substitution at position 405, and said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 407 and 409.
- the first Fc-region has an amino acid substitution at position 407
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 405, and 409.
- the first Fc-region has an amino acid substitution at position 409
- said second Fc-region has an amino acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 405, and 407.
- the sequences of said first and second CH3 regions contain asymmetrical mutations, i.e. mutations at different positions in the two CH3 regions, e.g. a mutation at position 405 in one of the CH3 regions and a mutation at position 409 in the other CH3 region.
- the first Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has an amino-acid substitution at a position selected from the group consisting of: 366, 368, 370, 399, 405 and 407.
- said first Fc-region has an amino acid other than Lys, Leu or Met, e.g.
- said second Fc- region has an amino acid other than Phe, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc- region has an amino acid other than Phe, e.g. Gly, Ala, Val, He, Ser, Thr, Lys, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, Cys, Lys, or Leu, at position 405.
- said first Fc-region has an amino acid other than Lys, Leu or Met, e.g.
- said first Fc-region comprises a Phe at position 405 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region comprises an amino acid other than Phe, e.g. Gly, Ala, Val, He, Ser, Thr, Lys, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, Leu, Met, or Cys, at position 405 and a Lys at position 409.
- said first Fc-region comprises a Phe at position 405 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region comprises an amino acid other than Phe, Arg or Gly, e.g. Leu, Ala, Val, He, Ser, Thr, Met, Lys, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 405 and a Lys at position 409.
- said first Fc-region comprises a Phe at position 405 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region comprises a Leu at position 405 and a Lys at position 409.
- said first Fc- region comprises a Phe at position 405 and an Arg at position 409 and said second Fc- region comprises an amino acid other than Phe, Arg or Gly, e.g.
- said first Fc-region comprises Phe at position 405 and an Arg at position 409 and said second Fc-region comprises a Leu at position 405 and a Lys at position 409.
- said first Fc-region comprises an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region comprises a Lys at position 409, a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises an Arg at position 409 and said second Fc-region comprises a Lys at position 409, a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises a Lys at position 370, a Phe at position 405 and an Arg at position 409 and said second Fc-region comprises a Lys at position 409, a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises an amino acid other than Lys, Leu or Met, e.g.
- Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region comprises a Lys at position 409 and : a) an He at position 350 and a Leu at position 405, or b) a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises an Arg at position 409 and said second Fc region comprises a Lys at position 409 and : a) an He at position 350 and a Leu at position 405, or b) a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises a Thr at position 350, a Lys at position 370, a Phe at position 405 and an Arg at position 409 and said second Fc region comprises a Lys at position 409 and : a) an He at position 350 and a Leu at position 405, or b) a Thr at position 370 and a Leu at position 405.
- said first Fc-region comprises a Thr at position 350, a Lys at position 370, a Phe at position 405 and an Arg at position 409 and said second Fc-region comprises an He at position 350, a Thr at position 370, a Leu at position 405 and a Lys at position 409.
- said first Fc-region has an amino acid other than Lys, Leu or Met at position 409 and said second Fc-region has an amino acid other than Phe at position 405, such as other than Phe, Arg or Gly at position 405; or said first CH3 region has an amino acid other than Lys, Leu or Met at position 409 and said second CH3 region has an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr at position 407.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region having an amino acid other than Lys, Leu or Met at position 409 and a second Fc-region having an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr at position 407.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region having a Tyr at position 407 and an amino acid other than Lys, Leu or Met at position 409 and a second Fc-region having an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr at position 407 and a Lys at position 409.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region having a Tyr at position 407 and an Arg at position 409 and a second Fc-region having an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr at position 407 and a Lys at position 409.
- said first Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr, e.g. Leu, Met, Gly, Ala, Val, He, His, Asn, Pro, Trp, or Cys, at position 407.
- said first Fc-region has an amino acid other than Lys, Leu or Met, e.g.
- said first Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has a Gly, Leu, Met, Asn or Trp at position 407.
- said first Fc-region has a Tyr at position 407 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr, e.g. Leu, Met, Gly, Ala, Val, He, His, Asn, Pro, Trp, or Cys, at position 407 and a Lys at position 409.
- said first Fc-region has a Tyr at position 407 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has an Ala, Gly, His, He, Leu, Met, Asn, Val or Trp at position 407 and a Lys at position 409.
- an amino acid other than Lys, Leu or Met e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys
- said first Fc-region has a Tyr at position 407 and an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region has a Gly, Leu, Met, Asn or Trp at position 407 and a Lys at position 409.
- said first Fc-region has a Tyr at position 407 and an Arg at position 409 and said second Fc-region has an amino acid other than Tyr, Asp, Glu, Phe, Lys, Gin, Arg, Ser or Thr, e.g. Leu, Met, Gly, Ala, Val, He, His, Asn, Pro, Trp, or Cys, at position 407 and a Lys at position 409.
- said first Fc-region has a Tyr at position 407 and an Arg at position 409 and said second Fc-region has an Ala, Gly, His, He, Leu, Met, Asn, Val or Trp at position 407 and a Lys at position 409.
- said first Fc-region has a Tyr at position 407 and an Arg at position 409 and said second Fc-region has a Gly, Leu, Met, Asn or Trp at position 407 and a Lys at position 409.
- the first Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409, and the second Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409, and the second Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, He, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 409, and the second Fc-region has an amino acid other than Lys, Leu or Met, e.g. G
- an amino acid other than Phe, Leu and Met e.g. Gly, Ala, Val, He, Ser, Thr, Lys, Arg, His, Asp, Asn, Glu, Gin, Pro, Trp, Tyr, or Cys, at position 368, or
- an amino acid other than Lys, Arg, Ser, Thr, or Trp e.g. Phe, Leu, Met, Ala, Val, Gly, lie, Asn, His, Asp, Glu, Gin, Pro, Tyr, or Cys, at position 366.
- the first Fc-region has an Arg, Ala, His or Gly at position 409, and the second Fc region has
- the first Fc-region has an Arg at position 409, and the second Fc region has
- said first and second Fc regions may contain further amino-acid substitutions, deletion or insertions relative to wild- type Fc sequences.
- said first and second Fab-arms (or heavy chain constant domains) comprising the first and second Fc regions comprise, except for the specified mutations, a CH3 sequence independently selected from the following :
- neither said first nor said second Fc-region comprises a Cys- Pro-Ser-Cys sequence in the (core) hinge region.
- both said first and said second Fc-region comprise a Cys- Pro-Pro-Cys sequence in the (core) hinge region.
- one or both Fab arms comprise a heavy-chain constant region sequence independently selected from SEQ ID NO : 63, 64, 65, 66, 67, 68, 69, 70, and 71 (see Table 1).
- the first antigen-binding region comprises heavy chain variable (VH) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs: l, 2, and 3, respectively, and light chain variable (VL) region CDRl, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO :4, the sequence GTN, and the sequence as set forth in SEQ ID NO: 5, respectively
- the second antigen-binding region which binds to human CD20 comprises the VH CDRl region of SEQ ID NO : 32, the VH CDR2 region of SEQ ID NO : 33, the VH CDR3 region of SEQ ID NO :34, the VL CDRl region of SEQ ID NO : 35, the VL CDR2 region of DAS, and the VL CDR3 region of SEQ ID NO : 36, respectively.
- the first antigen-binding region comprises the VH sequence as set forth in SEQ ID NO : 6, and a VL sequence as set forth in SEQ ID NO : 10
- the second antigen-binding region comprises the VH sequence as set forth in SEQ ID NO: 27, and the VL sequence as set forth in SEQ ID NO : 28.
- the first antigen-binding region is a Fab arm derived from lgGl-huCD3-HlLl- FEAL
- the second antigen-binding region is a Fab arm derived from IgGl-7D8-FEAR.
- the first binding arm is a half-molecule antibody (i.e. comprising one heavy and one light chain) derived from lgGl-huCD3-HlLl-FEAL
- the second binding arm is a half-molecule antibody derived from IgGl-7D8-FEAR.
- the first binding arm is a half-molecule antibody derived from lgGl-huCD3- H1L1-FEA
- the second binding arm is a half-molecule antibody derived from IgGl-7D8- FEAL.
- Another strategy to promote formation of heterodimers over homodimers is a "knob-into-hole” strategy in which a protuberance is introduced on a first heavy-chain polypeptide and a corresponding cavity in a second heavy-chain polypeptide, such that the protuberance can be positioned in the cavity at the interface of these two heavy chains so as to promote heterodimer formation and hinder homodimer formation .
- protuberances are constructed by replacing small amino-acid side-chains from the interface of the first polypeptide with larger side chains.
- Compensatory "cavities" of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino-acid side-chains with smaller ones (US patent 5,731, 168) .
- EP1870459 Choi
- WO2009089004 Amgen
- EP1870459 Choi
- WO2009089004 Amgen
- one or more residues that make up the CH3-CH3 interface in both CH3 domains are replaced with a charged amino acid such that homodimer formation is electrostatically unfavorable and heterodimerization is electrostatically favorable.
- WO2007110205 Merck
- bispecific antibodies Another in vitro method for producing bispecific antibodies has been described in WO2008119353 (Genmab), wherein a bispecific antibody is formed by "Fab-arm” or "half- molecule” exchange (swapping of a heavy chain and attached light chain) between two monospecific IgG4- or IgG4-like antibodies upon incubation under reducing conditions.
- the resulting product is a bispecific antibody having two Fab arms which may comprise different sequences.
- a preferred method for preparing the bispecific CD3xCD20 antibodies of the present invention includes the methods described in WO2011131746 and WO13060867 (Genmab) comprising the following steps:
- sequences of said first and second CH3 regions are different and are such that the heterodimeric interaction between said first and second CH3 regions is stronger than each of the homodimeric interactions of said first and second CH3 regions;
- the said first antibody together with said second antibody are incubated under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide-bond isomerization, wherein the heterodimeric interaction between said first and second antibodies in the resulting heterodimeric antibody is such that no Fab-arm exchange occurs at 0.5 mM GSH after 24 hours at 37° C.
- step c) the heavy-chain disulfide bonds in the hinge regions of the parent antibodies are reduced and the resulting cysteines are then able to form inter heavy-chain disulfide bond with cysteine residues of another parent antibody molecule (originally with a different specificity).
- the reducing conditions in step c) comprise the addition of a reducing agent, e.g.
- step c) comprises restoring the conditions to become non-reducing or less reducing, for example by removal of a reducing agent, e.g. by desalting.
- any of the CD3 and CD20 antibodes described above may be used including first and second CD3 and CD20 antibodies, respectively, comprising a first and/or second Fc region.
- first and second Fc regions including combination of such first and second Fc regions may include any of those described above.
- the first and second CD3 and CD20 antibodies, respectively may be chosen so as to obtain a bispecific antibody as described herein.
- said first and/or second antibodies are full-length antibodies.
- the Fc regions of the first and second antibodies may be of any isotype, including, but not limited to, IgGl, IgG2, IgG3 or IgG4.
- the Fc regions of both said first and said second antibodies are of the IgGl isotype.
- one of the Fc regions of said antibodies is of the IgGl isotype and the other of the IgG4 isotype.
- the resulting bispecific antibody comprises an Fc region of an IgGl and an Fc region of IgG4 and may thus have interesting intermediate properties with respect to activation of effector functions.
- one of the antibody starting proteins has been engineered to not bind Protein A, thus allowing to separate the heterodimeric protein from said homodimeric starting protein by passing the product over a protein A column.
- the sequences of the first and second CH3 regions of the homodimeric starting antibodies are different and are such that the heterodimeric interaction between said first and second CH3 regions is stronger than each of the homodimeric interactions of said first and second CH3 regions. More details on these interactions and how they can be achieved are provided in WO2011131746 and WO2013060867 (Genmab), which are hereby incorporated by reference in their entirety.
- a stable bispecific CD3xCD20 antibody can be obtained at high yield using the above method of the invention on the basis of two homodimeric starting antibodies which bind CD3 and CD20, respectively, and contain only a few, fairly conservative, asymmetrical mutations in the CH3 regions.
- Asymmetrical mutations mean that the sequences of said first and second CH3 regions contain amino acid substitutions at non-identical positions.
- the bispecific antibodies of the invention may also be obtained by co-expression of constructs encoding the first and second polypeptides in a single cell.
- the invention relates to a method for producing a bispecific antibody, said method comprising the following steps:
- first and second nucleic acid constructs encode light chain sequences of said first and second antibodies
- the present invention also relates to a recombinant eukaryotic or prokaryotic host cell which produces a bispecific antibody of the present invention.
- the bispecific antibody is obtained by any of the methods according to the present invention.
- Suitable expression vectors including promoters, enhancers, etc., and suitable host cells for the production of antibodies are well-known in the art.
- suitable host cells include yeast, bacterial and mammalian cells, such as CHO or HEK cells.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises first and second CH3 regions, except for the specified mutations, comprising the sequence of SEQ ID NO: 60 (IgGlm(a)).
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein neither said first nor said second Fc-region comprises a Cys-Pro-Ser-Cys sequence in the hinge region.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein both of said first and said second Fc-region comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein the first and second Fc-regions are human antibody Fc-regions.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein said first and second Fc region, except for the specified mutations, comprise a sequence independently selected from the group consisting of SEQ ID NOS :63, 64, 65, 66, 67, 68, 69, 70, and 71.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein the first and second antigen-binding regions comprise human antibody VH sequences and, optionally, human antibody VL sequences.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein the first and second antigen-binding regions are from heavy-chain antibodies.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first Fc-region and a second Fc-region, wherein the first and second antigen-binding regions comprise a first and second light chain.
- the co-expression method according to the invention comprises any of the further features described under the in vitro method above.
- the invention relates to an expression vector comprising the first and second nucleic-acid constructs specified herein above.
- the expression vector further comprises a nucleotide sequence encoding the constant region of a light chain, a heavy chain or both light and heavy chains of an antibody, e.g. a human antibody.
- An expression vector in the context of the present invention may be any suitable vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements) .
- suitable vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid (RNA or DNA) vectors.
- a CD20 or a CD3 antibody-encoding nucleic acid is comprised in a naked DNA or RNA vector, including, for example, a linear expression element (as described in for instance Sykes and Johnston, Nat Biotech 17, 355-59 ( 1997)), a compacted nucleic acid vector (as described in for instance US 6,077, 835 and/or WO 00/70087), a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119, a "midge" minimally-sized nucleic acid vector (as described in for instance Schakowski et al.
- a linear expression element as described in for instance Sykes and Johnston, Nat Biotech 17, 355-59 ( 1997)
- a compacted nucleic acid vector as described in for instance US 6,077, 835 and/or WO 00/70087
- a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119
- nucleic acid vector construct such as a CaP04-precipitated construct (as described in for instance WO200046147, Benvenisty and Reshef, PNAS USA 83, 9551-55 ( 1986), Wigler et al. , Cell 14, 725 ( 1978), and Coraro and Pearson, Somatic Cell Genetics 7, 603 ( 1981)) .
- CaP04-precipitated construct as described in for instance WO200046147, Benvenisty and Reshef, PNAS USA 83, 9551-55 ( 1986), Wigler et al. , Cell 14, 725 ( 1978), and Coraro and Pearson, Somatic Cell Genetics 7, 603 ( 1981)
- nucleic acid vectors and the usage thereof are well known in the art (see for instance US 5,589,466 and US 5,973,972) .
- the vector is suitable for expression of the CD20 antibody and/or the CD3 antibody in a bacterial cell.
- examples of such vectors include expression vectors such as BlueScript (Stratagene), pIN vectors (Van Heeke & Schuster, J Biol Chem 264, 5503-5509 ( 1989), pET vectors (Novagen, Madison WI) and the like) .
- An expression vector may also or alternatively be a vector suitable for expression in a yeast system. Any vector suitable for expression in a yeast system may be employed. Suitable vectors include, for example, vectors comprising constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH (reviewed in : F. Ausubel et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley InterScience New York (1987), and Grant et al., Methods in Enzymol 153, 516-544 (1987)).
- An expression vector may also or alternatively be a vector suitable for expression in mammalian cells, e.g. a vector comprising glutamine synthetase as a selectable marker, such as the vectors described in Bebbington (1992) Biotechnology (NY) 10 : 169-175.
- a nucleic acid and/or vector may also comprises a nucleic acid sequence encoding a secretion/localization sequence, which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
- a secretion/localization sequence which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
- sequences are known in the art, and include secretion leader or signal peptides.
- the expression vector may comprise or be associated with any suitable promoter, enhancer, and other expression-facilitating elements.
- suitable promoter, enhancer, and other expression-facilitating elements include strong expression promoters (e. g., human CMV IE promoter/enhancer as well as RSV, SV40, SL3-3, MMTV, and HIV LTR promoters), effective poly (A) termination sequences, an origin of replication for plasmid product in E. coli, an antibiotic resistance gene as selectable marker, and/or a convenient cloning site (e.g ., a polylinker).
- Nucleic acids may also comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE.
- the CD20 and/or CD3 antibody-encoding expression vector may be positioned in and/or delivered to the host cell or host animal via a viral vector.
- the invention relates to a host cell comprising the first and second nucleic-acid constructs specified herein above.
- the present invention also relates to a recombinant eukaryotic or prokaryotic host cell which produces a bispecific antibody of the present invention, such as a transfectoma.
- the first CD20-specific antibody may be expressed in a recombinant eukaryotic or prokaryotic host cell, such as a transfectoma, which produces an antibody of the invention as defined herein or a bispecific antibody of the invention as defined herein.
- the CD3- specific antibody may likewise be expressed in a recombinant eukaryotic or prokaryotic host cell, such as a transfectoma, which produces an antibody of the invention as defined herein or a bispecific antibody of the invention as defined herein.
- host cells include yeast, bacterial, plant and mammalian cells, such as CHO, CHO-S, HEK, HEK293, HEK-293F, Expi293F, PER.C6 or NSO cells or lymphocytic cells.
- the host cell may comprise a first and second nucleic acid construct stably integrated into the cellular genome.
- the present invention provides a cell comprising a non-integrated nucleic acid, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a first and second nucleic acid construct as specified above.
- the invention relates to a transgenic non-human animal or plant comprising nucleic acids encoding one or two sets of a human heavy chain and a human light chain, wherein the animal or plant produces a bispecific antibody of the invention.
- the invention relates to a hybridoma which produces an antibody for use in a bispecific antibody of the invention as defined herein.
- the invention relates to a transgenic non-human animal or plant comprising nucleic acids encoding one or two sets of a human heavy chain and a human light chain, wherein the animal or plant produces an antibody for use in a bispecific antibody or a bispecific antibody of the invention.
- the invention relates to a nucleic acid construct encoding one or more amino acid sequences set out in Table 1.
- the invention relates to an expression vector comprising
- the invention relates to a method for producing a bispecific antibody according to any one of the embodiments as disclosed herein, comprising the steps of
- the invention relates to a host cell comprising an expression vector as defined above.
- the host cell is a recombinant eukaryotic, recombinant prokaryotic, or recombinant microbial host cell.
- the bispecific CD3xCD20 antibody according to the present invention further comprises a first Fc region and a second Fc region which may be comprised in a first and a second Fab-arm which respectively further comprise the first and second antigen-binding regions described above (or vice versa).
- the bispecific CD3xCD20 antibody comprises a first and a second Fab-arm comprising a first and a second antigen-binding region, respectively.
- the bispecific CD3xCD20 antibody further comprises a first and a second Fc region.
- the bispecific CD3xCD20 antibody comprises the first Fab-arm comprising the first antigen-binding region and the first Fc region, and the second Fab-arm comprising the second antigen-binding region and the second Fc region.
- the bispecific CD3xCD20 antibody comprises the second Fab-arm comprising the second antigen-binding region and the first Fc region, and the first Fab-arm comprising the first antigen-binding region and the second Fc region.
- the first and second Fc-regions may each be of any isotype, including, but not limited to, IgGl, IgG2, IgG3 and IgG4, and may comprise one or more mutations or modifications.
- each of the first and second Fc regions is of the IgG4 isotype or derived therefrom, optionally with one or more mutations or modifications.
- each of the first and second Fc regions is of the IgGl isotype or derived therefrom, optionally with one or more mutations or modifications.
- one of the Fc regions is of the IgGl isotype and the other of the IgG4 isotype, or is derived from such respective isotypes, optionally with one or more mutations or modifications.
- one or both of the Fc regions comprise a mutation removing the acceptor site for Asn-linked glycosylation or is otherwise manipulated to change the glycosylation properties.
- an N297Q mutation can be used to remove an Asn-linked glycosylation site.
- one or both Fc-regions comprise an IgGl wildtype sequence with an N297Q mutation (SEQ ID NO: 66, see Table 1).
- one or both Fc-regions are effector-function-deficient.
- the Fc-region(s) may be of an IgG4 isotype, or a non-IgG4 type, e.g. IgGl, IgG2 or IgG3, which has been mutated such that the ability to mediate effector functions, such as ADCC, has been reduced or even eliminated.
- Such mutations have e.g. been described in Dall'Acqua WF et al., J Immunol. 177(2) : 1129-1138 (2006) and Hezareh M, J Virol. ; 75(24) : 12161-12168 (2001).
- one or both Fc-regions comprise an IgGl wildtype sequence (SEQ ID NO : 63, see Table 1).
- the bispecific antibody according to the present invention may comprise modifications in the Fc region.
- a bispecific antibody comprises such modifications it may become an inert, or non-activating, bispecific antibody.
- the inertness of an Fc region of a humanized or chimeric CD3 antibody is advantageously tested using the antibody in a monospecific format.
- variants can be constructed to make the Fc region of an antibody inactive for interactions with Fey (gamma) receptors and Clq for therapeutic antibody development. Examples of such variants are described herein.
- the antibody comprises an Fc region which has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
- PBMC peripheral blood mononuclear cell
- amino acids in the Fc region that play a dominant role in the interactions with Clq and the Fey receptors may be modified.
- amino acid positions that may be modified include positions L234, L235 and P331. Combinations thereof, such as L234F/L235E/P331S, can cause a profound decrease in binding to human CD64, CD32A, CD16 and Clq.
- the amino acid in at least one position corresponding to L234, L235 and P331, may be A, A and S, respectively (Xu et al., 2000, Cell Immunol. 200(l) : 16-26; Oganesyan et al., 2008, Acta Cryst. (D64) : 700-4).
- L234F and L235E amino acid substitutions can result in Fc regions with abrogated interactions with Fcy receptors and Clq (Canfield et al., 1991, J. Exp. Med. (173) : 1483-91; Duncan et al., 1988, Nature (332) : 738-40).
- the amino acids in the positions corresponding to L234 and L235 may be F and E, respectively.
- a D265A amino acid substitution can decrease binding to all Fc gamma Receptors and prevent ADCC (Shields et al., 2001, J. Biol. Chem. (276) : 6591-604).
- the amino acid in the position corresponding to D265 may be A. Binding to Clq can be abrogated by mutating positions D270, K322, P329, and P331.
- the amino acids in at least one position corresponding to D270, K322, P329 and P331, may be A, A, A, and A, respectively.
- N297 may be G, Q, A or E Leabman et al., 2013, MAbs; 5(6) : 896-903).
- Fc region with Fcy receptors may be obtained by the following mutations; P238A, A327Q, P329A or E233P/L234V/L235A/G236del (Shields et al., 2001, J. Biol. Chem. (276) : 6591-604).
- human IgG2 and IgG4 subclasses are considered naturally compromised in their interactions with Clq and Fc gamma Receptors although interactions with Fcy receptors were reported (Parren et al., 1992, J. Clin Invest. 90 : 1537-1546; Bruhns et al., 2009, Blood 113 : 3716-3725). Mutations abrogating these residual interactions can be made in both isotypes, resulting in reduction of unwanted side-effects associated with FcR binding. For IgG2, these include L234A and G237A, and for IgG4, L235E.
- the amino acid in a position corresponding to L234 and G237 in a human IgG2 heavy chain may be A and A, respectively.
- the amino acid in a position corresponding to L235 in a human IgG4 heavy chain may be E.
- the hinge region of the antibody can also be of importance with respect to interactions with Fcy receptors and complement (Brekke et al., 2006, J Immunol 177: 1129- 1138; Dall'Acqua WF, et al., 2006, J Immunol 177 : 1129-1138). Accordingly, mutations in or deletion of the hinge region can influence effector functions of an antibody.
- cross-linking refers to the indirect bridging of antibody Fab arm(s) (monovalently or bivalently) bound to the target antigen by an FcR-bearing cell through binding to the antibody Fc region.
- an antibody which binds its target antigen on target antigen-bearing cells may cross-link that cell with another cell expressing FcRs.
- unspecific killing refers to the killing of cells by the cytotoxic function of T cells or other effector cells, through tumor target antigen- independent activation of said cells.
- effector cells e.g. cytotoxic T cells
- cytotoxic T cells are activated and induce cytotoxicity independent of tumor target binding, for example by binding of the antibody to CD3 and an FcyR.
- the bispecific antibody comprises a first and a second immunoglobulin heavy chain, wherein in at least one of said first and second immunoglobulin heavy chains one or more amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain, are not L, L, D, N, and P, respectively.
- one or more amino acids in the position corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain are not L, L, D, N, and P, respectively.
- one or more amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are not L, L and D, respectively, and the amino acids in the positions corresponding to N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- amino acid corresponding to positions refers to an amino acid position number in a human IgGl heavy chain. Corresponding amino acid positions in other immunoglobulins may be found by alignment with human IgGl . Unless otherwise stated or contradicted by context, the amino acids of the constant region sequences are herein numbered according to the EU-index of numbering (described in Kabat, E.A. et al., 1991, Sequences of proteins of immunological interest. 5th Edition - US Department of Health and Human Services, NIH publication No. 91-3242, pp 662, 680, 689).
- an amino acid or segment in one sequence that "corresponds to" an amino acid or segment in another sequence is one that aligns with the other amino acid or segment using a standard sequence alignment program such as ALIGN, ClustalW or similar, typically at default settings and has at least 50%, at least 80%, at least 90%, or at least 95% identity to a human IgGl heavy chain. It is considered well-known in the art how to align a sequence or segment in a sequence and thereby determine the corresponding position in a sequence to an amino acid position according to the present invention.
- amino acid may be defined as described above.
- the amino acid is not or similar wording when referring to amino acids in a heavy chain is to be understood to mean that the amino acid is any other amino acid than the specific amino acid mentioned.
- the amino acid in the position corresponding to L234 in a human IgGl heavy chain is not L, means that the amino acid may be any of the other naturally or non-naturally occurring amino acids than L.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is not D.
- the amino acid in the position corresponding to D265 in a human IgGl heavy chain is not D, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids in the positions corresponding to position D265 in a human IgGl heavy chain is hydrophobic or polar amino acids.
- hydrophobic refers to an amino acid residue selected from the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
- amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
- polar refers to any amino acid residue selected from the group consisting of; C, D, E, H, K, N, Q, R, S, and T.
- amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is an aliphatic uncharged, aromatic or acidic amino acid.
- aliphatic uncharged refers to any amino acid residue selected from the group consisting of: A, G, I, L, and V.
- amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V.
- aromatic refers to any amino acid residue selected from the group consisting of: F, T, and W.
- amino acid in at least one of said first and second heavy chains is selected from the group consisting of; F, T, and W.
- amino acid residues refers to any amino acid residue chosen from the group consisting of: D and E.
- amino acid residues chosen from the group consisting of: D and E.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is not D.
- the amino acid in the position corresponding to D265 in a human IgGl heavy chain is not D, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is hydrophobic or polar amino acid.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
- the amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
- the amino acids in the positions corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is aliphatic uncharged, aromatic or acidic amino acids.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; F, T, and W.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain are selected from the group consisting of; D and E.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W.
- the amino acid in the position corresponding to position N297 in a human IgGl heavy chain is not N.
- the amino acid in the position corresponding to N297 in a human IgGl heavy chain is not N, and the amino acid in the position corresponding to position P331 in a human IgGl heavy chain, is P.
- the amino acid in the position corresponding to positions N297 in a human IgGl heavy chain is not N.
- the amino acid in the position corresponding to N297 in a human IgGl heavy chain is not N
- the amino acid in the position corresponding to position P331 in a human IgGl heavy chain is P.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are not L and L, respectively.
- the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are not L and L, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids corresponding to positions L234 and L235 in a human IgGl heavy chain are selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y, V.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are hydrophobic or polar amino acids.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are not L and L, respectively.
- the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are not L and L, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are hydrophobic or polar amino acids.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, G, I, and V.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; F, T, and W.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; D and E.
- the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively.
- the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively.
- the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E, respectively.
- the amino acids in both said first and second heavy chains are F and E, respectively.
- At least one of said first and second heavy chains at least the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain, are A and A, respectively.
- At least the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are A and A, respectively.
- the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are not L, L, and D, respectively.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are not L, L and D, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids corresponding to positions L234 and L235 in a human IgGl heavy chain are selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y, V, and W, and the amino acid corresponding to position D265 is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, Y, V, and W.
- the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are hydrophobic or polar amino acids.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T
- the amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y, and the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, and Y.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are hydrophobic or polar amino acids.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T
- the amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
- the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y, and the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, and Y.
- the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, G, I, and V.
- the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are each selected from the group consisting of; F, T, and W.
- the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are each selected from the group consisting of; D and E.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W, and the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
- the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are not L, L, and D, respectively.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are not L, L, and D, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, G, I, and V.
- amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are each selected from the group consisting of; D and E.
- the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W, and the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
- the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively.
- the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
- the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively.
- amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively.
- the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are A, A, and A, respectively.
- amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are A, A, and A, respectively.
- the amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, Q, and S, respectively.
- amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, Q, and S, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 8, a VL sequence as set out in SEQ ID NO : 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 8, a VL sequence as set out in SEQ ID NO : 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 6, a VL sequence as set out in SEQ ID NO : 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 6, a VL sequence as set out in SEQ ID NO : 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO :9, a VL sequence as set out in SEQ ID NO : 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO :9, a VL sequence as set out in SEQ ID NO : 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
- the bispecific antibody according to the invention comprises the human IgLC2/IgLC3 constant domain lambda light chain of SEQ ID NO : 29.
- a non-activating Fc region prevents the antibody from interacting with Fc- receptors present on blood cells, such as monocytes, or with Clq to activate the classical complement pathway.
- Reduction of the Fc activity was tested in antibody variants that contain different combinations of amino acid substitutions in the Fc region. Maximally five amino acid substitutions were introduced, which include the mutations N297Q, L234A, L235A, L234F, L235E, D265A, and P331S. Substitutions in one or more of these five amino acid positions were introduced in the K409R and/or F405L IgGl backbone.
- N297Q refers to the N297Q substitution, termed IgGl-huCLB-T3/4-N297Q
- LFLE refers to the L234F/L235E substitutions, termed IgGl-huCLB-T3/4-LFLE
- LALA refers to the L234A/L235A substitutions, termed IgGl-huCLB-T3/4-LALA
- LFLENQ refer to the L234F/L235E/N297Q substitutions, termed IgGl-huCLB-T3/4-LFLENQ
- LFLEDA refers to the L234F/L235E/D265A substitutions, termed IgGl-huCLB-T3/4-LFLEDA
- DA refers to the D265A substitution, termed IgGl-huCLB-T3/4-DA
- DAPS refers to the D265A substitution, termed IgGl-huCL
- LFLEDA a combination of three amino acid substitutions, which include the mutations L234F, L235E and D265A and is referred to as LFLEDA or FEA, were introduced in the K409R and F405L IgGl backbones to generate antibodies with a non-activating Fc region.
- the resulting non-activating antibody variant is termed with the suffix "FEAR" or "FEAL", respectively.
- the bispecific antibodies according to the invention may be modified in the light chain and/or heavy chain to increase the expression level and/or production yield.
- the antibodies according to the invention may be modified in the light chain.
- modifications are known in the art and may be performed according to the methods described in e.g. Zheng, L, Goddard, J. -P., Baumann, U., & Reymond, J.-L. (2004). Expression improvement and mechanistic study of the retro-Diels-Alderase catalytic antibody 10F11 by site-directed mutagenesis. Journal of Molecular Biology, 341(3), 807-14.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first heavy chain and first light chain, wherein the amino acid in the position corresponding to position T41 in the lambda light chain of SEQ ID NO : 10 of the first light chain is not T.
- the amino acid in the position corresponding to position T41 in the lambda light chain of SEQ ID NO : 10 is selected from H, I, K, L, Q, R and V.
- the amino acid in the position corresponding to position T41 in the lambda light chain of SEQ ID NO : 10 is H, K or R.
- the amino acid in the position corresponding to position T41 in the lambda light chain of SEQ ID NO: 10 of the first light chain is K.
- the amino acid in the position corresponding to position F10 in the lambda light chain of SEQ ID NO : 10 of the first light chain is not F, and one or more of the amino acid positions corresponding to the positions T41, K55, and L97 in the lambda light chain of SEQ ID NO: 10 of the first light chain are not T, K and L, respectively.
- the amino acids in the positions corresponding to positions F10, T41, K55, and L97 in the lambda light chain of SEQ ID NO: 10 of the first light chain are not F, T, K and L, respectively.
- the amino acids in the positions corresponding to positions FIO, T41, K55, and L97 in the lambda light chain of SEQ ID NO : 10 of the first light chain are L, K, N, and H, respectively.
- the amino acids in the positions corresponding to positions R23 and A35 in the lambda light chain of SEQ ID NO : 10 of the first light chain are not R and A, respectively.
- the amino acids in the positions corresponding to positions R23 and A35 in the lambda light chain of SEQ ID NO : 10 of the first light chain are A and P, respectively.
- the amino acids in the positions corresponding to positions F10, R23, A35, R47, D71, A82, D83, S86, 187, and F89 in the lambda light chain of SEQ ID NO : 10 of the first light chain are not F, R, A, R, D, A, D, S, I, and F, respectively.
- the amino acids in the positions corresponding to positions F10, R23, A35, R47, D71, A82, D83, S86, 187, and F89 in the lambda light chain of SEQ ID NO : 10 of the first light chain are L, A, P, T, G, P, E, A, E, and Y, respectively.
- the amino acid in the position corresponding to position K55 in the lambda light chain of SEQ ID NO: 10 of the first light chain is N
- the amino acid in the position corresponding to position F10 in the lambda light chain of SEQ ID NO : 10 of the first light chain is L
- the amino acid in the position corresponding to position K55 in the lambda light chain of SEQ ID NO: 10 of the first light chain is N.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acid in the position corresponding to position T41 is selected from H, I, K, L, Q, R or V, such as selected from H, K and R, such as K.
- the bispecific antibody according to the invention comprises a first light chain having the amino acids L, K, N, and H, respectively, in the positions corresponding to positions F10, T41, K55, and L97 in the lambda light chain of SEQ ID NO: 10.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acid in the position corresponding to position R23 is selected from A, G, H, K, Q, S, and T, such as from A and G, and wherein the amino acid in the position corresponding to A35 is selected from I, L, M, P, V, G, F and W, such as from I, L, M, P, and V.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acid in the position corresponding to position R23 is A or G, such as A, and the amino acid in the position corresponding to position A35 is P.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acids in the positions corresponding to positions F10, R23, A35, R47, D71, A82, D83, S86, 187, and F89 in the lambda light chain of SEQ ID NO : 10 are not F, R, A, R, D, A, D, S, I, and F, respectively.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acid in the position corresponding to position R23 is selected from A, G, H, K, Q, S, and T, such as from A and G, wherein the amino acid in the position corresponding to A35 is selected from I, L, M, P, V, G, F and W, such as from I, L, M, P, and wherein the amino acids in the positions corresponding to positions F10, R47, D71, A82, D83, S86, 187, and F89 in the lambda light chain of SEQ ID NO : 10 are L, T, G, P, E, A, E, and Y, respectively.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acid in the position corresponding to position R23 is A or G, and wherein the amino acids in the positions corresponding to positions F10, A35, R47, D71, A82, D83, S86, 187, and F89 in the lambda light chain of SEQ ID NO : 10 are L, P, T, G, P, E, A, E, and Y, respectively.
- the bispecific antibodies according to the invention may be modified in the first and/or second light chains to increase the affinity of the antibodies.
- the bispecific antibodies according to the invention may be modified in the light chain of the first and/or second binding arm to reduce the affinity of the antibodies. This may be advantageous in some settings and lead to increased efficacy.
- low affinity of the first binding arm binding to human CD3s (epsilon)
- epsilon may have an impact on the motility of T cells in circulation and at tumor site thus leading to better engagement of T cells with tumor cells, cf. Molhoj et al., Molecular Immunology 44 (2007).
- this may be useful in bispecific formats, in which the CD3 antibodies are used as one of the binding arms. Modifications that lead to reduced antibody affinity are known in the art, see for example Webster et al. Int J Cancer Suppl. 1988;3 : 13-6.
- the bispecific antibody according to the invention comprises a first light chain, wherein
- the antibody according to the invention comprises a constant light chain (LC), wherein
- the bispecific antibody according to the invention comprises a light chain, wherein the amino acids in the positions corresponding to positions F10, T41, K55, and L97 in the lambda light chain of SEQ ID NO : 10 are not F, T, K and L, respectively.
- Such modifications serve both to increase the expression level and to reduce the affinity.
- the bispecific antibody according to the invention comprises a first light chain, wherein the amino acids in the positions corresponding to positions F10, T41, K55, and L97 in the lambda light chain of SEQ ID NO : 10 are L, K, N, and H, respectively.
- modifications serve both to increase the expression level and to reduce the affinity.
- mutations in the CDR regions of huCD3 have been made to optimize the binding affinity of the CD3 binding arm, such as to reduce the binding affinity of the CD3 arm.
- the CD3 binding arm of the bispecific antibody according to the invention comprises the six CDR sequences selected from the CDR sequences set forth in the below Table 2.
- the six CDR sequences may be inserted in any one of the huCD3 VH and VL framework sequences VH l, VH2, VH3 and VH4, and VLl, VL2, and VL3, respectively, replacing the CDR sequences of huCD3.
- the six CDR sequences are inserted in the huCD3 framework sequences VH l and VLl.
- the CD3 binding arm comprises the six CDR sequences selected from the Table 2, wherein
- Xi of SEQ ID NO :72 is selected from V, H, F, T, P, L, Q, D, K, W, G, A, C and R;
- X 2 of SEQ ID NO :73 is selected from N, A, H, Q, P, F, M, Y, L, W, D, E and C;
- X 4 of SEQ ID NO : 75 is selected from Y, Q, W, L, A, I, M, D, T, K, R, G, F, E, V, C and
- X 5 of SEQ ID NO: 76 is selected from N, L, Y, W, H, M, G, F, K, S, V, R, Q, D, C, E and
- Xio of SEQ ID NO : 81 is selected from A, G, R, V, F, E, M, H, N, Y, P, Q, D, K and L;
- Xi2 of SEQ ID NO : 83 is selected from D, K, Q, G, V, E, T, N, Y, S, P, W, F and M .
- Such huCD3 CDR variant sequences have reduced binding affinity compared to huCD3 wildtype CDR sequences.
- the six CDR sequences may be inserted in any of the huCD3 VH and VL framework sequences VH l, VH2, VH3 and VH4, and VLl, VL2 and VL3, respectively, replacing the CDR sequences of huCD3.
- the six CDR sequences are inserted in the huCD3 framework sequences VH l and VLl.
- the six CDR sequences have been inserted in the huCD3 framework sequences VH l and VLl, wherein the amino acid T in positon 41 of VLl (SEQ ID NO : 10) has been mutated to K.
- the CD3 binding arm comprises the six CDR sequences selected from the Table 2, wherein
- Xi of SEQ ID NO :72 is selected from L, P, Q, D, K, W, S, G, A, C and R;
- X 2 of SEQ ID NO : 73 is selected from S, N, G, A, K, V, R, H, Q, P, I, F, M, Y, L, W, D, E and C;
- X 3 of SEQ ID NO :74 is selected from M, W, G, Q, V, T, S, L, P, I, A, K, R and C;
- X 4 of SEQ ID NO : 75 is selected from W, L, A, I, M, D, T, K, R, G, F, E, V, C and P;
- X 5 of SEQ ID NO :76 is selected from C, E, P and T:
- X 6 of SEQ ID NO :77 is selected from A, S, V, N, K, L, T, I, P, Q, C, G, Y, W, F, and R;
- X 7 of SEQ ID NO : 78 is selected from P, C, S, and T;
- X 8 of SEQ ID NO :79 is selected from A, T, G, L, N, C, P, F, Q, H, R, K, E, W, and Y ;
- X 9 of SEQ ID NO : 80 is selected from P, L, T, C, A, I, L, Q, V, E, M, K, R, G and P;
- Xio of SEQ ID NO : 81 is selected from E, H, I, M, N, Y, P, Q, D, K and L;
- Xii of SEQ ID NO : 82 is selected from F, Y, I, T, V, M, A, S, N, G, W, E, K, P, R and D; and
- Xi2 of SEQ ID NO : 83 is selected from G, Y, V, N, T, S, H, E, P, W, F and M.
- HuCD3 CDR variant sequences have reduced binding affinity compared to huCD3 wildtype CDR sequences.
- the six CDR sequences may be inserted in any of the huCD3 VH and VL framework sequences VH l, VH2, VH3 and VH4, and VLl, VL2 and VL3, respectively, replacing the CDR sequences of huCD3.
- the six CDR sequences are inserted in the huCD3 framework sequences VH l and VLl.
- the six CDR sequences have been inserted in the huCD3 framework sequences VH l and VLl, wherein the amino acid T in positon 41 of VLl (SEQ ID NO : 10) has been mutated to K.
- the CD3 binding arm comprises the six CDR sequences selected from the CDR sequences set forth in the below Table 3, wherein
- X 2 of SEQ ID NO :73 is selected from M and P;
- X 3 of SEQ ID NO: 74 is A;
- X 4 of SEQ ID NO : 75 is E;
- X 6 of SEQ ID NO :77 is selected from F, G, I, K, L, and N ;
- X 7 of SEQ ID NO :78 is P;
- X 8 of SEQ ID NO : 79 is selected from A and G;
- Xg of SEQ ID NO: 80 is selected from M, R and V. TABLE 3
- Such HuCD3 CDR variant sequences have reduced binding affinity compared to huCD3 wildtype CDR sequences.
- the six CDR sequences may be inserted in any of the huCD3 VH and VL framework sequences VH 1, VH2, VH3 and VH4, and VL1, VL2 and VL3, respectively, replacing the CDR sequences of huCD3.
- the six CDR sequences are inserted in the huCD3 framework sequences VH 1 and VL1.
- the six CDR sequences have been inserted in the huCD3 framework sequences VH 1 and VL1, wherein the amino acid T in positon 41 of VL1 (SEQ ID NO : 10) has been mutated to K.
- the first binding arm is derived from a CD3 antibody having a binding affinity value (K D ) to human CD3 epsilon higher than 3.4xl0 "8 M as determined by Bio-Layer Interferometry, such as from 3.5xl0 "8 M to 9.9xl0 "8 M, or from l .OxlO "7 M to 9.9xl0 "7 M as determined by Bio-Layer Interferometry.
- K D binding affinity value
- one or both of the antibodies forming part of the bispecific antibody have been engineered to reduce or increase the binding to the neonatal Fc receptor (FcRn) in order to manipulate the serum half-life of the bispecific antibody.
- FcRn neonatal Fc receptor
- Techniques for increasing or reducing the serum half-life are well-known in the art. See for example Dall'Acqua et al. 2006, J. Biol. Chem., 281 : 23514-24; Hinton et al. 2006,J. Immunol., 176: 346-56; and Zalevsky et al. 2010 Nat. Biotechnol., 28: 157-9.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first constant heavy chain (HC) and a first constant light chain (LC), wherein the positions corresponding to positions L234, L235, and D265 in the human IgGl heavy chain of SEQ ID NO : 15 of both the first heavy chain and the second heavy chain are F, E, and A, respectively.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first and second constant heavy chain (HC) and a first and second constant light chain (LC), wherein the positions corresponding to positions L234 and L235 in the human IgGl heavy chain of SEQ ID NO : 15 of both the first heavy chain and the second heavy chain are F and E, respectively.
- the first binding arm is a Fab arm derived from IgGl-huCD3-H lLl-FEAR
- the second binding arm is a Fab arm derived from IgGl-7D8-FEAL.
- huCD3-H lLl refers to the humanized SP34 anti-CD3 antibody having VH 1 and VL1 which are set forth in table 1 as SEQ ID Nos: 6 and 10.
- FEAL refers to L234F, L235E and D265A and F405L mutations in the constant region of the antibody
- FEAR refers to L234F, L235E and D265A and K409R mutations in the constant region of the antibody wherein the amino acid positions corresponds to the amino acid postions of human IgGl .
- IgGl refers to that the antibody constant regions are derived from the human IgGl outside the specified mutations.
- 7D8 refers to the anti-CD20 antibody having the VH and VL sequence set forth in Table 1 as SEQ ID Nos: 27 and 28.
- the first binding arm is a half-molecule antibody derived from IgGl-huCD3- H 1L1-FEAR
- the second binding arm is a half-molecule antibody derived from IgGl- 7D8-FEAL.
- the first binding arm is a Fab arm derived from IgGl-huCD3-H lLl-FEAL
- the second binding arm is a Fab arm derived from IgGl-7D8-FEAR.
- the first binding arm is a half-molecule antibody (i.e. comprising one heavy and one light chain) derived from IgGl-huCD3-H lLl-FEAL
- the second binding arm is a half-molecule antibody (Fab arm and Fc arm) derived from IgGl-7D8-FEAR.
- the bispecific antibody as defined in any of the embodiments disclosed herein comprises a first and second constant heavy chain (HC) and a first and second constant light chain (LC), wherein the positions corresponding to positions L234, L235, and D265 in the human IgGl heavy chain of SEQ ID NO : 15 of both the first constant heavy chain and the second constant heavy chain are F, E, and A, respectively, and wherein the position corresponding to F405 in the human IgGl heavy chain of SEQ ID NO: 15 of the first constant heavy chain is L, and the position corresponding to K409 in the human IgGl heavy chain of SEQ ID NO : 15 of the second constant heavy chain is R, and wherein (i) the positions corresponding to positions F10, T41, K55, and L97 in the lambda light chain of SEQ ID NO: 10 of the first constant light chain are L, K, N, and H, respectively, or (ii) the position corresponding to position T41 in the lambda light chain of SEQ ID NO: 10
- the bispecific antibody of the invention can be of any isotype.
- the choice of isotype typically will be guided by the desired effector functions, such as ADCC induction.
- Exemplary isotypes are IgGl, IgG2, IgG3, and IgG4. Either of the human light chain constant regions, kappa or lambda, may be used.
- the effector function of the antibodies of the present invention may be changed by isotype switching to, e.g., an IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody for various therapeutic uses.
- both Fc-regions of an antibody of the present invention are of the IgGl isotype, for instance an IgGl,K.
- the two Fc-regions of a bispecific antibody are of the IgGl and IgG4 isotypes, respectively.
- the Fc-region may be modified in the hinge and/or CH3 region as described elsewhere herein
- the bispecific antibody of the invention is a full-length antibody, preferably an IgGl antibody, in particular an IgGl,K antibody or a variant thereof.
- the bispecific antibody of the invention comprises an antibody fragment or a single-chain antibody.
- Antibody fragments may e.g. be obtained by fragmentation using conventional techniques, and the fragments screened for utility in the same manner as described herein for whole antibodies.
- F(ab') 2 fragments may be generated by treating an antibody with pepsin. The resulting F(ab') 2 fragment may be treated to reduce disulfide bridges with a reducing agent, such as dithiothreitol, to produce Fab' fragments.
- Fab fragments may be obtained by treating an antibody with papain.
- a F(ab') 2 fragment may also be produced by binding Fab' fragments via a thioether bond or a disulfide bond.
- Antibody fragments may also be generated by expression of nucleic acids encoding such fragments in recombinant cells (see for instance Evans et al., J . Immunol. Meth. 184, 123-38 (1995)).
- a chimeric gene encoding a portion of an F(ab') 2 fragment could include DNA sequences encoding the C H 1 domain and hinge region of the H chain, followed by a translational stop codon to yield such a truncated antibody fragment molecule.
- the bispecific CD3xCD20 antibodies of the invention may also be prepared from single chain antibodies.
- Single chain antibodies are peptides in which the heavy and light chain Fv regions are connected.
- the bispecific antibody of the present invention comprises a single-chain Fv (scFv) wherein the heavy and light chains in the Fv of a CD20 antibody of the present invention are joined with a flexible peptide linker (typically of about 10, 12, 15 or more amino acid residues) in a single peptide chain.
- scFv single-chain Fv
- a flexible peptide linker typically of about 10, 12, 15 or more amino acid residues
- a bispecific antibody can then be formed from two V H and V L from a single-chain CD20 antibody and a single-chain CD3 antibody, or a polyvalent antibody formed from more than two V H and V L chains.
- one or both Fc-regions of the CD3 and CD20 monoclonal antibodies for producing a bispecific antibody of the invention are effector-function- deficient.
- the present invention provides a bispecific CD3xCD20 antibody linked or conjugated to one or more therapeutic moieties, such as a cytokine, an immune- suppressant, an immune-stimulatory molecule and/or a radioisotope.
- therapeutic moieties such as a cytokine, an immune- suppressant, an immune-stimulatory molecule and/or a radioisotope.
- conjugates are referred to herein as “immunoconjugates” or “drug conjugates”.
- Immunoconjugates which include one or more cytotoxins are referred to as "immunotoxins”.
- the first and/or second Fc-region is conjugated to a drug or a prodrug or contains an acceptor group for the same.
- acceptor group may e.g. be an unnatural amino acid.
- the invention relates to a composition comprising a bispecific antibody according to any one of the embodiments disclosed herein.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising :
- the pharmaceutical composition of the present invention may contain one bispecific antibody of the present invention or a combination of different bispecific antibodies of the present invention.
- compositions may be formulated in accordance with conventional techniques such as those disclosed in Remington : The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995.
- a pharmaceutical composition of the present invention may e.g. include diluents, fillers, salts, buffers, detergents (e. g., a nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e. g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
- detergents e. g., a nonionic detergent, such as Tween-20 or Tween-80
- stabilizers e. g., sugars or protein-free amino acids
- preservatives e. g., tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
- Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption delaying agents, and the like that are physiologically compatible with a bispecific antibody of the present invention.
- suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the present invention include water, saline, phosphate buffered saline, ethanol, dextrose, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, carboxymethyl cellulose colloidal solutions, tragacanth gum and injectable organic esters, such as ethyl oleate, and/or various buffers.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions of the present invention may also comprise pharmaceutically acceptable antioxidants for instance (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, lec
- compositions may also comprise isotonicity agents, such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- isotonicity agents such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- the pharmaceutical bispecific antibodies of the present invention may also contain one or more adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
- adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
- the bispecific antibodies of the present invention may be prepared with carriers that will protect the bispecific antibody against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- Such carriers may include gelatin, glyceryl monostearate, glyceryl distearate, biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid alone or with a wax, or other materials well known in the art. Methods for the preparation of such formulations are generally known to those skilled in the art.
- Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above.
- examples of methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- the pharmaceutical composition may be administered by any suitable route and mode.
- a pharmaceutical composition of the present invention is administered parenterally.
- "Administered parenterally" as used herein means modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection and infusion.
- composition is administered by intravenous or subcutaneous injection or infusion.
- the invention relates to the bispecific antibody according to any one of the embodiments disclosed herein, the composition as disclosed herein, or the pharmaceutical composition as disclosed herein for use as a medicament.
- the invention relates to the bispecific antibody according to any one of the embodiments disclosed herein, the composition as disclosed herein, or the pharmaceutical composition as disclosed herein for use in the treatment of a disease.
- the invention relates to a method of treatment of a disease comprising administering the bispecific antibody according to any one of the embodiments disclosed herein, the composition as disclosed herein, or the pharmaceutical composition as disclosed herein to a subject in need thereof.
- the disease is mature B-cell malignancy.
- the disease is cancer, such as NHL or B cell leukemia.
- the bispecific antibodies of the invention may be used for a number of purposes.
- the bispecific antibodies of the invention may be used for the treatment of various forms of cancer, including metastatic cancer and refractory cancer.
- the bispecific antibodies according to the invention may be useful in therapeutic settings in which specific targeting and T cell-mediated killing of cells that express CD20 is desired, and they may be more efficient compared to a regular CD20 antibody in certain such indications and settings.
- the bispecific antibodies of the invention also have additional utility in therapy and diagnosis of a variety of CD20-related diseases.
- the bispecific antibodies can be used to elicit in vivo or in vitro one or more of the following biological activities: to inhibit the growth of and/or differentiation of a cell expressing CD20; to kill a cell expressing CD20; to mediate phagocytosis or ADCC of a cell expressing CD20 in the presence of human effector cells; to mediate CDC of a cell expressing CD20 in the presence of complement; to mediate apoptosis of a cell expressing CD20; and/or to induce translocation into lipid rafts upon binding CD20.
- the bispecific antibodies of the invention can be used to effect T cell-mediated immune responses, inflammation and microenvironment remodelling .
- the bispecific antibodies are used in vivo to treat, prevent or diagnose a variety of CD20-related diseases.
- CD20-related diseases include, among others, B cell lymphoma, e.g ., non-Hodgkin's lymphoma (NHL), B cell leukemia and immune diseases, e.g ., autoimmune diseases, such as those listed below.
- B cell lymphoma e.g ., non-Hodgkin's lymphoma (NHL)
- NHL non-Hodgkin's lymphoma
- immune diseases e.g ., autoimmune diseases, such as those listed below.
- the bispecific antibodies according to the invention are used for the treatment of NHL or B cell leukemia. In one embodiment, the bispecific antibodies according to the invention are used for the treatment of CD20 antibody-resistant NHL or B cell leukemia, such as rituximab- or ofatumumab-resistant NHL or B cell leukemia, e.g. rituximab-resistant non-aggressive B-cell lymphoma.
- the bispecific antibodies according to the invention are used for the treatment of Acute Lymphoblastic Leukemia (ALL), such as relapsed or refractory ALL.
- ALL Acute Lymphoblastic Leukemia
- the bispecific antibodies according to the invention are used for the treatment of CLL, such as relapsed or refractory CLL.
- the bispecific antibodies according to the invention are used for the treatment of FL, such as or relapsed or refractory FL.
- the bispecific antibodies according to the invention are used for the treatment of Adult Grade III Lymphomatoid Granulomatosis; Adult Nasal Type Extranodal NK/T-cell Lymphoma; Anaplastic Large Cell Lymphoma; Angioimmunoblastic T- cell Lymphoma; Contiguous Stage II Adult Burkitt Lymphoma; Contiguous Stage II Adult Diffuse Large Cell Lymphoma; Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma; Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma; Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma; Contiguous Stage II Adult Lymphoblastic Lymphoma; Contiguous Stage II Grade 1 Follicular Lymphoma; Contiguous Stage II Grade 2 Follicular Lymphoma; Contiguous Stage II Grade 3 Follicular Lymphoma; Contiguous Stage II Mantle Cell Lymphoma; Contiguous Stage II Marginal Zone Lymphoma; Contiguous Stage II Small
- NHL is a type of B cell lymphoma.
- Lymphomas e.g., B cell lymphomas
- the normal function of lymphocytes is to defend the body against invaders: germs, viruses, fungi, even cancer.
- malignant lymphocytes can move to many parts of the body.
- lymphoma cells form tumors in the lymphatic system : bone marrow, lymph nodes, spleen, and blood. However, these cells can migrate to other organs. Certain types of lymphoma will tend to grow in locations in which the normal version of the cell resides. For example, it is common for follicular NHL tumors to develop in the lymph nodes.
- CD20 is usually expressed at elevated levels on neoplastic (i.e., tumorigenic) B cells associated with NHL. Accordingly, CD20 binding antibodies of the invention can be used to deplete CD20 bearing tumor cells which lead to NHL and, thus, can be used to prevent or treat this disease.
- the bispecific antibodies of the present invention also can be used to block or inhibit other effects of CD20.
- CD20 is expressed on B lymphocytes and is involved in the proliferation and/or differentiation of these cells. Since B lymphocytes function as immunomodulators, CD20 is an important target for antibody mediated therapy to target B lymphocytes, e.g., to inactivate or kill B lymphocytes, involved in autoimmune disorders.
- autoimmune disorders include, for example, the above listed diseases
- the invention relates to a method for killing a tumor cell expressing CD20, comprising administration, to an individual in need thereof, of an effective amount of a bispecific antibody of the invention.
- the present invention also relates to a method for inhibiting growth and/or proliferation of one or more tumor cells expressing CD20, comprising administration, to an indicidual in need thereof, of a bispecific antibody of the present invention.
- the present invention alto relates to a method for treating cancer, comprising
- the invention relates to the use of a bispecific antibody that binds to human CD3 and human CD20 for the preparation of a medicament for the treatment of cancer, such as one of the specific cancer indications mentioned herein.
- the invention further relates to a bispecific antibody for use in the treatment of cancer, such as one of the cancer indications mentioned above.
- the bispecific antibody is for use in the treatment of mature B-cell malignancies. In one embodiment the bispecific antibody is for use in the treatment of tumors expressing CD20. In one embodiment the bispecific antibody is for use in the treatment of B cell lymphoma. In one embodiment the bispecific antibody is for use in the treatment of B cell lymphoma such as NHL. In one embodiment the bispecific antibody is for use in the treatment of precursor B cell lymphoblastic leukemia. In one embodiment the bispecific antibody is for use in the treatment of B cell chronic lymhocytic leukemia (CLL) . In one embodiment the bispecific antibody is for use in the treatment of small lymphocytic lymphoma (SLL) .
- CLL chronic lymhocytic leukemia
- the bispecific antibody is for use in the treatment of B cell prolymphocytic leukemia.
- the bispecific antibody is for use in the treatment of lymphoplasmacytic lymphoma.
- the bispecific antibody is for use in the treatment of mantle cell lymphoma (MCL) .
- MCL mantle cell lymphoma
- the bispecific antibody is for use in the treatment of follicular lymphoma (FL), including low-grade, intermediate-grade and high-grade FL.
- FL follicular lymphoma
- the bispecific antibody is for use in the treatment of B cell Hodgkin's lymphoma.
- the bispecific antibody is for use in the treatment of immune disorders in which CD20 expressing B cells are involved .
- the bispecific antibody is for use in the treatment of psoriasis.
- the bispecific antibody is for use in the treatment of sclerosis.
- the bispecific antibody is for use in the treatment of inflammatory bowel disease.
- the antibody is bsIgG l-huCD3-H lLl- FEALxCD20-7D8-FEAR, however it may be any of the bispecific CD3xCD20 antibodies disclosed herein .
- the bispecific antibodies of the present invention have numerous in vitro and in vivo diagnostic and therapeutic utilities involving the diagnosis and treatment of disorders involving cells expressing CD20.
- the antibodies can be administered to cells in culture, e.g ., in vitro or ex vivo, or to human subjects, e.g. , in vivo, to treat, prevent and to diagnose a variety of disorders.
- the term "subject" is intended to include human and non-human animals which respond to the bispecific antibodies against CD3 and CD20.
- Preferred subjects include human patients having disorders that can be corrected or ameliorated by inhibiting or controlling B cells (normal or malignant).
- the invention relates to a diagnostic composition comprising a bispecific antibody according to any one of the embodiments as disclosed herein.
- the diagnostic composition is a companion diagnostic which is used to screen and select those patients who will benefit from treatment with the bispecific antibody.
- the bispecific antibodies of the present invention can be used to treat a subject with a tumorigenic disorder, e.g., a disorder characterized by the presence of tumor cells expressing CD20 including, for example, B cell lymphoma, e.g., NHL.
- a tumorigenic disorder e.g., a disorder characterized by the presence of tumor cells expressing CD20 including, for example, B cell lymphoma, e.g., NHL.
- B cell lymphoma e.g., NHL, including precursor B cell lymphoblastic leukemia/lymphoma and mature B cell neoplasms, such as B cell chronic lymhocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), B cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular lymphoma (FL), including low-grade, intermediate-grade and high-grade FL, cutaneous follicle center lymphoma, marginal zone B cell lymphoma (MALT type, nodal and splenic type), hairy cell leukemia, diffuse large B cell lymphoma (DLBCL), Burkitt's lymphoma, plasmacytoma, plasma cell myeloma, post-transplant lymphoproliferative disorder, Waldenstrom's macroglobulinemia, malignant mel
- B cell non-Hodgkin's lymphomas are lymphomatoid granulomatosis, primary effusion lymphoma, intravascular large B cell lymphoma, mediastinal large B cell lymphoma, heavy chain diseases (including ⁇ , ⁇ , and a disease), lymphomas induced by therapy with immunosuppressive agents, such as cyclosporine- induced lymphoma, and methotrexate-induced lymphoma.
- bispecific antibodies of the present invention can be used to treat B cell Hodgkin's lymphoma.
- immune disorders in which CD20 expressing B cells are involved which can be treated and/or prevented include autoimmune disorders, such as psoriasis, psoriatic arthritis, dermatitis, systemic scleroderma and sclerosis, inflammatory bowel disease (IBD), Crohn's disease, ulcerative colitis, respiratory distress syndrome, meningitis, encephalitis (incuding chronic fatigue syndrome/myalgic encephalitis (CFS/ME) and chronic fatigue syndrome/myalgic encephalitis (CFS/ME), uveitis, glomerulonephritis, eczema, asthma, atherosclerosis, leukocyte adhesion deficiency, multiple sclerosis, Raynaud's syndrome, Sjogren's syndrome, juvenile onset diabetes, Reiter's disease, Behget's disease, immune complex nephritis, IgA nephropathy, IgM polyneuropathies, immune-mediated thrombocytopenias,
- inflammatory, immune and/or autoimmune disorders in which autoantibodies and/or excessive B lymphocyte activity are prominent and which can be treated and/or prevented, include the following :
- vasculitides and other vessel disorders such as microscopic polyangiitis, Churg- Strauss syndrome, and other ANCA-associated vasculitides, polyarteritis nodosa, essential cryoglobulinaemic vasculitis, cutaneous leukocytoclastic angiitis, Kawasaki disease, Takayasu arteritis, giant cell arthritis, Henoch-Schonlein purpura, primary or isolated cerebral angiitis, erythema nodosum, thrombangiitis obliterans, thrombotic thrombocytopenic purpura (including hemolytic uremic syndrome), and secondary vasculitides, including cutaneous leukocytoclastic vasculitis (e.g ., secondary to hepatitis B, hepatitis C, Waldenstrom's macroglobulinemia, B-cell neoplasias, rheumatoid arthritis, Sjogren's syndrome, or system
- skin disorders such as contact dermatitis, linear IgA dermatosis, vitiligo, pyoderma gangrenosum, epidermolysis bullosa acquisita, pemphigus vulgaris (including cicatricial pemphigoid and bullous pemphigoid), alopecia areata (including alopecia universalis and alopecia totalis), dermatitis herpetiformis, erythema multiforme, and chronic autoimmune urticaria (including angioneurotic edema and urticarial vasculitis) ;
- immune-mediated cytopenias such as autoimmune neutropenia, and pure red cell aplasia
- connective tissue disorders such as CNS lupus, discoid lupus erythematosus, CREST syndrome, mixed connective tissue disease, polymyositis/dermatomyositis, inclusion body myositis, secondary amyloidosis, cryoglobulinemia type I and type II, fibromyalgia, phospholipid antibody syndrome, secondary hemophilia, relapsing polychondritis, sarcoidosis, stiff man syndrome, and rheumatic fever; further examples are eosinophil fasciitis, myositis, and juvenile dermatomyositis; arthritides, such as ankylosing spondylitis, juvenile chronic arthritis, adult Still's disease, and SAPHO syndrome; further examples are sacroileitis, reactive arthritis, Still's disease, and gout;
- hematologic disorders such as aplastic anemia, primary hemolytic anemia (including cold agglutinin syndrome), hemolytic anemia secondary to CLL or systemic lupus erythematosus; POEMS syndrome, pernicious anemia, and Waldenstrom's purpura hyperglobulinaemica; further examples are agranulocytosis, autoimmune neutropenia, Franklin's disease, Seligmann's disease, ⁇ -chain disease, paraneoplastic syndrome secondary to thymoma and lymphomas, and factor VIII inhibitor formation;
- endocrinopathies such as polyendocrinopathy, and Addison's disease
- further examples are autoimmune hypoglycemia, autoimmune hypothyroidism, autoimmune insulin syndrome, de Quervain's thyroiditis, and insulin receptor antibody-mediated insulin resistance
- autoimmune hypoglycemia autoimmune hypothyroidism
- autoimmune insulin syndrome autoimmune insulin syndrome
- de Quervain's thyroiditis de Quervain's thyroiditis
- insulin receptor antibody-mediated insulin resistance insulin receptor antibody-mediated insulin resistance
- hepato-gastrointestinal disorders such as celiac disease, Whipple's disease, primary biliary cirrhosis, chronic active hepatitis, and primary sclerosing cholangiitis; a further example is autoimmune gastritis;
- nephropathies such as rapid progressive glomerulonephritis, post-streptococcal nephritis, Goodpasture's syndrome, membranous glomerulonephritis, and cryoglobulinemic nephritis; a further example is minimal change disease;
- neurological disorders such as autoimmune neuropathies, mononeuritis multiplex, Lambert-Eaton's myasthenic syndrome, Sydenham's chorea, tabes dorsalis, and Guillain- Barre's syndrome; further examples are myelopathy/tropical spastic paraparesis, myasthenia gravis, acute inflammatory demyelinating polyneuropathy, and chronic inflammatory demyelinating polyneuropathy;
- cardiac and pulmonary disorders such as fibrosing alveolitis, bronchiolitis obliterans, allergic aspergillosis, cystic fibrosis, Loffler's syndrome, myocarditis, and pericarditis; further examples are hypersensitivity pneumonitis, and paraneoplastic syndrome secondary to lung cancer;
- allergic disorders such as bronchial asthma and hyper-IgE syndrome
- a further example is amaurosis fugax
- ophthalmologic disorders such as idiopathic chorioretinitis
- infectious diseases such as parvovirus B infection (including hands-and-socks syndrome) ; and
- gynecological- obstretical disorders such as recurrent abortion, recurrent fetal loss, and intrauterine growth retardation
- a further example is paraneoplastic syndrome secondary to gynaecological neoplasms
- male reproductive disorders such as paraneoplastic syndrome secondary to testicular neoplasms
- transplantation-derived disorders such as allograft and xenograft rejection, and graft-versus-host disease (including chronic graft-versus-host disease) .
- the disease is an inflammatory, immune and/or autoimmune disorder selected from ulcerative colitis, Crohn's disease, juvenile onset diabetes, multiple sclerosis, immune-mediated thrombocytopenias, such as acute idiopathic thrombocytopenic purpura and chronic idiopathic thrombocytopenic purpura, hemolytic anemia (including autoimmune hemolytic anemia), myasthenia gravis, systemic sclerosis, and pemphigus vulgaris.
- the efficacy of the treatment is being monitored during the therapy, e.g . at predefined points in time, by determining tumor burden or CD20 expression levels on the relevant tumor cells.
- Dosage regimens in the above methods of treatment and uses are adjusted to provide the optimum desired response (e.g ., a therapeutic response) .
- a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage.
- An exemplary, non-limiting range for a therapeutically effective amount of a compound of the present invention is about 0.001- 10 mg/kg, such as about 0.001-5 mg/kg, for example about 0.001-2 mg/kg, such as about 0.001- 1 mg/kg, for instance about 0.001, about 0.01, about 0.1, about 1 or about 10 mg/kg .
- Another exemplary, non-limiting range for a therapeutically effective amount of a bispecific antibody of the present invention is about 0.1- 100 mg/kg, such as about 0.1-50 mg/kg, for example about 0.1-20 mg/kg, such as about 0.1- 10 mg/kg, for instance about 0.5, about such as 0.3, about 1, about 3, about 5, or about 8 mg/kg .
- a physician or veterinarian having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required .
- the physician or veterinarian could start doses of the bispecific antibody employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved .
- a suitable daily dose of a bispecific antibody of the present invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect.
- Administration may e.g. be parenteral, such as intravenous, intramuscular or subcutaneous.
- the bispecific antibodies may be administered by infusion in a weekly dosage of calculated by mg/m 2 .
- Such dosages can, for example, be based on the mg/kg dosages provided above according to the following : dose (mg/kg) x 70: 1.8.
- Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours.
- the bispecific antibodies may be administered by slow continuous infusion over a long period, such as more than 24 hours, in order to reduce toxic side effects.
- the bispecific antibodies may be administered in a weekly dosage of calculated as a fixed dose for up to 8 times, such as from 4 to 6 times when given once a week. Such regimen may be repeated one or more times as necessary, for example, after 6 months or 12 months.
- Such fixed dosages can, for example, be based on the mg/kg dosages provided above, with a body weight estimate of 70 kg.
- the dosage may be determined or adjusted by measuring the amount of bispecific antibody of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the CD20 antigen antigen-binding region of the bispecific antibodies of the present invention.
- the bispecific antibodies may be administered as maintenance therapy, such as, e.g., once a week for a period of 6 months or more.
- a bispecific antibody may also be administered prophylactically in order to reduce the risk of developing cancer, delay the onset of the occurrence of an event in cancer progression, and/or reduce the risk of recurrence when a cancer is in remission.
- the bispecific antibodies of the invention may also be administered in combination therapy, i.e., combined with other therapeutic agents relevant for the disease or condition to be treated. Accordingly, in one embodiment, the bispecific antibody-containing medicament is for combination with one or more further therapeutic agents, such as a cytotoxic, chemotherapeutic or anti-angiogenic agent.
- Such combined administration may be simultaneous, separate or sequential.
- the agents may be administered as one composition or as separate compositions, as appropriate.
- the present invention thus also provides methods for treating a disorder involving cells expressing CD20 as described above, which methods comprise administration of a bispecific antibody of the present invention combined with one or more additional therapeutic agents as described below.
- the present invention provides a method for treating a disorder involving cells expressing CD20 in a subject, which method comprises administration of a therapeutically effective amount of a bispecific antibody of the present invention, and optionally at least one additional therapeutic agent, or an antibody binding to a different CD20 epitope than said antibody, to a subject in need thereof.
- the present invention provides a method for treating or preventing cancer, which method comprises administration of a therapeutically effective amount of a bispecific antibody of the present invention and at least one additional therapeutic agent to a subject in need thereof.
- such an additional therapeutic agent may be selected from a tyrosine kinase inhibitor (TKI), such as imatinib (Glivec, Gleevec STI571), ibrutinib (PCI- 32765, Imbruvica) or lapatinib (PTK787/ZK222584).
- TKI tyrosine kinase inhibitor
- such an additional therapeutic agent may be selected from a Bruton tyrosine kinase (BTK) inhibitor, such as ibrutinib.
- BTK Bruton tyrosine kinase
- such an additional therapeutic agent may be selected from a proteasome inhibitor (PI), such as carfilzomib.
- PI proteasome inhibitor
- such an additional therapeutic agent may be selected from a immunomodulatory agent (IMID), such as pomalidomide, thalidomide, or lenalidomide.
- IMID immunomodulatory agent
- such an additional therapeutic agent may be selected from a phosphoinositide 3-kinase inhibitor, such as idelalisib or duvelisib.
- such an additional therapeutic agent may be selected from an aurora A kinase inhibitor, such as alisertib.
- such an additional therapeutic may be selected from a B-cell lymphoma-2 (Bcl-2) inhibitor, such as venetoclax.
- Bcl-2 B-cell lymphoma-2
- such an additional therapeutic may be selected from histone deacytelase (HDAC) inhibitors, such as panobinostat.
- HDAC histone deacytelase
- compositions of the invention also can be administered in combination therapy, i.e., combined with other agents.
- therapeutic agents include one or more chemotherapeutics, from the class of alkylating agents, antimetabolites, mitotic inhibitors, anti-tumor antibiotics, topoisomerase inhibitors or platinum analogs.
- chemotherapeutic agents are doxorubicin (Adriamycin), cisplatin (Platinol), bleomycin (Blenoxane), carmustine (Gliadel), cyclophosphamide (Cytoxan, Procytox, Neosar), bendamustine, and chlorambucil (Leukeran).
- bispecific antibodies of the present invention may be administered in combination with chlorambucil; CHOP (cyclophosphamide,
- such an additional therapeutic agent may be selected from an antimetabolite, such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabine, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine or cladribine.
- an antimetabolite such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabine, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine or cladribine.
- such an additional therapeutic agent may be selected from an alkylating agent, such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin.
- an alkylating agent such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin.
- such an additional therapeutic agent may be selected from an anti-mitotic agent, such as taxanes, for instance docetaxel, and paclitaxel, and vinca alkaloids, for instance vindesine, vincristine, vinblastine, and vinorelbine.
- an anti-mitotic agent such as taxanes, for instance docetaxel, and paclitaxel
- vinca alkaloids for instance vindesine, vincristine, vinblastine, and vinorelbine.
- such an additional therapeutic agent may be selected from a topoisomerase inhibitor, such as topotecan or irinotecan, or a cytostatic drug, such as etoposide and teniposide.
- a topoisomerase inhibitor such as topotecan or irinotecan
- a cytostatic drug such as etoposide and teniposide.
- the present invention provides a method for treating a disorder involving cells expressing CD20 in a subject, which method comprises administration of a therapeutically effective amount of a bispecific antibody of the present invention and at least one inhibitor of angiogenesis, neovascularization, and/or other vascularization to a subject in need thereof
- angiogenesis inhibitors examples include urokinase inhibitors, matrix metalloprotease inhibitors (such as marimastat, neovastat, BAY 12-9566, AG 3340, BMS-275291 and similar agents), inhibitors of endothelial cell migration and proliferation (such as TNP-470, squalamine, 2-methoxyestradiol, combretastatins, endostatin, angiostatin, penicillamine, SCH66336 (Schering-Plough Corp, Madison, NJ), R115777 (Janssen Pharmaceutica, Inc, Titusville, NJ) and similar agents), antagonists of angiogenic growth factors (such as such as ZD6474, SU6668, antibodies against angiogenic agents and/or their receptors (such as VEGF (e.g.
- thalidomide such as CC-5013
- Sugen 5416 such as SU5402
- antiangiogenic ribozyme such as angiozyme
- interferon a such as interferon a2a
- suramin and similar agents antiangiogenic ribozyme
- VEGF-R kinase inhibitors and other anti-angiogenic tyrosine kinase inhibitors (such as SU011248)
- inhibitors of endothelial-specific integrin/survival signaling such as vitaxin and similar agents
- copper antagonists/chelators such as tetrathiomolybdate, captopril and similar agents
- carboxyamido-triazole CAI
- ABT-627 CM 101
- IM862, PNU145156E as well as nucleotide molecules inhibiting angiogenesis (such as antisense-VEGF-
- inhibitors of angiogenesis, neovascularization, and/or other vascularization are anti-angiogenic heparin derivatives (e.g., heperinase III), temozolomide, NK4, macrophage migration inhibitory factor, cyclooxygenase-2 inhibitors, inhibitors of hypoxia-inducible factor 1, anti-angiogenic soy isoflavones, oltipraz, fumagillin and analogs thereof, somatostatin analogues, pentosan polysulfate, tecogalan sodium, dalteparin, tumstatin, thrombospondin, NM-3, combrestatin, canstatin, avastatin, antibodies against other targets, such as anti-alpha-v/beta-3 integrin and anti-kininostatin antibodies.
- heparin derivatives e.g., heperinase III
- temozolomide e.g., temozolomide,
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be an anti-cancer immunogen, such as a cancer antigen/tumor-associated antigen (e.g., epithelial cell adhesion molecule (EpCAM/TACSTDl), mucin 1 (MUC1), carcinoembryonic antigen (CEA), tumor-associated glycoprotein 72 (TAG-72), gplOO, Melan-A, MART-1, KDR, RCAS1, MDA7, cancer-associated viral vaccines (e.g., human papillomavirus vaccines) or tumor-derived heat shock proteins,
- a cancer antigen/tumor-associated antigen e.g., epithelial cell adhesion molecule (EpCAM/TACSTDl), mucin 1 (MUC1), carcinoembryonic antigen (CEA), tumor-associated glycoprotein 72 (TAG-72), gplOO, Melan-A, MART-1, KDR, R
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be an anti-cancer cytokine, chemokine, or combination thereof.
- suitable cytokines and growth factors include IFNy, IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, IL-18, IL-23, IL-24, IL-27, IL-28a, IL-28b, IL-29, KGF, IFNa (e.g., INFa2b), IFNp, GM-CSF, CD40L, Flt3 ligand, stem cell factor, ancestim, and TNFa.
- Suitable chemokines may include Glu-Leu-Arg (ELR)- negative chemokines such as IP-10, MCP-3, MIG, and SDF- ⁇ from the human CXC and C-C chemokine families.
- Suitable cytokines include cytokine derivatives, cytokine variants, cytokine fragments, and cytokine fusion proteins.
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be a cell cycle control/apoptosis regulator (or "regulating agent").
- a cell cycle control/apoptosis regulator may include molecules that target and modulate cell cycle control/apoptosis regulators such as (i) cdc-25 (such as NSC 663284), (ii) cyclin-dependent kinases that overstimulate the cell cycle (such as flavopiridol (L868275, HMR1275), 7-hydroxystaurosporine (UCN-01, KW-2401), and roscovitine (R-roscovitine, CYC202)), and (iii) telomerase modulators (such as BIBR1532, SOT-095, GRN 163 and compositions described in for instance US 6,440,735 and US 6,713,055).
- cdc-25 such as NSC 663284
- Non-limiting examples of molecules that interfere with apoptotic pathways include TNF-related apoptosis-inducing ligand (TRAIL)/apoptosis-2 ligand (Apo-2L), antibodies that activate TRAIL receptors, interferon- ⁇ (IFN- ⁇ ) and anti-sense Bcl-2.
- TRAIL TNF-related apoptosis-inducing ligand
- Apo-2L apoptosis-2 ligand
- IFN- ⁇ interferon- ⁇
- anti-sense Bcl-2 anti-sense Bcl-2.
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be a hormonal regulating agent, such as agents useful for anti-androgen and anti-estrogen therapy.
- hormonal regulating agents are tamoxifen, idoxifene, fulvestrant, droloxifene, toremifene, raloxifene, diethylstilbestrol, ethinyl estradiol/estinyl, an antiandrogene (such as flutaminde/eulexin), a progestin (such as such as hydroxyprogesterone caproate, medroxy- progesterone/provera, megestrol acepate/megace), an adrenocorticosteroid (such as hydrocortisone, prednisone), luteinizing hormone-releasing hormone (and analogs thereof and other LHRH agonists such as buserelin and goserelin), an aroma
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be an immune check-point inhibitor, such as molecules that block the activity of CTLA-4, e.g. ipilimumab, PD-1, e.g. pembrolizumab, PD-L1, TIM3, TIGIT, BTLA, VISTA or LAG-3.
- an immune check-point inhibitor such as molecules that block the activity of CTLA-4, e.g. ipilimumab, PD-1, e.g. pembrolizumab, PD-L1, TIM3, TIGIT, BTLA, VISTA or LAG-3.
- a therapeutic agent for use in combination with a bispecific antibody for treating the disorders as described above may be an anti-cancer nucleic acid or an anti-cancer inhibitory RNA molecule.
- differentiation inducing agents such as all trans retinoic acid, 13-cis retinoic acid and similar agents
- vitamin D analogues such as seocalcitol and similar agents
- anti-cancer agents which may be relevant as therapeutic agents for use in combination with a bispecific antibody according to the invention for treating the disorders as described above are estramustine and epirubicin.
- anti-cancer agents which may be relevant as therapeutic agents for use in combination with a bispecific antibody according to the invention for treating the disorders as described above are a HSP90 inhibitor like 17-allyl amino geld-anamycin, antibodies directed against a tumor antigen such as PSA, CA125, KSA, integrins, e.g. integrin ⁇ , or inhibitors of VCAM.
- anti-cancer agents which may be relevant as therapeutic agents for use in combination with a bispecific antibody for treating the disorders as described above are calcineurin-inhibitors (such as valspodar, PSC 833 and other MDR-1 or p-glycoprotein inhibitors), TOR-inhibitors (such as sirolimus, everolimus and rapamcyin), and inhibitors of "lymphocyte homing" mechanisms (such as FTY720), and agents with effects on cell signaling such as adhesion molecule inhibitors (for instance anti-LFA).
- calcineurin-inhibitors such as valspodar, PSC 833 and other MDR-1 or p-glycoprotein inhibitors
- TOR-inhibitors such as sirolimus, everolimus and rapamcyin
- inhibitors of "lymphocyte homing" mechanisms such as FTY720
- agents with effects on cell signaling such as adhesion molecule inhibitors (for instance anti-LFA).
- the bispecific antibodies may be administered in conjunction with radiotherapy and/or autologous or allogeneic peripheral stem cell or bone marrow transplantation.
- the bispecific antibodies may be administered in combination with one or more antibodies selected from anti-CD25 antibodies, anti-CD19 antibodies, anti-CD20 antibodies (e.g. ofatumumab or rituximab), anti-CD21 antibodies, anti-CD22 antibodies, anti-CD37 antibodies, anti-CD38 antibodies, anti-IL6R antibodies, anti-IL8 antibodies, anti-IL15 antibodies, anti-IL15R antibodies, anti-CD4 antibodies, anti- CDl la antibodies (e.g., efalizumab), anti-alpha-4/beta-l integrin (VLA4) antibodies (e.g., natalizumab), and CTLA4-Ig.
- anti-CD25 antibodies e.g., anti-CD19 antibodies, anti-CD20 antibodies (e.g. ofatumumab or rituximab), anti-CD21 antibodies, anti-CD22 antibodies, anti-CD37 antibodies, anti-CD38 antibodies, anti-IL6R antibodies, anti-IL8 antibodies, anti-IL15
- the bispecific antibodies may be administered in combination with one or more antibodies that block immune checkpoints, such as anti- CTLA-4 (CD152) antibodies, anti-PD-1 (CD279) antibodies, anti-PD-Ll (CD274) antibodies, anti-LAG-3 (CD223) antibodies, anti-TIM3 antibodies, anti-CEACAM l (CD66a) antibodies, anti-VISTA antibodies, anti-TIGIT antibodies, anti-BTLA (CD272) antibodies.
- antibodies that block immune checkpoints such as anti- CTLA-4 (CD152) antibodies, anti-PD-1 (CD279) antibodies, anti-PD-Ll (CD274) antibodies, anti-LAG-3 (CD223) antibodies, anti-TIM3 antibodies, anti-CEACAM l (CD66a) antibodies, anti-VISTA antibodies, anti-TIGIT antibodies, anti-BTLA (CD272) antibodies.
- the bispecific antibodies may be administered in combination with one or more agonistic antibodies which are specific for costimulatory receptors on immune cells, such as anti-4-lBB (CD137) antibodies (e.g. urelumab), anti- OX40 (CD134) antibodies, anti-CD40 antibodies, anti-CD27 antibodies.
- agonistic antibodies which are specific for costimulatory receptors on immune cells, such as anti-4-lBB (CD137) antibodies (e.g. urelumab), anti- OX40 (CD134) antibodies, anti-CD40 antibodies, anti-CD27 antibodies.
- the bispecific antibodies may be administered in combination with one or more type II macrophage depleting or polarizing antibodies, such as anti-CSF-lR (CD115) antibodies.
- type II macrophage depleting or polarizing antibodies such as anti-CSF-lR (CD115) antibodies.
- the bispecific antibodies may be administered in combination with one or more antibodies that bind to molecules involved in regulation of the innate immune system, such as anti-CD47 antibodies, anti-CD200 antibodies, anti-CD200R antibodies, antibodies against killer cell inhibitory receptors (KIRs), antibodies against CD94/NKG2 receptors, anti-CD305 (LAIR1).
- the bispecifc antibodies are administered in combination with one or more antibodies selected from anti-CD19 antibodies, anti-CD21 antibodies, anti-CD22 antibodies, anti-CD37 antibodies, and anti-CD38 antibodies for the treatment of malignant diseases.
- the bispecific antibodies are administered in combination with an anti-CD20 antibody, such as ofatumumab.
- the bispecific antibodies are administered in combination with one or more antibodies selected from anti-IL6R antibodies, anti-IL8 antibodies, anti-IL15 antibodies, anti-IL15R antibodies, anti-CD4 antibodies, anti-CD l la antibodies (e.g ., efalizumab), anti-alpha-4/beta- l integrin (VLA4) antibodies (e.g natali- vonab), and CTLA4-Ig for the treatment of inflammatory diseases.
- the bispecific antibody of the invention is for use in combination with one or more other therapeutic antibodies, such as zanolimumab, daratumumab (Darzalex), ranibizumab, nimotuzumab, panitumumab, hu806, daclizumab (Zenapax), basiliximab (Simulect), infliximab (Remicade), adalimumab (Humira), natalizumab (Tysabri), omalizumab (Xolair), and/or efalizumab (Raptiva) .
- other therapeutic antibodies such as zanolimumab, daratumumab (Darzalex), ranibizumab, nimotuzumab, panitumumab, hu806, daclizumab (Zenapax), basiliximab (Simulect), infliximab (Remicade), adalimum
- the bispecific antibody of the invention is for use in combination with one or more antibody-drug conjugates (ADCs), for example brentuximab- vedotin (Adcetris), inotuzumab ozogamicin (CMC-544), polatuzumab vedotin (RG7593), coltuximab ravtansine (SAR3419), indatuximab ravtansine (BT-062), inotuzumab ozogamicin (CMC-544), denintuzumab mafodotin (SGN-CD 19), polatuzumab vedotin (RG7596) or a CD37-specific antibody drug conjugated (for example IMGN529 or AGS67E) .
- ADCs antibody-drug conjugates
- the bispecific antibody of the invention can be used in combination with an anti-inflammatory or an immunosuppressive agent.
- the combination therapy can include a composition of the present invention with at least one anti-inflammatory agent or at least one immunosuppressive agent.
- such therapeutic agents include one or more anti-inflammatory agents, such as a steroidal drug or a NSAID (nonsteroidal anti-inflammatory drug) .
- Preferred agents include, for example, aspirin and other salicylates, Cox-2 inhibitors, such as celecoxib (Celebrex), NSAIDs such as ibuprofen (Motrin, Advil), fenoprofen (Nalfon), naproxen (Naprosyn), sulindac (Clinoril), diclofenac (Voltaren), piroxicam (Feldene), ketoprofen (Orudis), d iflunisal (Dolobid), nabumetone (Relafen), etodolac (Lodine), oxaprozin (Daypro), and indomethacin (Indocin) .
- Cox-2 inhibitors such as celecoxib (Celebrex)
- NSAIDs such as ibuprofen (Motrin, Advil), fenoprofen (Nalfon), naproxen (Naprosyn), sulindac (C
- such therapeutic agents include one or more DMARDs, such as methotrexate (Rheumatrex), hydroxychloroquine (Plaquenil), sulfasalazine (Asulfidine), pyrimidine synthesis inhibitors, e.g., leflunomide (Arava), IL-1 receptor blocking agents, e.g., anakinra (Kineret), and TNF-a blocking agents, e.g., etanercept (Enbrel), infliximab (Remicade) and adalimumab.
- DMARDs such as methotrexate (Rheumatrex), hydroxychloroquine (Plaquenil), sulfasalazine (Asulfidine), pyrimidine synthesis inhibitors, e.g., leflunomide (Arava), IL-1 receptor blocking agents, e.g., anakinra (Kineret), and
- such therapeutic agents include one or more immunosuppressive agents, such as cyclosporine (Sandimmune, Neoral) and azathioprine (Imural).
- immunosuppressive agents such as cyclosporine (Sandimmune, Neoral) and azathioprine (Imural).
- the bispecific antibodies are administered in combination with an anti-CD25 antibody for the treatment of bullous pemphigoid, e.g., in patients with graft-versus-host disease.
- the present invention provides a method for treating a disorder involving cells expressing CD20 in a subject, which method comprises administration of a therapeutically effective amount of a CD3xCD20 bispecifc antibody of the present invention, and radiotherapy to a subject in need thereof.
- the present invention provides a method for treating or preventing cancer, which method comprises administration of a therapeutically effective amount of a CD3xCD20 bispecific antibody of the present invention, and radiotherapy to a subject in need thereof.
- the present invention provides the use of a bispecific antibody of the present invention, for the preparation of a pharmaceutical composition for treating cancer to be administered in combination with radiotherapy.
- Radiotherapy may comprise radiation or associated administration of radiopharmaceuticals to a patient.
- the source of radiation may be either external or internal to the patient being treated (radiation treatment may, for example, be in the form of external beam radiation therapy (EBRT) or brachytherapy (BT)).
- Radioactive elements that may be used in practicing such methods include, e.g., radium, cesium-137, iridium-192, americium-241, gold-198, cobalt-57, copper-67, technetium-99, iodide-123, iodide-131, and indium-I l l .
- the present invention provides a method for treating or preventing cancer, which method comprises administration to a subject in need thereof of a therapeutically effective amount of a bispecific antibody of the present invention, in combination with surgery. Diagnostic uses
- the invention relates to a diagnostic composition comprising a bispecific CD3xCD20 antibody as defined herein, and to its use.
- the invention relates to a kit for detecting cross-linking between CD3- and CD20-expressing cells, in a sample derived from a patient such as a blood sample, lymph node sample or bone marrow sample, comprising
- the present invention provides a kit for diagnosis of cancer comprising a container comprising a bispecific CD3xCD20 antibody, and one or more reagents for detecting cross-linking of CD20 expressing cells and CD3 expressing cells.
- Reagents may include, for example, fluorescent tags, enzymatic tags, or other detectable tags.
- the reagents may also include secondary or tertiary antibodies or reagents for enzymatic reactions, wherein the enzymatic reactions produce a product that may be visualized.
- the invention relates to a method for detecting whether cross- linking between CD3- and CD20-expressing cells occurs in a sample derived from a patient, such as a blood sample, lymph node sample or bone marrow sample, upon administration of a bispecific antibody according to any one of the embodiments as disclosed herein, comprising the steps of:
- Detection of the complex can be done by methods known in the art, such as by the method disclosed in Example 5.
- the invention relates to an anti-idiotypic antibody which binds to the first antigen-binding region as defined in any one of the embodiments disclosed herein, or which binds to the second antigen-binding region as defined in any one of the embodiments disclosed herein.
- Humanization of a murine CD3 antibody SP34 (US8236,308, described herein as IgGl-CD3) was performed by Antitope (Cambridge, UK) using their improved version of the germline humanization (CDR-grafting) technology (EP0629240).
- CDR-grafting germline humanization
- 4 different VH chains SEQ ID NOs: 6, 7, 8, and 9
- 3 different VL chains SEQ ID NOs: 10, 11, and 12
- the humanized variants are described herein as huCD3.
- humanized variants comprising a VH and a VL according to the invention, are described as, e.g., IgGl-huCD3-H lLl meaning that said specific variant is of the IgGl isotype, is a humanized SP34 CD3-specific antibody and comprises the VH amino acid sequence termed "H I" and is defined according to SEQ ID NO : 6, and the VL amino acid sequence termed "LI" and is defined according to SEQ ID NO : 10.
- H I refers to the variable heavy chain region VH l
- LI refers to the variable light chain region VLl, and so forth.
- the variants IgGl-huCD3-H lLl (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO : 6 and the VLl sequence set forth in SEQ ID NO : 10), IgGl- huCD3-H lL2 (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO: 6 and the VL2 sequence set forth in SEQ ID NO : 11), IgGl-huCD3-H lL3 (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO : 6 and the VL3 sequence set forth in SEQ ID NO : 12), IgGl-huCD3-H3L3 (humanized CD3 comprising the VH3 sequence set forth in SEQ ID NO : 8 and the VL3 sequence set forth in SEQ ID NO : 12), IgGl-huCD3-H4Ll (humanized CD3 comprising the VH4 sequence set forth in SEQ.
- the CD3 antibody comprising the heavy and light chain variable region sequences of huCLB-T3/4 (SEQ ID NOs: 17 and 18, respectively) were used as the first antigen-binding region of the bispecific antibodies according to the invention.
- huCLB- T3/4 is a humanized version of the murine CD3 antibody CLB-T3/4 (Parren et al., Res Immunol. 1991, 142(9) : 749-63). Both sequences (SEQ ID NOs: 17 and 18) were cloned into the relevant pcDNA3.3 (Invitrogen) expression vectors and expressed by cotransfection in HEK293F cells. The resulting CD3 antibody is described as IgGl-huCLB-T3/4.
- the humanized CD3 antibodies are further disclosed in WO2015001085.
- CD20 antibodies used as the second binding arm of the present bispecific antibodies are further disclosed in WO2004035607 (Genmab) and WO2005103081 (Genmab).
- IgGl-CD3 the parental CD3 antibody SP34 having the VH and VL sequences set forth in SEQ ID NO : 25 and SEQ ID NO : 26, respectively.
- IgGl-huCD3 (H 1L1) (having the VH and VL sequences set forth in SEQ ID NO: 6 and SEQ ID NO: 10, respectively)
- bsIgGl-huCD3-H lLl-FEALxbl2-FEAR bispecific antibody using as the second arm the antibody bl2 which is a gpl20 specific antibody (Barbas, CF. J Mol Biol. 1993 Apr 5; 230(3) : 812-23).
- IgGl-7D8 (having the VH and VL sequences set forth in SEQ ID NO : 27 and SEQ ID NO : 28, respectively)
- IgGl-l lB8 (having the VH and VL sequences set forth in SEQ ID NO :40 and SEQ ID NO :41, respectively)
- IgGl-2F2 (having the VH and VL sequences set forth in SEQ ID NO : 37 and SEQ ID NO : 28, respectively)
- IgGl-RTX (having the VH and VL sequences of rituximab)
- IgGl-GAlOl having the VH and VL sequences of obinutuzumab, CHEMBL1743048, US8883980, with a wild type human IgGl Fc domain
- IgGl-2C6 (having the VH and VL sequences set forth in SEQ ID NO:47 and SEQ ID NO :48, respectively).
- Quantitative flow cytometry (QIFIKIT®, Dako; cat. no K0078) was performed as described (Poncelet and Carayon, 1985, J. Immunol. Meth. 85: 65-74), to quantify the binding of 7D8 CD20 antibody on different human B-cell lines used in the examples, as an indication of CD20 expression. To this end, human B-cell lines were incubated with a saturating concentration of 7D8, and the number of bound 7D8 molecules was determined using quantitative flow cytometry.
- the anti-human CD20 antibody 7D8 that was engineered to express a murine Fc domain (10 g/mL, mmIgGl-7D8 (Overdijk et al. 2012, J. Immunol. 189: 3430-3438), was used in this assay.
- B-ALL B cell acute lymphoblastic leukemia
- ABC-DLBCL activated B cell diffuse large B-cell lymphoma
- GC-DLBCL germinal center diffuse large B-cell-lymphoma
- FL follicular lymphoma.
- bispecific antibodies An in vitro method for producing bispecific antibodies is described in WO2008119353 (Genmab) and reported by van der Neut-Kolfschoten et al. (Science. 2007 Sep 14; 317(5844): 1554-7).
- the bispecific antibodies were formed by "Fab-arm” or "half- molecule” exchange (swapping of a heavy chain and attached light chain) between two monospecific IgG4- or IgG4-like antibodies upon incubation under mildly reducing conditions.
- this Fab-arm exchange reaction was the result of a disulfide-bond isomerization reaction wherein the inter heavy-chain disulfide bonds in the hinge regions of monospecific antibodies were reduced and the resulting free cysteines form a new inter heavy-chain disulfide bond with cysteine residues of another antibody molecule with a different specificity.
- the resulting products were bispecific antibodies having two Fab arms with different sequences.
- IgG4 Fab-arm exchange was adapted to generate a method to produce stable IgGl-based bispecific antibodies (WO2011131746 (Genmab)).
- the bispecific antibody product generated by this method described below will no longer participate in IgG4 Fab-arm exchange.
- the basis for this method was the use of complimentary CH3 domains, which promote the formation of heterodimers under specific assay conditions.
- IgGl molecules carrying certain mutations in the CH3 domain were generated : in one of the parental IgGl antibody T350I, K370T and F405L mutations (or minimally F405L) in the other parental IgGl antibody the K409R mutation.
- these two parental antibodies each antibody at a final concentration of 0.5 mg/mL (equimolar concentration), were incubated with 25 mM 2- mercaptoethylamine-HCI (2-MEA) in a total volume of 100 ⁇ _ Tris-EDTA (TE) at 37°C for 90 min.
- the reduction reaction is stopped when the reducing agent 2-MEA is removed by using spin columns (Microcon centrifugal filters, 30k, Millipore) according to the manufacturer's protocol.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Apparatus Associated With Microorganisms And Enzymes (AREA)
Priority Applications (56)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020247014333A KR102712786B1 (ko) | 2015-01-08 | 2016-01-08 | Cd3 및 cd20에 대항한 이중특이적 항체 |
| NZ733531A NZ733531B2 (en) | 2016-01-08 | Bispecific antibodies against cd3 and cd20 | |
| CN202210117824.1A CN114478792A (zh) | 2015-01-08 | 2016-01-08 | 针对cd3和cd20的双特异性抗体 |
| EP16700133.8A EP3242682A1 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
| IL318350A IL318350A (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
| CN201680014755.4A CN107660214B (zh) | 2015-01-08 | 2016-01-08 | 针对cd3和cd20的双特异性抗体 |
| MX2017008875A MX391279B (es) | 2015-01-08 | 2016-01-08 | Anticuerpos biespecíficos contra cd3 y cd20. |
| KR1020247032341A KR20240148942A (ko) | 2015-01-08 | 2016-01-08 | Cd3 및 cd20에 대항한 이중특이적 항체 |
| KR1020177021738A KR102663073B1 (ko) | 2015-01-08 | 2016-01-08 | Cd3 및 cd20에 대항한 이중특이적 항체 |
| EA201791554A EA201791554A1 (ru) | 2015-01-08 | 2016-01-08 | Биспецифичные антитела против cd3 и cd20 |
| US15/541,594 US10544220B2 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against CD3 and CD20 |
| BR112017014551-0A BR112017014551B1 (pt) | 2015-01-08 | 2016-01-08 | Anticorpo, composição farmacêutica, método para detecção da possível ocorrência de reticulação entre células com expressão de cd3 e cd20 em uma amostra derivada de um paciente, e, kit |
| CA2973159A CA2973159A1 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
| UAA201708112A UA120286C2 (uk) | 2015-01-08 | 2016-01-08 | Біспецифічне антитіло проти cd3 і cd20 |
| EP25189898.7A EP4678661A3 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
| AU2016205967A AU2016205967B2 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against CD3 and CD20 |
| SG11201705496SA SG11201705496SA (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
| JP2017536356A JP6853176B2 (ja) | 2015-01-08 | 2016-01-08 | Cd3およびcd20に対する二重特異性抗体 |
| IL289946A IL289946B2 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against CD3 and CD20 |
| IL256562A IL256562B2 (en) | 2015-07-15 | 2016-07-14 | Human CD3 antibodies or chimeras |
| EA201890305A EA201890305A1 (ru) | 2015-07-15 | 2016-07-14 | Гуманизированные или химерные cd3-антитела |
| EP16739459.2A EP3322727B1 (en) | 2015-07-15 | 2016-07-14 | HUMANIZED OR CHIMERICAL ANTI-CD3 ANTIBODIES |
| CA2992380A CA2992380A1 (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric cd3 antibodies |
| PT167394592T PT3322727T (pt) | 2015-07-15 | 2016-07-14 | Anticorpos anti-cd3 humanizados ou quiméricos |
| IL310467A IL310467A (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric cd3 antibodies |
| PCT/EP2016/066845 WO2017009442A1 (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric cd3 antibodies |
| ES16739459T ES3063317T3 (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric cd3 antibodies |
| HK18114771.6A HK1255635A1 (zh) | 2015-07-15 | 2016-07-14 | 人源化或嵌合的cd3抗体 |
| KR1020257009196A KR20250048113A (ko) | 2015-07-15 | 2016-07-14 | 인간화 또는 키메라 cd3 항체 |
| CN202511003204.5A CN120842408A (zh) | 2015-07-15 | 2016-07-14 | 人源化或嵌合cd3抗体 |
| BR112018000696-3A BR112018000696A2 (en) | 2015-07-15 | 2016-07-14 | antibody, methods for reducing and increasing the binding affinity of a human cd3 binding antibody, for treating and diagnosing a disease, for producing an antibody, and for detecting the presence of cd3 antigen, nucleic acid construct, expression vector, host cell, composition, and kit? |
| SI201631947T SI3322727T1 (sl) | 2015-07-15 | 2016-07-14 | Humanizirana ali himerna cd3 protitelesa |
| AU2016293073A AU2016293073B2 (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric CD3 antibodies |
| CN202210585379.1A CN114989302B (zh) | 2015-07-15 | 2016-07-14 | 人源化或嵌合cd3抗体 |
| CN201680054638.0A CN108368172B (zh) | 2015-07-15 | 2016-07-14 | 人源化或嵌合cd3抗体 |
| KR1020187004157A KR102786353B1 (ko) | 2015-07-15 | 2016-07-14 | 인간화 또는 키메라 cd3 항체 |
| UAA201801453A UA128057C2 (uk) | 2015-07-15 | 2016-07-14 | Гуманізоване або химерне антитіло, яке зв'язує cd3 людини |
| FIEP16739459.2T FI3322727T3 (fi) | 2015-07-15 | 2016-07-14 | Humanisoituja tai kimeerisiä CD3-vasta-aineita |
| US15/744,317 US11359015B2 (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric CD3 antibodies |
| NZ778205A NZ778205B2 (en) | 2016-07-14 | Humanized or chimeric CD3 antibodies | |
| NZ778208A NZ778208B2 (en) | 2016-07-14 | Humanized or chimeric CD3 antibodies | |
| NZ739028A NZ739028A (en) | 2015-07-15 | 2016-07-14 | Humanized or chimeric cd3 antibodies |
| JP2018501159A JP2018526981A (ja) | 2015-07-15 | 2016-07-14 | ヒト化またはキメラcd3抗体 |
| MX2018000347A MX395317B (es) | 2015-07-15 | 2016-07-14 | Anticuerpos de grupo de diferenciacion 3 (cd3) humanizados o quimericos. |
| DK16739459.2T DK3322727T3 (da) | 2015-07-15 | 2016-07-14 | Humaniserede eller kimære CD3-antistoffer |
| IL253166A IL253166B (en) | 2015-01-08 | 2017-06-25 | Bispecific antibodies against cd3 and cd20 |
| MX2022011002A MX2022011002A (es) | 2015-07-15 | 2018-01-09 | Anticuerpos de grupo de diferenciacion 3 (cd3) humanizados o quimericos. |
| US16/702,996 US20200199231A1 (en) | 2015-01-08 | 2019-12-04 | Bispecific antibodies against cd3 and cd20 |
| JP2021168124A JP7604351B2 (ja) | 2015-07-15 | 2021-10-13 | ヒト化またはキメラcd3抗体 |
| AU2022200871A AU2022200871B2 (en) | 2015-01-08 | 2022-02-10 | Bispecific antibodies against CD3 and CD20 |
| US17/739,940 US20220389101A1 (en) | 2015-07-15 | 2022-05-09 | Humanized or chimeric cd3 antibodies |
| US17/739,923 US20220380464A1 (en) | 2015-07-15 | 2022-05-09 | Humanized or chimeric cd3 antibodies |
| US17/739,934 US12617854B2 (en) | 2015-07-15 | 2022-05-09 | Humanized or chimeric CD3 antibodies |
| AU2023201733A AU2023201733A1 (en) | 2015-07-15 | 2023-03-20 | Humanized or chimeric CD3 antibodies |
| JP2024216521A JP2025038049A (ja) | 2015-07-15 | 2024-12-11 | ヒト化またはキメラcd3抗体 |
| AU2025213616A AU2025213616A1 (en) | 2015-01-08 | 2025-08-07 | Bispecific antibodies against CD3 and CD20 |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2015/050276 WO2015104346A1 (en) | 2014-01-09 | 2015-01-08 | Humanized or chimeric cd3 antibodies |
| EPPCT/EP2015/050276 | 2015-01-08 | ||
| DKPA201500413 | 2015-07-15 | ||
| DKPA201500412 | 2015-07-15 | ||
| DKPA201500412 | 2015-07-15 | ||
| DKPA201500413 | 2015-07-15 | ||
| DKPA201500415 | 2015-07-16 | ||
| DKPA201500416 | 2015-07-16 | ||
| DKPA201500416 | 2015-07-16 | ||
| DKPA201500415 | 2015-07-16 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/541,594 A-371-Of-International US10544220B2 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against CD3 and CD20 |
| US16/702,996 Division US20200199231A1 (en) | 2015-01-08 | 2019-12-04 | Bispecific antibodies against cd3 and cd20 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016110576A1 true WO2016110576A1 (en) | 2016-07-14 |
Family
ID=56355550
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/050296 Ceased WO2016110576A1 (en) | 2015-01-08 | 2016-01-08 | Bispecific antibodies against cd3 and cd20 |
Country Status (13)
| Country | Link |
|---|---|
| US (2) | US10544220B2 (https=) |
| EP (2) | EP4678661A3 (https=) |
| JP (3) | JP6853176B2 (https=) |
| KR (3) | KR20240148942A (https=) |
| CN (2) | CN114478792A (https=) |
| AU (3) | AU2016205967B2 (https=) |
| CA (1) | CA2973159A1 (https=) |
| EA (1) | EA201791554A1 (https=) |
| IL (3) | IL318350A (https=) |
| MX (2) | MX391279B (https=) |
| SG (1) | SG11201705496SA (https=) |
| UA (1) | UA120286C2 (https=) |
| WO (1) | WO2016110576A1 (https=) |
Cited By (47)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3252078A1 (en) * | 2016-06-02 | 2017-12-06 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
| CN107501412A (zh) * | 2017-10-11 | 2017-12-22 | 深圳精准医疗科技有限公司 | 突变型双特异性抗体及其应用 |
| WO2018060978A3 (fr) * | 2016-09-30 | 2018-05-17 | Centre National De La Recherche Scientifique | Marqueurs cellulaires |
| WO2018093821A1 (en) * | 2016-11-15 | 2018-05-24 | Genentech, Inc. | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibodies |
| WO2018114748A1 (en) * | 2016-12-20 | 2018-06-28 | F. Hoffmann-La Roche Ag | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists |
| WO2018220099A1 (en) * | 2017-06-02 | 2018-12-06 | F. Hoffmann-La Roche Ag | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
| WO2019025545A1 (en) * | 2017-08-04 | 2019-02-07 | Genmab A/S | BINDING AGENTS BINDING TO PD-L1 AND CD137 AND THEIR USE |
| WO2019034580A1 (en) * | 2017-08-14 | 2019-02-21 | Morphosys Ag | HUMANIZED ANTIBODIES FOR CD3 |
| WO2019155008A1 (en) | 2018-02-09 | 2019-08-15 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| WO2019175658A1 (en) * | 2018-03-14 | 2019-09-19 | Novimmune Sa | Anti-cd3 epsilon antibodies and methods of use thereof |
| US10501545B2 (en) | 2015-06-16 | 2019-12-10 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
| US10640572B2 (en) | 2013-12-17 | 2020-05-05 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
| WO2021028587A1 (en) | 2019-08-15 | 2021-02-18 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| US11007267B2 (en) | 2015-06-16 | 2021-05-18 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
| EP3661555A4 (en) * | 2017-08-01 | 2021-07-14 | Ab Studio Inc. | SPECIFIC ANTIBODIES AND USES THEREOF |
| US11084877B2 (en) | 2014-09-12 | 2021-08-10 | Genentech, Inc. | Anti-CLL-1 antibodies and immunoconjugates |
| WO2021185934A1 (en) * | 2020-03-18 | 2021-09-23 | Genmab A/S | Antibodies binding to b7h4 |
| WO2021224499A1 (en) | 2020-05-08 | 2021-11-11 | Genmab A/S | Bispecific antibodies against cd3 and cd20 |
| US11192950B2 (en) | 2015-06-16 | 2021-12-07 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
| WO2022053655A1 (en) | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma |
| WO2022053656A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma |
| WO2022053653A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibodies against cd3 and cd20 for treating chronic lymphocytic leukemia |
| WO2022053658A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2022053654A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2022053657A1 (en) | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| WO2022189667A1 (en) * | 2021-03-12 | 2022-09-15 | Genmab A/S | Non-activating antibody variants |
| EP3928790A4 (en) * | 2019-02-22 | 2023-01-11 | Wuhan Yzy Biopharma Co., Ltd. | CD3 ANTIGEN-BINDING FRAGMENT AND ITS USE |
| EP3967713A4 (en) * | 2019-07-02 | 2023-03-01 | Excelmab Inc. | BISPECIFIC ANTIBODY, METHOD OF PRODUCTION THEREOF AND USE THEREOF |
| WO2023144306A1 (en) | 2022-01-28 | 2023-08-03 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2023144290A1 (en) | 2022-01-28 | 2023-08-03 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2023198839A2 (en) | 2022-04-13 | 2023-10-19 | Genmab A/S | Bispecific antibodies against cd3 and cd20 |
| US11845799B2 (en) | 2019-12-13 | 2023-12-19 | Genentech, Inc. | Anti-Ly6G6D antibodies and methods of use |
| US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US11958906B2 (en) | 2022-04-13 | 2024-04-16 | Genentech, Inc. | Pharmaceutical compositions of mosunetuzumab and methods of use |
| WO2024213754A1 (en) | 2023-04-13 | 2024-10-17 | Genmab A/S | Methods of treating lymphoma with bispecific antibodies against cd3 and cd20 |
| WO2024236031A1 (en) | 2023-05-15 | 2024-11-21 | Genmab A/S | Highly purified epcoritamab compositions |
| WO2024236035A1 (en) | 2023-05-15 | 2024-11-21 | Genmab A/S | Methods of treating cd20 expressing b-cell cancers |
| US12195547B2 (en) | 2021-04-30 | 2025-01-14 | Hoffmann-La Roche Inc. | Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate |
| WO2025064890A1 (en) * | 2023-09-20 | 2025-03-27 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof |
| US12291575B2 (en) | 2021-05-14 | 2025-05-06 | Genentech, Inc. | Methods for treatment of CD20-positive proliferative disorder with mosunetuzumab and polatuzumab vedotin |
| US12351643B2 (en) | 2020-11-04 | 2025-07-08 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
| US12463463B2 (en) | 2019-01-28 | 2025-11-04 | Ab Therapeutics, Inc. | Bispecific antibodies and uses thereof |
| US12492261B2 (en) | 2020-11-04 | 2025-12-09 | Genentech, Inc. | Subcutaneous dosing of anti-CD20/anti-CD3 bispecific antibodies |
| WO2025252962A1 (en) | 2024-06-07 | 2025-12-11 | T-Therapeutics Limited | Tumour-transforming multispecific proteins |
| US12516118B2 (en) | 2020-11-04 | 2026-01-06 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies and anti-CD79b antibody drug conjugates |
| WO2026078231A1 (en) | 2024-10-11 | 2026-04-16 | T-Therapeutics Limited | Soluble non-aggregating immune ligand |
Families Citing this family (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PT3434767T (pt) * | 2010-11-30 | 2026-01-23 | Chugai Pharmaceutical Co Ltd | Agente terapêutico indutor de citotoxicidade |
| CN104736174B (zh) | 2012-07-06 | 2019-06-14 | 根马布私人有限公司 | 具有三重突变的二聚体蛋白质 |
| ME03675B (me) | 2013-07-05 | 2020-10-20 | Genmab As | Humanizovana ili himerna anтi-cd3 antiтela |
| IL256562B2 (en) | 2015-07-15 | 2024-07-01 | Genmab As | Human CD3 antibodies or chimeras |
| IL319047A (en) | 2015-08-28 | 2025-04-01 | Amunix Operating Inc | Chimeric polypeptide composition and methods for its preparation and use |
| CN108395482B (zh) | 2017-02-08 | 2021-02-05 | 西比曼生物科技(香港)有限公司 | 一种靶向cd20抗原嵌合抗原受体的构建及其工程化t细胞的活性鉴定 |
| EP3569617A1 (en) * | 2018-05-18 | 2019-11-20 | Trion Research GmbH | Pharmaceutical preparation for use in treating epstein- barr virus positive patients with reactivation phenomenon- associated diseases |
| CN110540593B (zh) * | 2018-05-29 | 2022-05-17 | 上海药明生物技术有限公司 | 新型的抗cd3/抗cd20双特异性抗体 |
| TW202016144A (zh) * | 2018-06-21 | 2020-05-01 | 日商第一三共股份有限公司 | 包括cd3抗原結合片段之組成物及其用途 |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| CN109836502B (zh) * | 2018-11-12 | 2021-09-07 | 浙江大学 | 一种双特异性抗体及其应用 |
| WO2020229378A1 (en) * | 2019-05-13 | 2020-11-19 | F. Hoffmann-La Roche Ag | Interference-suppressed pharmacokinetic immunoassay |
| CN111100204B (zh) * | 2019-11-26 | 2022-03-11 | 山东立菲生物产业有限公司 | 靶向cd20的抗体、其制备方法和应用 |
| WO2021144315A1 (en) * | 2020-01-13 | 2021-07-22 | Synaffix B.V. | Conjugates of antibodies an immune cell engagers |
| CN113402612A (zh) * | 2020-03-17 | 2021-09-17 | 西比曼生物科技(香港)有限公司 | 靶向cd19和cd20的联合嵌合抗原受体及其应用 |
| US10981996B1 (en) * | 2020-06-01 | 2021-04-20 | Abexxa Biologics, Inc. | Antibodies targeting a complex comprising non-classical HLA-I and neoantigen and their methods of use |
| US11976120B2 (en) * | 2020-06-01 | 2024-05-07 | Boehringer Ingelheim International Gmbh | Antibodies targeting a complex comprising non-classical HLA-I and neoantigen and their methods of use |
| CN112062855B (zh) * | 2020-08-26 | 2024-08-30 | 北京天诺健成医药科技有限公司 | 一种含有衔接器的药物治疗剂的开发和应用 |
| CN114656562B (zh) * | 2020-12-23 | 2023-11-03 | 北京天广实生物技术股份有限公司 | 结合人和猴cd3的抗体及其应用 |
| AU2022214319A1 (en) | 2021-01-28 | 2023-08-03 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for treating cytokine release syndrome |
| WO2022192895A1 (en) * | 2021-03-10 | 2022-09-15 | H. Lee Moffitt Cancer Center And Research Institute Inc. | Compositions and methods to reduce therapeutic t cell toxicity |
| EP4507790A1 (en) | 2022-04-11 | 2025-02-19 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for universal tumor cell killing |
| WO2024102948A1 (en) | 2022-11-11 | 2024-05-16 | Celgene Corporation | Fc receptor-homolog 5 (fcrh5) specific binding molecules and bispecific t-cell engaging antibodies including same and related methods |
| IL321437A (en) * | 2022-12-14 | 2025-08-01 | Evolveimmune Therapeutics Inc | Bispecific antibody fusion molecules and methods for using them |
| CN120857940A (zh) | 2023-02-17 | 2025-10-28 | 瑞泽恩制药公司 | 对cd3/taa双特异性抗体有反应的诱导型nk细胞 |
| KR20250131823A (ko) | 2023-03-31 | 2025-09-03 | 아벨제타 인크. | Cd20 및 bcma를 표적화하는 이중특이적 키메라 항원 수용체 |
| WO2025109119A1 (en) * | 2023-11-22 | 2025-05-30 | Priothera Sas | Methods of treatment with multispecific antigen-binding proteins in combination with s1p receptor modulators |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004035607A2 (en) * | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| WO2007042261A2 (en) * | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| WO2012162067A2 (en) * | 2011-05-21 | 2012-11-29 | Macrogenics, Inc. | Cd3-binding molecules capable of binding to human and non-human cd3 |
| US20140088295A1 (en) * | 2012-09-21 | 2014-03-27 | Regeneron Pharmaceuticals, Inc. | Anti-cd3 antibodies, bispecific antigen-binding molecules that bind cd3 and cd20, and uses thereof |
Family Cites Families (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6077A (en) | 1849-01-30 | Improved hinged claw-wrench | ||
| US835A (en) | 1838-07-12 | X i i i x | ||
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| EP1400536A1 (en) | 1991-06-14 | 2004-03-24 | Genentech Inc. | Method for making humanized antibodies |
| GB9203459D0 (en) | 1992-02-19 | 1992-04-08 | Scotgen Ltd | Antibodies with germ-line variable regions |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| KR970029803A (ko) | 1995-11-03 | 1997-06-26 | 김광호 | 반도체 메모리장치의 프리차지 회로 |
| ATE299938T1 (de) | 1997-05-02 | 2005-08-15 | Genentech Inc | Ein verfahren zur herstellung multispezifischer antikörper die heteromultimere und gemeinsame komponenten besitzen |
| EP1068296B1 (en) | 1998-03-31 | 2011-08-10 | Geron Corporation | Compositions for eliciting an immune response to a telomerase antigen |
| WO2000046147A2 (en) | 1999-02-03 | 2000-08-10 | Biosante Pharmaceuticals, Inc. | Therapeutic calcium phosphate particles and methods of manufacture and use |
| US6281005B1 (en) | 1999-05-14 | 2001-08-28 | Copernicus Therapeutics, Inc. | Automated nucleic acid compaction device |
| AU2002235141A1 (en) | 2000-11-27 | 2002-06-03 | Geron Corporation | Glycosyltransferase vectors for treating cancer |
| US20100081792A1 (en) | 2001-06-28 | 2010-04-01 | Smithkline Beecham Corporation | Ligand |
| JP2006502091A (ja) | 2002-03-01 | 2006-01-19 | イミューノメディクス、インコーポレイテッド | クリアランス速度を高めるための二重特異性抗体点変異 |
| DK2314629T4 (da) | 2002-07-18 | 2023-02-06 | Merus Nv | Rekombinant produktion af blandinger af antistoffer |
| KR20060041205A (ko) | 2003-07-01 | 2006-05-11 | 이뮤노메딕스, 인코오포레이티드 | 양특이성 항체들의 다가 담체들 |
| US9296820B2 (en) | 2003-11-05 | 2016-03-29 | Roche Glycart Ag | Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function |
| US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
| US7850962B2 (en) | 2004-04-20 | 2010-12-14 | Genmab A/S | Human monoclonal antibodies against CD20 |
| US7741568B2 (en) | 2005-01-13 | 2010-06-22 | The Wiremold Company | Downward facing receptacle assembly for cable raceway |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| CA2631184A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| CA2646508A1 (en) | 2006-03-17 | 2007-09-27 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| PT1999154E (pt) | 2006-03-24 | 2013-01-24 | Merck Patent Gmbh | Domínios proteicos heterodiméricos modificados |
| AT503902B1 (de) | 2006-07-05 | 2008-06-15 | F Star Biotech Forsch & Entw | Verfahren zur manipulation von immunglobulinen |
| ES2593484T3 (es) | 2007-03-29 | 2016-12-09 | Genmab A/S | Anticuerpos biespecíficos y métodos de producción de los mismos |
| RS53008B2 (sr) | 2007-04-03 | 2022-12-30 | Amgen Res Munich Gmbh | Interspecijski specifičan cd3-epsilon vezujući domen |
| WO2008145141A1 (en) * | 2007-05-31 | 2008-12-04 | Genmab A/S | Method for extending the half-life of exogenous or endogenous soluble molecules |
| JP5511654B2 (ja) * | 2007-05-31 | 2014-06-04 | ゲンマブ エー/エス | 分子操作により得られた組換え非グリコシル化一価半抗体 |
| WO2008145140A2 (en) * | 2007-05-31 | 2008-12-04 | Genmab A/S | Transgenic animals producing monovalent human antibodies and antibodies obtainable from these animals |
| EP2158221B1 (en) | 2007-06-21 | 2018-08-29 | MacroGenics, Inc. | Covalent diabodies and uses thereof |
| EP2535349A1 (en) | 2007-09-26 | 2012-12-19 | UCB Pharma S.A. | Dual specificity antibody fusions |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| JP6157046B2 (ja) | 2008-01-07 | 2017-07-05 | アムジェン インコーポレイテッド | 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法 |
| WO2010015792A1 (en) | 2008-08-06 | 2010-02-11 | Argenta Discovery Limited | Nitrogen containing heterocyclic compounds useful as bifunctional modulators of m3 receptors and beta-2 receptors |
| EP2352765B1 (en) * | 2008-10-01 | 2018-01-03 | Amgen Research (Munich) GmbH | Cross-species-specific single domain bispecific single chain antibody |
| WO2010059315A1 (en) | 2008-11-18 | 2010-05-27 | Merrimack Pharmaceuticals, Inc. | Human serum albumin linkers and conjugates thereof |
| DK2786762T3 (da) | 2008-12-19 | 2019-05-06 | Macrogenics Inc | Kovalente diabodies og anvendelser deraf |
| WO2010111625A1 (en) | 2009-03-27 | 2010-09-30 | Zymogenetics, Inc. | Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| KR101224468B1 (ko) | 2009-05-20 | 2013-01-23 | 주식회사 파멥신 | 신규한 형태의 이중표적항체 및 그 용도 |
| UY32808A (es) | 2009-07-29 | 2011-02-28 | Abbott Lab | Inmunoglobulinas como dominio variable dual y usos de las mismas |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| US8961967B2 (en) | 2009-11-30 | 2015-02-24 | Janssen Biotech, Inc. | Antibody Fc mutants with ablated effector functions |
| CN102770456B (zh) | 2009-12-04 | 2018-04-06 | 弗·哈夫曼-拉罗切有限公司 | 多特异性抗体、抗体类似物、组合物和方法 |
| CA2785907A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Ron binding constructs and methods of use thereof |
| AR080794A1 (es) | 2010-03-26 | 2012-05-09 | Hoffmann La Roche | Anticuerpos bivalentes biespecificos anti- vegf/ anti-ang-2 |
| HRP20241208T1 (hr) * | 2010-04-20 | 2024-11-22 | Genmab A/S | Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju |
| US9527926B2 (en) | 2010-05-14 | 2016-12-27 | Rinat Neuroscience Corp. | Heterodimeric proteins and methods for producing and purifying them |
| CN103261220B (zh) | 2010-08-16 | 2016-06-15 | 诺夫免疫股份有限公司 | 用于生成多特异性和多价抗体的方法 |
| CN103068847B (zh) | 2010-08-24 | 2019-05-07 | 罗切格利卡特公司 | 可活化的双特异性抗体 |
| CN103068846B9 (zh) | 2010-08-24 | 2016-09-28 | 弗·哈夫曼-拉罗切有限公司 | 包含二硫键稳定性Fv片段的双特异性抗体 |
| ES2758994T3 (es) | 2010-11-05 | 2020-05-07 | Zymeworks Inc | Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc |
| PT3434767T (pt) * | 2010-11-30 | 2026-01-23 | Chugai Pharmaceutical Co Ltd | Agente terapêutico indutor de citotoxicidade |
| AU2012245116A1 (en) * | 2011-04-20 | 2013-11-07 | Genmab A/S | Bispecific antibodies against HER2 and CD3 |
| CN102250246A (zh) | 2011-06-10 | 2011-11-23 | 常州亚当生物技术有限公司 | 抗VEGF/PDGFRβ双特异性抗体及其应用 |
| NO2748201T3 (https=) | 2011-08-23 | 2018-05-12 | ||
| SG11201401422VA (en) | 2011-10-27 | 2014-09-26 | Genmab As | Production of heterodimeric proteins |
| US9248181B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
| CN104736174B (zh) | 2012-07-06 | 2019-06-14 | 根马布私人有限公司 | 具有三重突变的二聚体蛋白质 |
| DK2924052T3 (da) | 2012-11-21 | 2019-09-30 | Pharmabcine Inc | Dual-target-antistof målrettet mod vegfr-2 og dll4, og farmaceutisk sammensætning omfattende samme |
| EP2961773B1 (en) | 2013-02-26 | 2019-03-20 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| EP2961770A1 (en) | 2013-02-26 | 2016-01-06 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| ME03675B (me) | 2013-07-05 | 2020-10-20 | Genmab As | Humanizovana ili himerna anтi-cd3 antiтela |
| WO2015006749A2 (en) * | 2013-07-12 | 2015-01-15 | Zymeworks Inc. | Bispecific cd3 and cd19 antigen binding contructs |
| IL263466B2 (en) * | 2013-12-17 | 2023-10-01 | Genentech Inc | Anti-CD3 antibodies and methods of using them |
| TWI701042B (zh) | 2014-03-19 | 2020-08-11 | 美商再生元醫藥公司 | 用於腫瘤治療之方法及抗體組成物 |
| KR102614189B1 (ko) | 2014-11-17 | 2023-12-18 | 리제너론 파아마슈티컬스, 인크. | Cd3xcd20 이특이적 항체를 이용한 종양의 치료 방법 |
| WO2017210485A1 (en) | 2016-06-01 | 2017-12-07 | Xencor, Inc. | Bispecific antibodies that bind cd20 and cd3 for use in the treatment of lymphoma |
| WO2019034580A1 (en) * | 2017-08-14 | 2019-02-21 | Morphosys Ag | HUMANIZED ANTIBODIES FOR CD3 |
| CA3189883A1 (en) * | 2020-09-10 | 2022-03-17 | Brian Elliott | Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma |
-
2016
- 2016-01-08 US US15/541,594 patent/US10544220B2/en active Active
- 2016-01-08 IL IL318350A patent/IL318350A/en unknown
- 2016-01-08 SG SG11201705496SA patent/SG11201705496SA/en unknown
- 2016-01-08 KR KR1020247032341A patent/KR20240148942A/ko active Pending
- 2016-01-08 JP JP2017536356A patent/JP6853176B2/ja active Active
- 2016-01-08 WO PCT/EP2016/050296 patent/WO2016110576A1/en not_active Ceased
- 2016-01-08 CA CA2973159A patent/CA2973159A1/en active Pending
- 2016-01-08 IL IL289946A patent/IL289946B2/en unknown
- 2016-01-08 UA UAA201708112A patent/UA120286C2/uk unknown
- 2016-01-08 EP EP25189898.7A patent/EP4678661A3/en active Pending
- 2016-01-08 MX MX2017008875A patent/MX391279B/es unknown
- 2016-01-08 EP EP16700133.8A patent/EP3242682A1/en not_active Withdrawn
- 2016-01-08 CN CN202210117824.1A patent/CN114478792A/zh active Pending
- 2016-01-08 AU AU2016205967A patent/AU2016205967B2/en active Active
- 2016-01-08 KR KR1020247014333A patent/KR102712786B1/ko active Active
- 2016-01-08 EA EA201791554A patent/EA201791554A1/ru unknown
- 2016-01-08 KR KR1020177021738A patent/KR102663073B1/ko active Active
- 2016-01-08 CN CN201680014755.4A patent/CN107660214B/zh active Active
-
2017
- 2017-06-25 IL IL253166A patent/IL253166B/en unknown
- 2017-07-04 MX MX2022004082A patent/MX2022004082A/es unknown
-
2019
- 2019-12-04 US US16/702,996 patent/US20200199231A1/en active Pending
-
2021
- 2021-03-11 JP JP2021038857A patent/JP7177317B2/ja active Active
-
2022
- 2022-02-10 AU AU2022200871A patent/AU2022200871B2/en active Active
- 2022-10-07 JP JP2022162493A patent/JP7596342B2/ja active Active
-
2025
- 2025-08-07 AU AU2025213616A patent/AU2025213616A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004035607A2 (en) * | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| WO2007042261A2 (en) * | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| WO2012162067A2 (en) * | 2011-05-21 | 2012-11-29 | Macrogenics, Inc. | Cd3-binding molecules capable of binding to human and non-human cd3 |
| US20140088295A1 (en) * | 2012-09-21 | 2014-03-27 | Regeneron Pharmaceuticals, Inc. | Anti-cd3 antibodies, bispecific antigen-binding molecules that bind cd3 and cd20, and uses thereof |
Cited By (85)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11530275B2 (en) | 2013-12-17 | 2022-12-20 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
| US10640572B2 (en) | 2013-12-17 | 2020-05-05 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
| US11084877B2 (en) | 2014-09-12 | 2021-08-10 | Genentech, Inc. | Anti-CLL-1 antibodies and immunoconjugates |
| US11192950B2 (en) | 2015-06-16 | 2021-12-07 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
| US11007267B2 (en) | 2015-06-16 | 2021-05-18 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
| US11466087B2 (en) | 2015-06-16 | 2022-10-11 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
| US10501545B2 (en) | 2015-06-16 | 2019-12-10 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
| US12030947B2 (en) | 2015-06-16 | 2024-07-09 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| EP3252078A1 (en) * | 2016-06-02 | 2017-12-06 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
| CN110603266A (zh) * | 2016-06-02 | 2019-12-20 | 豪夫迈·罗氏有限公司 | 用于治疗癌症的ii型抗cd20抗体和抗cd20/cd3双特异性抗体 |
| EP3901630A1 (fr) * | 2016-09-30 | 2021-10-27 | Centre national de la recherche scientifique | Marqueurs cellulaires |
| US11125751B2 (en) | 2016-09-30 | 2021-09-21 | Centre National De La Recherche Scientifique | Method for isolating HIV reservoir cells expressing CD32a cell marker |
| JP2019535011A (ja) * | 2016-09-30 | 2019-12-05 | セントレ ナショナル デ ラ レセルシュ シャンティフィク | 細胞マーカー |
| WO2018060978A3 (fr) * | 2016-09-30 | 2018-05-17 | Centre National De La Recherche Scientifique | Marqueurs cellulaires |
| JP7083819B2 (ja) | 2016-09-30 | 2022-06-13 | セントレ ナショナル デ ラ レセルシュ シャンティフィク | 細胞マーカー |
| WO2018093821A1 (en) * | 2016-11-15 | 2018-05-24 | Genentech, Inc. | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibodies |
| US11466094B2 (en) | 2016-11-15 | 2022-10-11 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
| IL267406B1 (en) * | 2016-12-20 | 2025-01-01 | Hoffmann La Roche | Combination therapy of specific antibodies against CD20/CD3 and 4-1BB (CD137) agonists |
| WO2018114748A1 (en) * | 2016-12-20 | 2018-06-28 | F. Hoffmann-La Roche Ag | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists |
| US11718680B2 (en) | 2016-12-20 | 2023-08-08 | Hoffmann-La Roche Inc. | Combination therapy of anti-CD20/anti-CD3 bispecific antibodies and 4-1BB (CD137) agonists |
| IL267406B2 (en) * | 2016-12-20 | 2025-05-01 | Hoffmann La Roche | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists |
| CN110088135A (zh) * | 2016-12-20 | 2019-08-02 | 豪夫迈·罗氏有限公司 | 抗cd20/抗cd3双特异性抗体和4-1bb(cd137)激动剂的组合疗法 |
| WO2018220099A1 (en) * | 2017-06-02 | 2018-12-06 | F. Hoffmann-La Roche Ag | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
| EP3661555A4 (en) * | 2017-08-01 | 2021-07-14 | Ab Studio Inc. | SPECIFIC ANTIBODIES AND USES THEREOF |
| EP4088783A1 (en) * | 2017-08-01 | 2022-11-16 | Ab Studio Inc. | Bispecific antibodies and uses thereof |
| US11440972B2 (en) | 2017-08-01 | 2022-09-13 | Ab Studio Inc. | Bispecific antibodies and uses thereof |
| US12049517B2 (en) | 2017-08-01 | 2024-07-30 | Ab Studio Inc. | Bispecific antibodies and uses thereof |
| US11566083B2 (en) | 2017-08-01 | 2023-01-31 | Ab Studio Inc. | Bispecific antibodies and uses thereof |
| US11459395B2 (en) | 2017-08-04 | 2022-10-04 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| WO2019025545A1 (en) * | 2017-08-04 | 2019-02-07 | Genmab A/S | BINDING AGENTS BINDING TO PD-L1 AND CD137 AND THEIR USE |
| CN111406067B (zh) * | 2017-08-04 | 2022-11-08 | 健玛保 | 与pd-l1和cd137结合的结合剂及其用途 |
| US10968280B2 (en) | 2017-08-04 | 2021-04-06 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| CN111406067A (zh) * | 2017-08-04 | 2020-07-10 | 健玛保 | 与pd-l1和cd137结合的结合剂及其用途 |
| US12570751B2 (en) | 2017-08-04 | 2026-03-10 | Genmab A/S | Binding agents binding to PD-L1 and CD137 and use thereof |
| US11472880B2 (en) | 2017-08-14 | 2022-10-18 | Morphosys Ag | Humanized antibodies for CD3 |
| WO2019034580A1 (en) * | 2017-08-14 | 2019-02-21 | Morphosys Ag | HUMANIZED ANTIBODIES FOR CD3 |
| CN107501412A (zh) * | 2017-10-11 | 2017-12-22 | 深圳精准医疗科技有限公司 | 突变型双特异性抗体及其应用 |
| US12297270B2 (en) | 2018-02-08 | 2025-05-13 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US20210032358A1 (en) * | 2018-02-09 | 2021-02-04 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| JP7326345B2 (ja) | 2018-02-09 | 2023-08-15 | ジェンマブ アクティーゼルスカブ | Cd3及びcd20に対する二重特異性抗体を含む医薬組成物及びそれらの使用 |
| JP2021513571A (ja) * | 2018-02-09 | 2021-05-27 | ジェンマブ アクティーゼルスカブ | Cd3及びcd20に対する二重特異性抗体を含む医薬組成物及びそれらの使用 |
| WO2019155008A1 (en) | 2018-02-09 | 2019-08-15 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| AU2019235523B2 (en) * | 2018-03-14 | 2025-12-18 | Novimmune Sa | Anti-CD3 epsilon antibodies and methods of use thereof |
| WO2019175658A1 (en) * | 2018-03-14 | 2019-09-19 | Novimmune Sa | Anti-cd3 epsilon antibodies and methods of use thereof |
| US11203646B2 (en) | 2018-03-14 | 2021-12-21 | Novimmune Sa | Anti-CD3 epsilon antibodies and methods of use thereof |
| US12463463B2 (en) | 2019-01-28 | 2025-11-04 | Ab Therapeutics, Inc. | Bispecific antibodies and uses thereof |
| EP3928790A4 (en) * | 2019-02-22 | 2023-01-11 | Wuhan Yzy Biopharma Co., Ltd. | CD3 ANTIGEN-BINDING FRAGMENT AND ITS USE |
| US12600791B2 (en) | 2019-07-02 | 2026-04-14 | Excelmab Inc. | Bispecific antibody, preparation method therefor and application thereof |
| EP3967713A4 (en) * | 2019-07-02 | 2023-03-01 | Excelmab Inc. | BISPECIFIC ANTIBODY, METHOD OF PRODUCTION THEREOF AND USE THEREOF |
| US20220411505A1 (en) * | 2019-08-15 | 2022-12-29 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| WO2021028587A1 (en) | 2019-08-15 | 2021-02-18 | Genmab A/S | Pharmaceutical compositions comprising bispecific antibodies directed against cd3 and cd20 and their uses |
| US11845799B2 (en) | 2019-12-13 | 2023-12-19 | Genentech, Inc. | Anti-Ly6G6D antibodies and methods of use |
| WO2021185934A1 (en) * | 2020-03-18 | 2021-09-23 | Genmab A/S | Antibodies binding to b7h4 |
| US11261254B1 (en) | 2020-03-18 | 2022-03-01 | Genmab A/S | Antibodies |
| WO2021224499A1 (en) | 2020-05-08 | 2021-11-11 | Genmab A/S | Bispecific antibodies against cd3 and cd20 |
| US12435154B2 (en) | 2020-05-08 | 2025-10-07 | Genmab A/S | Bispecific antibodies against CD3 and CD20 |
| US11548952B2 (en) | 2020-09-10 | 2023-01-10 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma |
| WO2022053657A1 (en) | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| US11845805B2 (en) | 2020-09-10 | 2023-12-19 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma |
| US11858995B2 (en) | 2020-09-10 | 2024-01-02 | Genmab A/S | Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia |
| US11608383B2 (en) | 2020-09-10 | 2023-03-21 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating follicular lymphoma |
| US11535679B2 (en) | 2020-09-10 | 2022-12-27 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating follicular lymphoma |
| WO2022053655A1 (en) | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma |
| WO2022053656A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma |
| WO2022053653A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibodies against cd3 and cd20 for treating chronic lymphocytic leukemia |
| WO2022053654A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2022053658A1 (en) * | 2020-09-10 | 2022-03-17 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| US12492261B2 (en) | 2020-11-04 | 2025-12-09 | Genentech, Inc. | Subcutaneous dosing of anti-CD20/anti-CD3 bispecific antibodies |
| US12516118B2 (en) | 2020-11-04 | 2026-01-06 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies and anti-CD79b antibody drug conjugates |
| US12351643B2 (en) | 2020-11-04 | 2025-07-08 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
| WO2022189667A1 (en) * | 2021-03-12 | 2022-09-15 | Genmab A/S | Non-activating antibody variants |
| US12195547B2 (en) | 2021-04-30 | 2025-01-14 | Hoffmann-La Roche Inc. | Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate |
| US12291575B2 (en) | 2021-05-14 | 2025-05-06 | Genentech, Inc. | Methods for treatment of CD20-positive proliferative disorder with mosunetuzumab and polatuzumab vedotin |
| WO2023144290A1 (en) | 2022-01-28 | 2023-08-03 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| WO2023144306A1 (en) | 2022-01-28 | 2023-08-03 | Genmab A/S | Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma |
| US11958906B2 (en) | 2022-04-13 | 2024-04-16 | Genentech, Inc. | Pharmaceutical compositions of mosunetuzumab and methods of use |
| WO2023198839A2 (en) | 2022-04-13 | 2023-10-19 | Genmab A/S | Bispecific antibodies against cd3 and cd20 |
| WO2024213754A1 (en) | 2023-04-13 | 2024-10-17 | Genmab A/S | Methods of treating lymphoma with bispecific antibodies against cd3 and cd20 |
| WO2024236035A1 (en) | 2023-05-15 | 2024-11-21 | Genmab A/S | Methods of treating cd20 expressing b-cell cancers |
| WO2024236031A1 (en) | 2023-05-15 | 2024-11-21 | Genmab A/S | Highly purified epcoritamab compositions |
| WO2025064890A1 (en) * | 2023-09-20 | 2025-03-27 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof |
| WO2025252962A1 (en) | 2024-06-07 | 2025-12-11 | T-Therapeutics Limited | Tumour-transforming multispecific proteins |
| WO2026078231A1 (en) | 2024-10-11 | 2026-04-16 | T-Therapeutics Limited | Soluble non-aggregating immune ligand |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2022200871B2 (en) | Bispecific antibodies against CD3 and CD20 | |
| US20240317861A1 (en) | Antibodies against pd-l1 | |
| AU2018242227B2 (en) | Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof | |
| HK40074511A (en) | Bispecific antibodies against cd3 and cd20 | |
| BR122024010593A2 (pt) | Método para produzir um anticorpo biespecífico | |
| BR122024010585A2 (pt) | Uso de um anticorpo biespecífico | |
| BR122024010593B1 (pt) | Método para produzir um anticorpo biespecífico | |
| BR122024010585B1 (pt) | Uso de um anticorpo biespecífico | |
| BR112017014551B1 (pt) | Anticorpo, composição farmacêutica, método para detecção da possível ocorrência de reticulação entre células com expressão de cd3 e cd20 em uma amostra derivada de um paciente, e, kit | |
| HK40021859A (en) | Antibodies against pd-l1 | |
| HK40021859B (en) | Antibodies against pd-l1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16700133 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 253166 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/008875 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15541594 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2973159 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017536356 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201705496S Country of ref document: SG |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017014551 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2016205967 Country of ref document: AU Date of ref document: 20160108 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177021738 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016700133 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201791554 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 112017014551 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170705 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 733531 Country of ref document: NZ |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2016700133 Country of ref document: EP |