WO2016090312A1 - Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof - Google Patents
Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof Download PDFInfo
- Publication number
- WO2016090312A1 WO2016090312A1 PCT/US2015/064102 US2015064102W WO2016090312A1 WO 2016090312 A1 WO2016090312 A1 WO 2016090312A1 US 2015064102 W US2015064102 W US 2015064102W WO 2016090312 A1 WO2016090312 A1 WO 2016090312A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acids
- set forth
- sequence set
- chain variable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/15—Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4256—Tumor associated carbohydrates
- A61K40/4257—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1205—Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10041—Use of virus, viral particle or viral elements as a vector
- C12N2740/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2840/00—Vectors comprising a special translation-regulating system
- C12N2840/20—Vectors comprising a special translation-regulating system translation of more than one cistron
- C12N2840/203—Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES
Definitions
- the presently disclosed subject matter provides for methods and compositions for treating cancer. It relates to chimeric antigen receptors (CARs) that specifically target a G-protein coupled receptor (e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)), immunoresponsive cells comprising such CARs, and methods of using such cells for treating cancer (e.g., multiple myeloma).
- CARs chimeric antigen receptors
- GPRC5D G-protein coupled receptor family C group 5 member D
- T cells and other immune cells may be modified to target tumor antigens through the introduction of genetic material coding for artificial or synthetic receptors for antigen, termed Chimeric Antigen Receptors (CARs), specific to selected antigens.
- CARs Chimeric Antigen Receptors
- MM Multiple myeloma
- GvM immuno-therapeutic graft versus myeloma
- a potentially curative T cell effect may be achieved with minimal toxicity through autologous adoptive T cell therapy.
- Myeloma may be an ideal disease to test adoptive T cell therapy.
- allogeneic transplants demonstrate that the T cell can be a curative treatment, even with minimal or no concomitant chemotherapy such as after non- myeloablative transplants or post-transplantation donor lymphocyte infusions.
- conditioning chemotherapy possibly through the mechanism of depleting regulatory T cells (Tregs), enhances the efficacy of adoptive T cell therapy, 5 ' 13 as such, the immediate post-autologous transplant period could be an optimal time to administer T cells, and myeloma is one of the few diseases where autologous stem cell transplantation is the standard of care.
- the immunomodulatory drug lenalidomide may improve CAR based therapy, as has been shown in mice, 14 and lenalidomide is commonly used to treat MM.
- adoptive T cell therapy works best in bone marrow predominant disease such as ALL, 7 ' 8 when compared to solid tumors or extra-medullary CLL, 5 and similar to ALL, myeloma is a disease of the bone marrow.
- CD19 expression is seen in only 2% of myeloma patients. 15 Furthermore, unlike CD19, the common extracellular immunophenotypic markers in myeloma (CD138, CD38, and CD56) are all co- expressed on other essential cell types, and we predict CARs to any of these targets would lead to unacceptable "off tumor, on target" toxicity which can be fatal even in targets where antibodies are well tolerated, as was the case with a HER2 targeted CAR.
- the presently disclosed subject matter generally provides chimeric antigen receptors (CARs) that specifically target a G-protein coupled receptor, immunoresponsive cells comprising such CARs, and uses of these CARs and immunoresponsive cells for treating multiple myeloma.
- CARs chimeric antigen receptors
- the CAR comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen- binding domain specifically binds to a G-protein coupled receptor.
- the G-protein coupled receptor is a G-protein coupled receptor family C group 5 member D (GPRC5D).
- the extracellular antigen- binding domain specifically binds to GPRC5D with a binding affinity (K D ) of from about 1 x 10 ⁇ 9 M to about 3 x 10 ⁇ 6 M.
- the extracellular antigen -binding domain is a single-chain variable fragment (scFv).
- the extracellular antigen-binding domain is a murine scFv. In certain embodiments, the extracellular antigen-binding domain is a human scFv. In certain embodiments, the extracellular antigen-binding domain is a Fab, which is optionally crosslinked. In certain embodiments, the extracellular binding domain is a F(ab) 2. In certain embodiments, any of the foregoing molecules can be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314,
- the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315,
- the extracellular antigen-binding domain comprises
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386; and (b) a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 9
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53,
- the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54,
- the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386, and conservative modifications thereof, and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387, and conservative modifications thereof.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386.
- the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS:2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58.
- the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
- the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: l, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:2; (b) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:5, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:9, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 10; (d) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 13, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 14; (e) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 17, and a light chain variable region
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66. In yet another embodiment, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
- the extracellular antigen-binding domain comprises both of said heavy and light chains, optionally with a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen- binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the extracellular antigen-binding domain comprises
- a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222, 228, 234, 240, 246, 252, 258, 264, 306, 318, 330, 342, 354, 366, 378, and 390; and (b) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 129, 135, 141, 147, 153, 159, 165, 171, 177, 183, 189, 195, 201, 207, 213, 219, 225, 231, 237, 243, 249, 255, 261, 267, 309, 321, 333, 345, 357, 369, 381, and 393.
- the heavy chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389, and conservative modifications thereof; and (b) the light chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 332, 344, 356, 368, 380, and 392, and conservative modifications thereof.
- the heavy chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; and (b) the light chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof.
- the extracellular antigen-binding domain comprises: (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388; (b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389; (c) a heavy
- the extracellular antigen-binding domain comprises
- a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof;
- a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof;
- a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 202; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 208; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210.
- the extracellular antigen -binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 214; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 220; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 226; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228.
- the extracellular antigen-binding domain comprises: (a) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof; (b) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof; and a light chain variable region CDR3 comprising SEQ ID NO: 135 or conservative modifications thereof; (c) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:
- the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:206; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
- the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:212; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
- the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:218; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
- the extracellular antigen-binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:224; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
- the extracellular antigen-binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:230; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
- the extracellular antigen-binding domain comprises: (a) a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129; (b) a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131; a heavy chain variable region CDR3 comprising amino acids having the sequence set
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:206; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:212; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 214; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 217; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:218; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
- the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 220; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 223; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:224; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
- the extracellular antigen- binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 226; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 229; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:230; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
- the human scFv comprises a heavy chain variable region, a light chain variable region, a linker peptide between the heavy chain variable region and the light chain variable region, and an His-tag and an HA-tag.
- the amino acid sequence of the His-tag and HA-tag comprises the amino acid sequence of SEQ ID NO:275,which is provided below:
- SEQ ID NO: 275 The nucloetide sequence encoding SEQ ID NO: 275 is SEQ ID NO: 276, which is provided below:
- the GPRC5D comprises the amino acid sequence set forth in SEQ ID NO:97.
- the extracellular antigen-binding domain binds to one, two, three or four epitope region selected from the group consisting of an epitope region in N-terminal region comprising amino acids 1-27 of SEQ ID NO:97, an epitope region in ECLl region comprising amino acids 85-93 of SEQ ID NO:97, an epitope region in ECL2 region comprising amino acids 145-167 of SEQ ID NO:97, and an epitope region in ECL3 region comprising amino acids 226- 239 of SEQ ID NO:97.
- the extracellular antigen-binding domain binds to an epitope region comprising amino acids 16-23 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 15-23 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 16-25 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 10-17 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 5-17 of SEQ ID NO:97.
- the extracellular antigen-binding domain binds to an epitope region comprising amino acids 85-95 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 157-164 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 157-167 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 230-237 of SEQ ID NO:97.
- the extracellular antigen-binding domain binds to an epitope region comprising amino acids 229-237 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 230-243 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 227-237 of SEQ ID NO:97.
- the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 16-25 of SEQ ID NO:97, an epitope region comprising amino acids 157-164 of SEQ ID NO:97, and an epitope region comprising amino acids 229-237 of SEQ ID NO:97.
- the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
- the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 5-17 of SEQ ID NO:97, an epitope region comprising amino acids 85-95 of SEQ ID NO:97, and an epitope region comprising amino acids 157-164 of SEQ ID NO:97.
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
- the extracellular antigen-binding domain binds to one or two epitope region selected from the group consisting of an epitope region comprising amino acids 15-23 of SEQ ID NO:97, and an epitope region comprising amino acids 230-243 of SEQ ID NO:97.
- the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
- the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 10-17 of SEQ ID NO:97, an epitope region comprising amino acids 157-167 of SEQ ID NO:97, and an epitope region comprising amino acids 227-237 of SEQ ID NO:97.
- the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
- the extracellular antigen-binding domain is covalently joined to a transmembrane domain.
- the extracellular antigen-binding domain can comprise a signal peptide that is covalently joined to the 5' terminus of the extracellular antigen-binding domain.
- the transmembrane domain of the CAR comprises a CD8 polypeptide, a CD28 polypeptide, a CD3 ⁇ polypeptide, a CD4 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
- the transmembrane domain comprises a CD8 polypeptide.
- the transmembrane domain comprises a CD28 polypeptide.
- the intracellular domain comprises a CD3 ⁇ polypeptide.
- the intracellular domain further comprises at least one signaling region.
- the at least one signaling region comprises a CD28 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP- 10 polypeptide, a PD-1 polypeptide, a CTLA-4 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
- the signaling region is a co-stimulatory signaling region.
- the co-stimulatory signaling region comprises a CD28 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP- 10 polypeptide, or a combination thereof.
- the at least one co-stimulatory signaling region comprises a CD28 polypeptide.
- the at least one co-stimulatory signaling region comprises a 4- IBB polypeptide.
- the transmembrane domain comprises a CD28 polypeptide
- the intracellular domain comprises a CD3 ⁇ polypeptide
- the co-stimulatory signaling domain comprises a CD28 polypeptide.
- the CAR is recombinantly expressed.
- the CAR can be expressed from a vector.
- the vector is a ⁇ -retroviral rector.
- the presently disclosed subject matter also provides isolated immunoresponsive cells comprising the above-described CARs.
- the isolated immunoresponsive cell is transduced with the CAR, for example, the CAR is constitutively expressed on the surface of the immunoresponsive cell.
- the isolated immunoresponsive cell is further transduced with at least one co- stimulatory ligand such that the immunoresponsive cell expresses the at least one co- stimulatory ligand.
- the at least one co-stimulatory ligand is selected from the group consisting of 4-1BBL, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, and combinations thereof.
- the isolated immunoresponsive cell is further transduced with at least one cytokine such that the immunoresponsive cell secrets the at least one cytokine.
- the at least cytokine is selected from the group consisting of IL-2, IL-3, IL-6, IL-7, IL-11, IL-12, IL-15, IL-17, IL-21, and combinations thereof.
- the isolated immunoresponsive cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated.
- the immunoresponsive cell is a T cell.
- nucleic acid molecules encoding the presently disclosed CARs, vectors comprising the nucleic acid molecules, and host cells expressing such nucleic acid molecules.
- the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:397. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:398. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:399. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:400.
- the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:401. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:402. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:403. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:406. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:407. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:408.
- the vector is a ⁇ -retroviral vector.
- the host cell is a T cell.
- the presently disclosed subject matter provides methods of using the above-described immunoresponsive cell for reducing tumor burden in a subject.
- the presently disclosed subject matter provides methods of treating reducing tumor burden in a subject, where the method comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby inducing tumor cell death in the subject.
- the method reduces the number of the number of tumor cells.
- the method reduces tumor size.
- the method eradicates the tumor in the subject.
- the subject is a human.
- the immunoresponsive cell is a T cell.
- the tumor is multiple myeloma or Waldenstrom's Macroglobulinemia.
- the tumor is multiple myeloma.
- the presently disclosed subject matter provides methods of using the above-described immunoresponsive cell for increasing or lengthening survival of a subject having neoplasia.
- the presently disclosed subject matter provides methods of increasing or lengthening survival of a subject having neoplasia, where the method comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby increasing or lengthening survival of the subject.
- the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
- the neoplasia is multiple myeloma.
- the method reduces or eradicates tumor burden in the subject.
- the presently disclosed subject matter also provides methods for producing an immunoresponsive cell that binds to a G-protein coupled receptor.
- the method comprises introducing into the immunoresponsive cell a nucleic acid sequence that encodes a chimeric antigen receptor (CAR), which comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, wherein the extracellular antigen-binding domain specifically binds to a G-protein coupled receptor.
- the G-protein coupled receptor is a G-protein coupled receptor family C group 5 member D (GPRC5D).
- the extracellular antigen-binding domain is an scFv.
- the presently disclosed subject matter further provides pharmaceutical compositions comprising an effective amount of the presently disclosed immunoresponsive cells and a pharmaceutically acceptable excipient.
- the pharmaceutical compositions are for treating a neoplasia.
- the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
- the neoplasia is multiple myeloma.
- kits for treating a neoplasia comprising the presently disclosed immunoresponsive cells.
- the kit further include written instructions for using the immunoresponsive cell for treating a neoplasia.
- the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
- the neoplasia is multiple myeloma.
- Figure 1 shows a chimeric antigen receptor targeting a G-protein coupled receptor in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 2 depicts the human GPRC5D expression in normal tissues and human cancer cell lines.
- Figure 3 depicts the expression of the presently disclosed GPRC5D CAR on human T cells.
- Figure 4 depicts the killing activity of the presently disclosed GPRC5D for 3T3 cells overexpressing GPRC5D.
- Figure 5 depicts the killing activity of the presently disclosed GPRC5D for a human multiple myeloma cell line.
- Figure 6 shows a chimeric antigen receptor targeting GPRC5D in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 7 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 8 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 9 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 10 depicts the cytotoxicity of GPRC5D targeted CAR T cells for human multiple myeloma cell lines.
- Figure 11 depicts induction of cytokine secretion of GPRC5D targeted CAR T cells.
- Figure 12 depicts anti-tumor activity of GPRC5D targeted CAR T cells.
- Figures 13A and 13B depict the killing activity of GPRC5D targeted CAR T cells.
- A Shows the percent of GFP + tumor line at time 0.
- B Shows the killing the percent of GFP + tumor line at time 36 hours.
- FIG 14 illustrates the CLIPS technology.
- the CLIPS reaction takes place between bromo groups of the CLIPS scaffold and thiol sidechains of cysteines. The reaction is fast and specific under mild conditions.
- native protein sequences are transformed into CLIPS constructs with a range of structures. From left to right: two different single T2 loops, T3 double loop, conjugated T2+T3 loops, stabilized beta sheet, and stabilized alpha helix (Timmerman et al., J. Mol. Recognit. 2007; 20: 283-29).
- Figure 15 illustrates combinatorial clips library screening.
- the target protein (left) containing a discontinuous conformational epitope is converted into a matrix library (middle).
- Combinatorial peptides are synthesized on a proprietary minicard and chemically converted into spatially defined CLIPS constructs (right).
- Figure 16 depicts T3 looped CLIPSTM construct.
- Figures 17A-17D illustrates heat map technology.
- A Table of combined peptides, with two sub-sequences indicated as "Loop 1" and "Loop 2".
- B Data from A displayed as a matrix.
- C Color bar indication of the heat map representation.
- D Heat map visualization of data from A.
- Figure 18 shows intensity profiles recorded for ET 150-2. Lines are drawn from the starting residue to the ending residue of a single peptide on the height at which the signal for that peptide is recorded.
- Figure 19 shows heatmap analysis of data recorded for ET 150-5 under high stringency conditions.
- Figure 20 shows intensity profiles recorded for ET150-18.
- Figure 21 shows intensity profiles recorded for ET150-8.
- Figure 22 depicts schematic drawing of GPCR containing seven transmembrane helices (TM) and 3 extracellular regions (ECLs). With colored arrows binding sites for each antibody is depicted.
- TM transmembrane helices
- ECLs extracellular regions
- Figure 23 depicts scatterplot analysis of all data recorded for each sample. On the diagonal is the statistical data distribution.
- Figure 24 depicts FACS analysis of anti-GPRC5D antibodies.
- Figure 25 depicts FACS analysis of anti-GPRC5D antibodies.
- Figure 26 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- Figure 27 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
- the presently disclosed subject matter generally provides chimeric antigen receptors (CARs) targeting a G-protein coupled receptor (e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)).
- CARs chimeric antigen receptors
- a G-protein coupled receptor e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)
- the CAR comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain specifically binds to a G-protein coupled receptor.
- the presently disclosed subject matter also provides immunoresponsive cells (e.g., T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated) expressing the CARs targeting a G- protein coupled receptor, and methods of using such immunoresponsive cells for treating cancer, e.g., multiple myeloma.
- immunoresponsive cells e.g., T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated
- the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
- a cell population refers to a group of at least two cells expressing similar or different phenotypes.
- a cell population can include at least about 10, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000 cells expressing similar or different phenotypes.
- the term “antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab') 2 , and Fab. F(ab') 2 , and Fab fragments that lack the Fe fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983).
- the antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
- single-chain variable fragment or "scFv” is a fusion protein of the variable regions of the heavy (V H ) and light chains (V L ) of an immunoglobulin (e.g., mouse or human) covalently linked to form a V H -VL heterodimer.
- V H variable regions of the heavy
- V L light chains
- an immunoglobulin e.g., mouse or human
- the heavy (V H ) and light chains (V L ) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N- terminus of the V H with the C-terminus of the V L , or the C-terminus of the V H with the N-terminus of the V L -
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility.
- the linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen-binding domain.
- Non-limiting examples of linkers are disclosed in Shen et al., Anal. Chem. 80(6): 1910-1917 (2008) and WO 2014/087010, the contents of which are hereby incorporated by reference in their entireties.
- the linker is a G4S linker.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO: 897 as provided below.
- nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:284 is set forth in SEQ ID NO:285, which is provided below:
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98 as provided below.
- nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:98 is set forth in SEQ ID NO:99, which is provided below:
- Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising V H - and V L -encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Patent Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
- Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 2008 27(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 August 12; Shieh et al., J Imunol2009 183(4):2277-85; Giomarelli et al., Thromb Haemost 2007 97(6):955-63; Fife eta., J Clin Invst 2006 116(8):2252-61; Brocks et al., Immunotechnology 1997 3(3): 173-84; Moosmayer et al., Ther Immunol 1995 2(10:31-40).
- F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- F(ab')2 refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab') (bivalent) regions, wherein each (ab') region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S-S bond for binding an antigen and where the remaining H chain portions are linked together.
- a "F(ab')2" fragment can be split into two individual Fab' fragments.
- vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells.
- vector includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
- expression vector refers to a recombinant nucleic acid sequence, i.e. recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism.
- Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences.
- Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
- CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- affinity is meant a measure of binding strength. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term “avidity,” which refers to the strength of the antigen- antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g., flow cytometry assay) is also reflective of antibody affinity. Antibodies and affinities can be phenotypically characterized and compared using functional assays (e.g., flow cytometry assay).
- Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. By “hybridize” is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
- stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
- concentration of detergent e.g., sodium dodecyl sulfate (SDS)
- SDS sodium dodecyl sulfate
- Various levels of stringency are accomplished by combining these various conditions as needed.
- hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ⁇ g/ml denatured salmon sperm DNA (ssDNA).
- hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
- wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Rogness (Proc. Natl.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
- Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- analog refers to a structurally related polypeptide or nucleic acid molecule having the function of a reference polypeptide or nucleic acid molecule.
- the term "ligand” refers to a molecule that binds to a receptor.
- the ligand binds a receptor on another cell, allowing for cell-to-cell recognition and/or interaction.
- disease refers to any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include neoplasia or pathogen infection of cell.
- an “effective amount” refers to an amount sufficient to have a therapeutic effect.
- an “effective amount” is an amount sufficient to arrest, ameliorate, or inhibit the continued proliferation, growth, or metastasis (e.g., invasion, or migration) of a neoplasia.
- heterologous nucleic acid molecule or polypeptide refers to a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell.
- This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
- the term “immunoresponsive cell” refers to a cell that functions in an immune response or a progenitor, or progeny thereof.
- the term “modulate” refers positively or negatively alter. Exemplary modulations include an about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75%, or about 100% change.
- the term "increase” refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
- the term “reduce” refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
- isolated cell refers to a cell that is separated from the molecular and/or cellular components that naturally accompany the cell.
- the term “isolated,” “purified,” or “biologically pure” refers to material that is free to varying degrees from components which normally accompany it as found in its native state. “Isolate” denotes a degree of separation from original source or surroundings. “Purify” denotes a degree of separation that is higher than isolation.
- a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
- the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
- modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
- secreted is meant a polypeptide that is released from a cell via the secretory pathway through the endoplasmic reticulum, Golgi apparatus, and as a vesicle that transiently fuses at the cell plasma membrane, releasing the proteins outside of the cell.
- the term “specifically binds” or “specifically binds to” or “specifically target” is meant a polypeptide or fragment thereof that recognizes and binds a biological molecule of interest (e.g., a polypeptide), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
- treating refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
- Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
- the term "subject” refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, rodents, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested).
- G protein-coupled receptors also known as seven-transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptor, and G protein-linked receptors, constitute a large protein family of receptors that sense molecules outside the cell and activate inside signal transduction pathways and, ultimately, cellular responses.
- GPCRs can be categorized into six classes based on sequence homology and functional similarity: Class A (Rhodopsin-like), Class B (Secretin receptor family), Class C (Metabotropic glutamate/pheromone), Class D (Fungal mating pheromone receptors), Class E (Cyclic AMP receptors), and Class F (Frizzled/Smoothened).
- the GRPs are Class C GRPs.
- the Class C GRP is a G-protein coupled receptor family C group 5 member D.
- G-protein coupled receptor family C group 5 member D is an orphan receptor with no known ligand or function in humans. It is a member of a family of retinoic acid- inducible G-protein-coupled receptors. It is overexpressed in multiple myeloma (MM) cells and is not expressed or expressed in a significantly lower level in any other cell type, benign or malignant, as shown in Figure 2.
- MM myeloma
- 2- 4 It has been shown that higher mRNA expression correlates with worse overall survival. 1 Surface staining of Bone marrow aspirates from patients with MM demonstrate plasma cell specific staining. 4 To the knowledge of the inventors, this is the first time GPRC5D has been targeted by any therapeutic. Additionally, to the knowledge of the inventors, this is the first time a CAR targeting any G-protein coupled receptor has been generated.
- GPRC5D is human GPRC5D having the amino acid sequence set forth in SEQ ID NO:97, or fragments thereof.
- SEQ ID NO:97 is provided below:
- the N-terminal region of human GPRC5D has amino acids 1-27 of SEQ ID NO:
- the extracellular loop 1 (ECL1) region of human GPRC5D has amino acids 85-93 of SEQ ID NO:97.
- the extracellular loop 2 (ECL2) region of human GPRC5D has amino acids 145-167 of SEQ ID NO:97.
- the extracellular loop 3 (ECL3) region of human GPRC5D has amino acids 226-239 of SEQ ID NO:97.
- Chimeric antigen receptors are engineered receptors, which graft or confer a specificity of interest onto an immune effector cell.
- CARs can be used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
- First generation CARs are typically composed of an extracellular antigen binding domain (e.g., a single-chain variable fragments (scFv)) fused to a transmembrane domain, fused to cytoplasmic/intracellular domain of the T cell receptor chain.
- scFv single-chain variable fragments
- First generation CARs typically have the intracellular domain from the CD3 ⁇ - chain, which is the primary transmitter of signals from endogenous TCRs.
- “First generation” CARs can provide de novo antigen recognition and cause activation of both CD4 + and CD8 + T cells through their CD3 ⁇ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.
- “Second generation” CARs add intracellular domains from various co- stimulatory molecules ⁇ e.g., CD28, 4- IBB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.
- "Second generation” CARs comprise those that provide both co- stimulation (e.g., CD28 or 4- IBB) and activation ⁇ 3 ⁇ ).
- Preclinical studies have indicated that "Second Generation” CARs can improve the anti-tumor activity of T cells. For example, robust efficacy of "Second Generation” CAR modified T cells was demonstrated in clinical trials targeting the CD 19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL).
- “Third generation” CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4- IBB) and activation (CD3Q.
- the CARs comprise an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain binds to a G-protein coupled receptor.
- the G-protein coupled receptor is a GPRC5D.
- the extracellular antigen-binding domain is a scFv.
- the extracellular antigen-binding domain is a Fab, which is optionally crosslinked.
- the extracellular binding domain is a F(ab) 2.
- any of the foregoing molecules may be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
- the extracellular antigen-binding domain of a presently disclsoed CAR has a high binding specificity as well as high binding affinity to the G-protein coupled receptor ⁇ e.g., GPRC5D).
- the extracellular antigen-binding domain of the CAR (embodied, for example, in a scFv or an analog thereof) binds to GPRC5D with a dissociation constant (K D ) of about 3 x 10 "6 M or less.
- the K D is about 1 x 10 "6 M or less, about 1 x 10 "7 M or less, about 1 x 10 "8 M or less, or about 1 x 10 "9 M or less, about 1 x 10 "10 M or less, or about 1 x 10 "11 M or less.
- K D is about 1 x 10 " M or less.
- the K D is from about 1 x 10 "11 M to about 3 x 10 "6 M, such as from about 1 x 10 "11 M to about 1 x 10 "10 M, from about 1 x 10 "10 M to about 1 x 10 "9 M, from about 1 x 10 "9 M to about 1 x 10 "8 M, from about 1 x 10 "8 M to about 1 x 10 "7 M, or from about 1 x 10 "7 M to about 1 x 10 "6 M, or from about 1 x 10 "6 M to about 3 x 10 "6 M.
- the K D is from about 1 x 10 "11 M to about 3 x 10 "6 M, such as from about 1 x 10 "11 M to about 1 x 10 "10 M, from about 1 x 10 "10 M to about 1 x 10 "9 M, from about 1 x 10 "9 M to about 1 x 10 "8 M, from about 1 x 10 "8 M to about 1 x
- the KD is from about 1 x 10 " M to about 1 x 10 " M. In certain embodiments, the KD is from about 1 x 10 "9 M to about 1.5 x 10 "9 M. In certain embodiments, the K D is about 1.2 x 10 "9 M. In certain embodiments, the K D is from about 4 x 10 "9 M to about 5 x 10 "9 M. In certain embodiments, the K D is about 5 x 10 "9 M. In certain embodiments, the KD is about 4.8 x 10 "9 M. In certain embodiments, the KD is from about 8 x 10 "9 M to about 9 x 10 "9 M. In certain embodiments, the KD is about 8 x 10 "9 M. In certain embodiments, the K D is about 8.1 x 10 "9 M
- Binding of the extracellular antigen-binding domain (embodiment, for example, in an scFv or an analog thereof) of a presently disclosed CAR to a G-protein coupled receptor (e.g. , GPRC5D) can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g. , growth inhibition), or Western Blot assay.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS analysis e.g. , FACS analysis
- bioassay e.g. , growth inhibition
- Western Blot assay Each of these assays generally detect the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g. , an antibody, or a scFv) specific for the complex of interest.
- a labeled reagent e.g
- the scFv can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein).
- the radioactive isotope can be detected by such means as the use of a ⁇ counter or a scintillation counter or by autoradiography.
- the GPRC5D-targeted extracellular antigen-binding domain is labeled with a fluorescent marker.
- Non-limiting examples of fluorescent markers include green fluorescent protein (GFP), blue fluorescent protein (e.g., EBFP, EBFP2, Azurite, and mKalamal), cyan fluorescent protein (e.g., ECFP, Cerulean, and CyPet), and yellow fluorescent protein (e.g., YFP, Citrine, Venus, and YPet).
- GFP green fluorescent protein
- blue fluorescent protein e.g., EBFP, EBFP2, Azurite, and mKalamal
- cyan fluorescent protein e.g., ECFP, Cerulean, and CyPet
- yellow fluorescent protein e.g., YFP, Citrine, Venus, and YPet.
- the GPRC5D-targeted human scFv is labeled with GFP.
- the extracellular antigen-binding domain of a presently disclosed CAR comprises a single-chain variable fragment (scFv).
- the extracellular antigen-binding domain of a presently disclosed CAR comprises a human scFv that specifically binds to human GPRC5D.
- the extracellular antigen-binding domain of a presently disclosed CAR comprises a murine scFv that specifically binds to human GPRC5D.
- the scFv are identified by screening scFv phage library with cells (e.g., 3T3 cells) that express GPRC5D.
- the extracellular antigen-binding domain (e.g., scFv) comprises a heavy chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and 93.
- nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and 93 are 3, 7, 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91, and 95, respectively.
- the extracellular antigen-binding domain (e.g., scFv) comprises a light chain variable region comprising amino acids having a sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, and 94.
- the nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, and 94 are 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, and 96, respectively.
- the sequences of SEQ ID NOS: 1-96 are described in the following Tables 1-24.
- the extracellular antigen-binding domain comprises heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences described herein and as disclosed in Tables 1-24.
- the extracellular antigen- binding domain comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93
- the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387.
- the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386; and (b) a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%,
- the presently disclosed subject matter further provides extracellular antigen- binding domains (e.g. , scFv) that comprise heavy chain variable region and light chain variable region CDRs, e.g. , CDRls, CDR2s and CDR3s, as disclosed herein in Tables 1-24.
- the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- the presently disclosed subject matter further provides extracellular antigen-binding domains (e.g. , scFv) that comprise conservative modifications of the antibody sequences disclosed herein.
- an extracellular antigen-binding domains of the presently disclosed subject matter comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences disclosed herein, or conservative modifications thereof, and wherein the extracellular antigen-binding domains retain the desired functional properties.
- the presently disclosed subject matter provides an extracellular antigen-binding domain (e.g.
- scFv comprising a heavy chain variable region
- the heavy chain variable region comprises: (a) a CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377
- the extracellular antigen-binding domain comprises a light chain variable region, wherein the light chain variable region comprises: (a) a CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 33
- the presently disclosed subject matter provides an extracellular antigen- binding domain (e.g. , scFv) comprising a heavy chain variable region comprising CDRl, CDR2, and CDR3 sequences and a light chain variable region comprising CDRl, CDR2, and CDR3 sequences, wherein: (a) the heavy chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222, 228, 234, 240, 246, 252, 258, 264, 306, 318, 330, 342, 354, 366, 378, and 390, and conservative modifications thereof; and (b) the light chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 129, 135, 141, 147, 153, 159, 165, 171, 177, 183
- the heavy chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389, and conservative modifications thereof; and (b) the light chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 332, 344, 356, 368, 380, and 392, and conservative modifications thereof; wherein the extracellular antigen-binding domain specifically binds
- the heavy chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; and (b) the light chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof; wherein the extracellular antigen-binding domain
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 100 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 153 scFv (also referred to as "ET150-3 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 153 scFv also referred to as "ET150-3 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: l and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:2, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 1.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: l, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: l, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:2, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 1 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof, as shown in Table 1.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 101 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 166 scFv (also referred to as "ET150-16 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:6, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 2.
- the extracellular antigen-binding domain is a human scFv.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:5, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:5, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:6, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:5 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135 or conservative modifications thereof, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135 or conservative modifications thereof, as shown in Table 2.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 102 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 170 scFv (also referred to as "ET150-20 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 170 scFv also referred to as "ET150-20 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:9 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 10, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 3.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:9, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:9, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 10, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 10, as shown in Table 3.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:9 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 10, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138 or conservative modifications thereof, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141 or conservative modifications thereof, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141 or conservative modifications thereof, as shown in Table 3.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 103 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 171 scFv (also referred to as "ET150-21 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 13 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 14, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 4.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 13, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 13, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 14, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 14, as shown in Table 4.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 13 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 14, as shown in Table 4.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144 or conservative modifications thereof, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147 or conservative modifications thereof, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147 or conservative modifications thereof, as shown in Table 4.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 104 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 175 scFv (also referred to as "ET150-25 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 175 scFv also referred to as "ET150-25 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 17 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 18, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 5.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 17, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 17, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 18, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 18, as shown in Table 5.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 17 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 18, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth inO SEQ ID NO: 150 or conservative modifications thereof, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 150 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, as shown in Table 5.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 150, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 105 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 154 scFv (also referred to as "ET150-4 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:21 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:22, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 6.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:21, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:21, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:22, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:21 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, as shown in Table 6.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V H AYTFTDYY [SEQ ID INPKSGRT [SEQ ID ARVYGYSRWSGFD
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 106 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 156 scFv (also referred to as "ET150-6 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:25 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:26, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 7.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:25, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:25, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:26, as shown in Table7.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:25 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165 or conservative modifications thereof, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165 or conservative modifications thereof, as shown in Table 7.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- ID NO:160 ID NO: 161] YDR [SEQ ID NO: 162]
- VYYCARGHKVYKSHPTGGYDRWGQGTLVTVSS [SEQ ID NO: 106]
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 107 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 157 scFv (also referred to as "ET150-7 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:29 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:30, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 8.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:29, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:29, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:30, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:29 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168 or conservative modifications thereof, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, as shown in Table 8.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 108 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 159 scFv (also referred to as "ET150-9 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:33 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:34, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 9.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:33, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:33, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:34, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:33 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, as shown in Table 9.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 109 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 160 scFv (also referred to as "ET150-10 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:37 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:38, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 10.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:37, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:37, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:38, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:37 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, as shown in Table 10.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 110 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 161 scFv (also referred to as "ET150-11 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 161 scFv also referred to as "ET150-11 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:41 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:42, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 11.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:41, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:41, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:42, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:41 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, as shown in Table 11.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 111 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 162 scFv (also referred to as "ET150-12 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:45 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:46, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 12.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:45, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:45, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:46, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:45 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192 or conservative modifications thereof, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195 or conservative modifications thereof, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195 or conservative modifications thereof, as shown in Table 12.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 112 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 163 scFv (also referred to as "ET150-13 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:49 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:50, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 13.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:49, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:49, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:50, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:49 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 or conservative modifications thereof, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201 or conservative modifications thereof, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201 or conservative modifications thereof, as shown in Table 13.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 113 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 151 scFv (also referred to as "ET150-1 scFv").
- the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 14.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:53, as shown in Table 14.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:53, as shown in Table 14.
- the extracellular antigen- binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:54, as shown in Table 14.
- the extracellular antigen -binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:53 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14.
- the extracellular antigen- binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:202 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:203 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204 or conservative modifications thereof, as shown in Table 14.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207 or conservative modifications thereof, as shown in Table 14.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207 or conservative modifications thereof, as shown in Table 14.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V H GFTFSSYA [SEQ ID ISGRGRST [SEQ ID ARYYHAGAFDL
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 114 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 152 scFv (also referred to as "ET150-2 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 152 scFv also referred to as "ET150-2 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 15.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:57, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:57, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:58, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:57 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:208 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210 or conservative modifications thereof, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213 or conservative modifications thereof, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213 or conservative modifications thereof, as shown in Table 15.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 115 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 155 scFv (also referred to as "ET150-5 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 155 scFv also referred to as "ET150-5 scFv”
- the extracellular antigen-binding domain is a scFV, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 16.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:61, as shown in Table 16.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:61, as shown in Table 16.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:62, as shown in Table 16.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:61 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:214 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216 or conservative modifications thereof, as shown in Table 16.
- the extracellular antigen- binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219 or conservative modifications thereof, as shown in Table 16.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219 or conservative modifications thereof, as shown in Table 16.
- the extracellular antigen- binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 116 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 158 scFv (also referred to as "ET150-8 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 17.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:65, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:65, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:66, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:65 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:220 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222 or conservative modifications thereof, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225 or conservative modifications thereof, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225 or conservative modifications thereof, as shown in Table 17.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 117 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 168 scFv (also referred to as "ET150-18 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 18.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:69, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:69, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:70, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:70, as shown in Table 18.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:69 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:70, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:226 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228 or conservative modifications thereof, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231 or conservative modifications thereof, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231 or conservative modifications thereof, as shown in Table 18.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 118 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 164 scFv (also referred to as "ET150-14 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:73 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:74, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 19.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:73, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:73, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:74, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:74, as shown in Table 19.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:73 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:74, as shown in Table 19.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:232 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234 or conservative modifications thereof, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237 or conservative modifications thereof, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 232 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237 or conservative modifications thereof, as shown in Table 19.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 232, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 119 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 165 scFv (also referred to as "ET150-15 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:77 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:78, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 20.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:77, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:77, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:78, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:78, as shown in Table 20.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:77 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:78, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:238 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240 or conservative modifications thereof, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243 or conservative modifications thereof, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 238 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243 or conservative modifications thereof, as shown in Table 20.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 238, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 120 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 167 scFv (also referred to as "ET150-17 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 167 scFv also referred to as "ET150-17 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:81 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 82, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 21.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:81, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:81, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 82, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:82, as shown in Table 21.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 81 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:82, as shown in Table 21.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:244 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246 or conservative modifications thereof, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249 or conservative modifications thereof, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 244 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249 or conservative modifications thereof, as shown in Table 21.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 244, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249.
- Table 21
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 121 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 169 scFv (also referred to as "ET150-19 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 85 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 86, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 22.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:85, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:85, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 86, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:86, as shown in Table 22.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 85 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:86, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:250 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252 or conservative modifications thereof, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255 or conservative modifications thereof, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 250 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255 or conservative modifications thereof, as shown in Table 22.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 250, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 122 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 172 scFv (also referred to as "ET150-22 scFv").
- GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
- ET150- 172 scFv also referred to as "ET150-22 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 89 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:90, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 23.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 89, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 89, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:90, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:90, as shown in Table 23.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 89 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:90, as shown in Table 23.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:256 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258 or conservative modifications thereof, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261 or conservative modifications thereof, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 256 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261 or conservative modifications thereof, as shown in Table 23.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 256, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261.
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 123 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 173 scFv (also referred to as "ET150-23 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:93 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:94, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 24.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:93, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:93, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:94, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:94, as shown in Table 24.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:93 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:94, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:262 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264 or conservative modifications thereof, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267 or conservative modifications thereof, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 262 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267 or conservative modifications thereof, as shown in Table 24.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 262, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 f, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- ID NO: 262 NO: 263] ID NO: 264]
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 301 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 024 scFv (also referred to as "ET150-174 scFv").
- ET150- 024 scFv also referred to as "ET150-174 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:302 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:303, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 25.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:302, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:302, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:303, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:303, as shown in Table 25.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:302 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:303, as shown in Table 25.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:304 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:305 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:306 or conservative modifications thereof, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:307 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:308 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:309 or conservative modifications thereof, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 304 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 305 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 306 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 307 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 308 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 309 or conservative modifications thereof, as shown in Table 25.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 304, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 305, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 306, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 307, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 308, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 309.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- ID NO: 304 ID NO: 305] NO: 306]
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 313 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 026 scFv (also referred to as "ET150- 176 scFv").
- ET150- 026 scFv also referred to as "ET150- 176 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:314 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:315, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 26.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:314 as shown in Table 26.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:314, as shown in Table 26.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:315, as shown in Table 26.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:315, as shown in Table 26.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:314 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:315 as shown in Table 26.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:316 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:317 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:318 or conservative modifications thereof, as shown in Table 26.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:319 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:320 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:321 or conservative modifications thereof, as shown in Table 26.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 316 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 317 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 318 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 319 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 320 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 321 or conservative modifications thereof, as shown in Table 26.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 316, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 317, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 318, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 319, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 320, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 321.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V H GFTFSNYA [SEQ ID rfNSGRST [SEQ ID ARVTHRRYGSTFDS
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 325 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 028 scFv (also referred to as "ET150-178 scFv").
- ET150- 028 scFv also referred to as "ET150-178 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:326 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:327, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 27.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:325 as shown in Table 27.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:325, as shown in Table 27.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:326, as shown in Table 27.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:326, as shown in Table 27.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:325 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:327 as shown in Table 27.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:328 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:329 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:330 or conservative modifications thereof, as shown in Table 27.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:331 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:332 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:333 or conservative modifications thereof, as shown in Table 27.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 328 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 329 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 330 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 331 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 332 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 333 or conservative modifications thereof, as shown in Table 27.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 328, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 329, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 330, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 331, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 332, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 333.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V L SSNIGGNT [SEQ ID NO: AAWDASRQGV
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 337 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 029 scFv (also referred to as "ET150- 179 scFv").
- ET150- 029 scFv also referred to as "ET150- 179 scFv”
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:338 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:339, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 28.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:338 as shown in Table 28.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:338, as shown in Table 28.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:339, as shown in Table 28.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:339, as shown in Table 28.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:338 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:339 as shown in Table 28.
- the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:340 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:341 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:342 or conservative modifications thereof, as shown in Table 28.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:343 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:344 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:345 or conservative modifications thereof, as shown in Table 28.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 340 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 341 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 342 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 343 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 344 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 345 or conservative modifications thereof, as shown in Table 28.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 340, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 341, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 342, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 343, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 344, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 345.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V H GFTFSSYA [SEQ ID ISGSGGST [SEQ ID ARKYQDV [SEQ ID NO: 1]
- the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 349 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 030 scFv (also referred to as "ET150-180 scFv").
- the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:350 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:351, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
- the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
- the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 29.
- the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:350 as shown in Table 29.
- the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:350, as shown in Table 29.
- the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:351, as shown in Table 29.
- the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:351, as shown in Table 29.
- the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:350 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:351 as shown in Table 29.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:352 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:353 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:354 or conservative modifications thereof, as shown in Table 29.
- the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:355 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:356 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:357 or conservative modifications thereof, as shown in Table 29.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 352 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 353 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 354 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 355 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 356 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 357 or conservative modifications thereof, as shown in Table 29.
- the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 352, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 353, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 354, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 355, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 356, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 357.
- Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
- V H GFSFSGTA SEQ ISSTGRST [SEQ ID ARPVSSMTLSIQSDG
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (34)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL15865633T PL3227339T3 (pl) | 2014-12-05 | 2015-12-04 | Chimeryczne receptory antygenowe ukierunkowane na receptory sprzężone białka g oraz ich zastosowania |
| CN202410434671.2A CN118271463A (zh) | 2014-12-05 | 2015-12-04 | 靶向g-蛋白偶联受体的嵌合抗原受体及其用途 |
| MYPI2017000855A MY192065A (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| CN202111119531.9A CN113968912B (zh) | 2014-12-05 | 2015-12-04 | 靶向g-蛋白偶联受体的嵌合抗原受体及其用途 |
| MX2017007242A MX385156B (es) | 2014-12-05 | 2015-12-04 | Receptores de antígeno quimérico que se dirigen al receptor acoplado a la proteína g y sus usos. |
| EP21201788.3A EP4015534A1 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| SI201531772T SI3227339T1 (sl) | 2014-12-05 | 2015-12-04 | Himerni antigenski receptorji, ki ciljajo na receptor, povezan z G-proteinom, in njihova uporaba |
| RS20211596A RS62870B1 (sr) | 2014-12-05 | 2015-12-04 | Himerni antigenski receptori sa ciljanim delovanjem na receptore spregnute sa g-proteinom i njihove upotrebe |
| BR112017011920-0A BR112017011920B1 (pt) | 2014-12-05 | 2015-12-04 | Receptores de antígeno quimérico que direcionam receptor acoplado à proteína g, molécula de ácido nucleico, vetor, método in vitro ou ex vivo, composição farmacêutica, kit e usos dos mesmos |
| AU2015357518A AU2015357518B2 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| IL252621A IL252621B2 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| KR1020177018389A KR102612367B1 (ko) | 2014-12-05 | 2015-12-04 | G-단백질 커플화 수용체를 표적화하는 키메라 항원 수용체 및 그의 용도 |
| ES15865633T ES2899779T3 (es) | 2014-12-05 | 2015-12-04 | Receptores antigénicos quiméricos dirigidos a receptor acoplado a proteína G y usos de los mismos |
| SG11201704547RA SG11201704547RA (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| SM20220040T SMT202200040T1 (it) | 2014-12-05 | 2015-12-04 | Recettori chimerici per l'antigene che bersagliano un recettore accoppiato a proteina g e loro usi |
| RU2017123551A RU2762359C2 (ru) | 2014-12-05 | 2015-12-04 | Химерные антигенные рецепторы, нацеленные на рецептор, связанный с g-белками, и их применение |
| CN201580075557.4A CN107428829B (zh) | 2014-12-05 | 2015-12-04 | 靶向g-蛋白偶联受体的嵌合抗原受体及其用途 |
| NZ732574A NZ732574B2 (en) | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof | |
| LTEPPCT/US2015/064102T LT3227339T (lt) | 2014-12-05 | 2015-12-04 | Chimeriniai antigeno receptoriai, nukreipti į receptorių su prijungtu g baltymu ir jų naudojimo būdai |
| DK15865633.0T DK3227339T3 (da) | 2014-12-05 | 2015-12-04 | Kimæriske antigenreceptorer rettet mod g-protein-koblet receptor og anvendelser deraf |
| JP2017529741A JP6919091B2 (ja) | 2014-12-05 | 2015-12-04 | Gタンパク質共役受容体を標的化するキメラ抗原受容体およびその使用 |
| HRP20211978TT HRP20211978T1 (hr) | 2014-12-05 | 2015-12-04 | Kimerični antigenski receptori koji ciljaju receptor spojen na g-protein i njihove uporabe |
| CA2969864A CA2969864A1 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| IL310130A IL310130A (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| EP15865633.0A EP3227339B1 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| SA517381665A SA517381665B1 (ar) | 2014-12-05 | 2017-06-05 | مستقبلات مولد ضد خيمري تستهدف مستقبل مقترن ببروتين واستخداماتها g |
| PH12017501044A PH12017501044A1 (en) | 2014-12-05 | 2017-06-05 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
| US15/613,800 US10633426B2 (en) | 2014-12-05 | 2017-06-05 | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| US16/798,151 US10906956B2 (en) | 2014-12-05 | 2020-02-21 | Methods of treatments using chimeric antigen receptors targeting G-protein coupled receptor |
| US16/798,059 US11820806B2 (en) | 2014-12-05 | 2020-02-21 | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| US16/798,104 US11866478B2 (en) | 2014-12-05 | 2020-02-21 | Nucleic acid molecules encoding chimeric antigen receptors targeting G-protein coupled receptor |
| AU2022200052A AU2022200052A1 (en) | 2014-12-05 | 2022-01-06 | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| CY20221100105T CY1125008T1 (el) | 2014-12-05 | 2022-02-07 | Χιμαιρικοι υποδοχεις αντιγονων που στοχευουν συζευγμενους με πρωτεϊνη g yποδοχεις και χρησεις αυτων |
| US18/517,766 US20240294599A1 (en) | 2014-12-05 | 2023-11-22 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462088286P | 2014-12-05 | 2014-12-05 | |
| US62/088,286 | 2014-12-05 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/613,800 Continuation US10633426B2 (en) | 2014-12-05 | 2017-06-05 | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016090312A1 true WO2016090312A1 (en) | 2016-06-09 |
Family
ID=56092565
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/064102 Ceased WO2016090312A1 (en) | 2014-12-05 | 2015-12-04 | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof |
Country Status (26)
| Country | Link |
|---|---|
| US (5) | US10633426B2 (enExample) |
| EP (2) | EP3227339B1 (enExample) |
| JP (3) | JP6919091B2 (enExample) |
| KR (1) | KR102612367B1 (enExample) |
| CN (4) | CN113968912B (enExample) |
| AU (2) | AU2015357518B2 (enExample) |
| CA (1) | CA2969864A1 (enExample) |
| CY (1) | CY1125008T1 (enExample) |
| DK (1) | DK3227339T3 (enExample) |
| ES (1) | ES2899779T3 (enExample) |
| HR (1) | HRP20211978T1 (enExample) |
| HU (1) | HUE057777T2 (enExample) |
| IL (2) | IL252621B2 (enExample) |
| LT (1) | LT3227339T (enExample) |
| MX (2) | MX385156B (enExample) |
| MY (1) | MY192065A (enExample) |
| PH (1) | PH12017501044A1 (enExample) |
| PL (1) | PL3227339T3 (enExample) |
| PT (1) | PT3227339T (enExample) |
| RS (1) | RS62870B1 (enExample) |
| RU (1) | RU2762359C2 (enExample) |
| SA (1) | SA517381665B1 (enExample) |
| SG (2) | SG11201704547RA (enExample) |
| SI (1) | SI3227339T1 (enExample) |
| SM (1) | SMT202200040T1 (enExample) |
| WO (1) | WO2016090312A1 (enExample) |
Cited By (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018147245A1 (ja) * | 2017-02-07 | 2018-08-16 | 第一三共株式会社 | 抗gprc5d抗体及び該抗体を含む分子 |
| EP3227324A4 (en) * | 2014-12-05 | 2018-08-29 | Memorial Sloan Kettering Cancer Center | Antibodies targeting g-protein coupled receptor and methods of use |
| WO2018200583A1 (en) | 2017-04-26 | 2018-11-01 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
| WO2019032927A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | METHODS FOR PRODUCING GENETICALLY MODIFIED CELL COMPOSITIONS AND COMPOSITIONS THEREOF |
| WO2019032929A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | METHODS AND COMPOSITIONS FOR PREPARING GENETICALLY MODIFIED CELLS |
| US10208285B2 (en) | 2016-10-07 | 2019-02-19 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2019051335A1 (en) | 2017-09-07 | 2019-03-14 | Juno Therapeutics, Inc. | METHODS OF IDENTIFYING CELLULAR CHARACTERISTICS RELATED TO RESPONSES ASSOCIATED WITH CELL THERAPY |
| WO2019089855A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
| WO2019089848A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
| WO2019089858A2 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods of assessing or monitoring a response to a cell therapy |
| WO2019090004A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for producing a t cell composition |
| WO2019099483A1 (en) * | 2017-11-14 | 2019-05-23 | Memorial Sloan-Kettering Cancer Center | Il-36 secreting immunoresponsive cells and uses thereof |
| WO2019109053A1 (en) | 2017-12-01 | 2019-06-06 | Juno Therapeutics, Inc. | Methods for dosing and for modulation of genetically engineered cells |
| WO2019113559A2 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Phenotypic markers for cell therapy and related methods |
| WO2019113557A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Process for producing a composition of engineered t cells |
| WO2019113556A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Serum-free media formulation for culturing cells and methods of use thereof |
| US10358474B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2019191704A1 (en) * | 2018-03-30 | 2019-10-03 | Eureka Therapeutics, Inc. | Constructs targeting cd22 and uses thereof |
| WO2019220368A1 (en) * | 2018-05-16 | 2019-11-21 | Janssen Biotech, Inc. | Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy |
| WO2020033916A1 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Methods for assessing integrated nucleic acids |
| WO2020033927A2 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Processes for generating engineered cells and compositions thereof |
| WO2020092854A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d) |
| WO2020089343A1 (en) | 2018-10-31 | 2020-05-07 | Juno Therapeutics Gmbh | Methods for selection and stimulation of cells and apparatus for same |
| RU2721582C1 (ru) * | 2016-08-05 | 2020-05-20 | И-Байолоджикс Инк. | Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение |
| WO2020113194A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for treatment using adoptive cell therapy |
| WO2020148677A1 (en) * | 2019-01-18 | 2020-07-23 | Janssen Biotech, Inc. | Gprc5d chimeric antigen receptors and cells expressing the same |
| WO2020223571A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods |
| WO2020223535A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods |
| WO2020252218A1 (en) | 2019-06-12 | 2020-12-17 | Juno Therapeutics, Inc. | Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein |
| WO2021035194A1 (en) | 2019-08-22 | 2021-02-25 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods |
| WO2021084050A1 (en) | 2019-10-30 | 2021-05-06 | Juno Therapeutics Gmbh | Cell selection and/or stimulation devices and methods of use |
| US11066475B2 (en) | 2017-11-01 | 2021-07-20 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides |
| WO2021154887A1 (en) | 2020-01-28 | 2021-08-05 | Juno Therapeutics, Inc. | Methods for t cell transduction |
| US11130796B2 (en) | 2017-01-05 | 2021-09-28 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| WO2021231657A1 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Methods of identifying features associated with clinical response and uses thereof |
| WO2021260186A1 (en) | 2020-06-26 | 2021-12-30 | Juno Therapeutics Gmbh | Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods |
| US11242376B2 (en) | 2016-08-02 | 2022-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11299530B2 (en) | 2017-01-05 | 2022-04-12 | Kahr Medical Ltd. | SIRP alpha-CD70 fusion protein and methods of use thereof |
| WO2022098787A1 (en) | 2020-11-04 | 2022-05-12 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods |
| WO2022148370A1 (en) * | 2021-01-05 | 2022-07-14 | Lanova Medicines Development Co., Ltd. | Anti-gprc5d monoclonal antibodies and uses thereof |
| WO2022187406A1 (en) | 2021-03-03 | 2022-09-09 | Juno Therapeutics, Inc. | Combination of a t cell therapy and a dgk inhibitor |
| WO2022204071A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Method to assess potency of viral vector particles |
| WO2022204070A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Methods of determining potency of a therapeutic cell composition |
| WO2022234009A2 (en) | 2021-05-06 | 2022-11-10 | Juno Therapeutics Gmbh | Methods for stimulating and transducing t cells |
| US11566060B2 (en) | 2017-01-05 | 2023-01-31 | Kahr Medical Ltd. | PD1-CD70 fusion protein and methods of use thereof |
| US11623961B2 (en) | 2017-11-01 | 2023-04-11 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for B-cell maturation antigen |
| WO2023079494A1 (en) | 2021-11-03 | 2023-05-11 | Janssen Biotech, Inc. | Corticosteriod reduction in treatment with anti-cd38 antibodies |
| US11702458B2 (en) | 2017-01-05 | 2023-07-18 | Kahr Medical Ltd. | PD1-41BBL fusion protein and methods of use thereof |
| WO2023147515A1 (en) | 2022-01-28 | 2023-08-03 | Juno Therapeutics, Inc. | Methods of manufacturing cellular compositions |
| WO2023213969A1 (en) | 2022-05-05 | 2023-11-09 | Juno Therapeutics Gmbh | Viral-binding protein and related reagents, articles, and methods of use |
| WO2023220655A1 (en) | 2022-05-11 | 2023-11-16 | Celgene Corporation | Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy |
| US11820806B2 (en) | 2014-12-05 | 2023-11-21 | Memorial Sloan-Kettering Cancer Center | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| WO2023230581A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Methods of manufacturing t cell therapies |
| US11851491B2 (en) | 2016-11-22 | 2023-12-26 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2024007020A1 (en) | 2022-06-30 | 2024-01-04 | Indapta Therapeutics, Inc. | Combination of engineered natural killer (nk) cells and antibody therapy and related methods |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| WO2024031091A2 (en) | 2022-08-05 | 2024-02-08 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for gprc5d and bcma |
| WO2024054944A1 (en) | 2022-09-08 | 2024-03-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing |
| WO2024100604A1 (en) | 2022-11-09 | 2024-05-16 | Juno Therapeutics Gmbh | Methods for manufacturing engineered immune cells |
| WO2024161021A1 (en) | 2023-02-03 | 2024-08-08 | Juno Therapeutics Gmbh | Methods for non-viral manufacturing of engineered immune cells |
| WO2024220588A1 (en) | 2023-04-18 | 2024-10-24 | Juno Therapeutics, Inc. | Cytotoxicity assay for assessing potency of therapeutic cell compositions |
| US12134638B2 (en) | 2018-07-11 | 2024-11-05 | Kahr Medical Ltd. | SIRPalpha-4-1BBL variant fusion protein and methods of use thereof |
| WO2024243365A2 (en) | 2023-05-23 | 2024-11-28 | Juno Therapeutics, Inc. | Activation markers of t cells and method for assessing t cell activation |
| EP4520346A1 (en) * | 2023-09-06 | 2025-03-12 | Gyncentrum Sp. z o.o. | Cells, methods and systems for use in the treatment of a cancer with dual-car-t |
| WO2025059362A1 (en) | 2023-09-13 | 2025-03-20 | Juno Therapeutics, Inc. | Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| WO2025076472A1 (en) | 2023-10-06 | 2025-04-10 | Juno Therapeutics, Inc. | Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses |
| US12286466B2 (en) | 2018-07-11 | 2025-04-29 | Kahr Medical Ltd. | PD1-4-1BBL variant fusion protein and methods of use thereof |
| WO2025147545A1 (en) | 2024-01-03 | 2025-07-10 | Juno Therapeutics, Inc. | Lipid nanoparticles for delivery of nucleic acids and related methods and uses |
| US12473345B2 (en) | 2018-11-01 | 2025-11-18 | Juno Therapeutics, Inc. | Methods for treatment using chimeric antigen receptors specific for B-cell maturation antigen |
Families Citing this family (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7672340B2 (ja) * | 2018-10-19 | 2025-05-07 | メモリアル スローン ケタリング キャンサー センター | シアリルルイスaを標的とするキメラ抗原受容体およびその使用 |
| US10980836B1 (en) | 2019-12-11 | 2021-04-20 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| MX2022012685A (es) | 2020-04-10 | 2023-03-08 | Invivyd Inc | Compuestos específicos contra la proteína s de coronavirus y usos de los mismos. |
| BR112023018832A2 (pt) | 2021-03-17 | 2023-12-26 | Myeloid Therapeutics Inc | Composições de proteínas de fusão quiméricas modificadas e métodos de uso das mesmas |
| IL307367A (en) * | 2021-04-07 | 2023-11-01 | Lg Chemical Ltd | GUCY2C binding polypeptide and uses thereof |
| WO2022247756A1 (zh) * | 2021-05-23 | 2022-12-01 | 上海邦耀生物科技有限公司 | 靶向gprc5d的嵌合抗原受体及其用途 |
| CN116063500A (zh) | 2021-08-30 | 2023-05-05 | 原启生物科技(上海)有限责任公司 | 抗gprc5d抗原结合蛋白及其用途 |
| EP4497759A1 (en) | 2022-01-14 | 2025-01-29 | Oricell Therapeutics Co., Ltd. | Chimeric antigen receptor targeting gprc5d and application thereof |
| WO2023143537A1 (zh) | 2022-01-29 | 2023-08-03 | 恺兴生命科技(上海)有限公司 | Gprc5d抗体及其应用 |
| AU2023272490A1 (en) | 2022-05-17 | 2024-12-12 | Umoja Biopharma, Inc. | Manufacturing viral particles |
| KR20250022800A (ko) | 2022-06-10 | 2025-02-17 | 우모자 바이오파마 인코포레이티드 | 조작된 줄기 세포 및 그의 용도 |
| WO2023250122A1 (en) * | 2022-06-24 | 2023-12-28 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Molecules that bind to enpp1 polypeptides |
| CN116003598B (zh) | 2022-08-30 | 2024-04-26 | 苏州缔码生物科技有限公司 | 靶向人gprc5d的重组人源化单克隆抗体及其应用 |
| TW202434735A (zh) | 2022-11-04 | 2024-09-01 | 美商烏莫賈生物製藥股份有限公司 | 展示黏著分子融合的顆粒 |
| WO2024102954A1 (en) | 2022-11-10 | 2024-05-16 | Massachusetts Institute Of Technology | Activation induced clipping system (aics) |
| CN117229407B (zh) * | 2023-11-14 | 2024-02-20 | 成都优赛诺生物科技有限公司 | 一种靶向gprc5d的单域抗体、嵌合抗原受体及其应用 |
| WO2025129084A1 (en) | 2023-12-13 | 2025-06-19 | Umoja Biopharma, Inc. | Engineered induced stem cell derived myeloid cells and methods of differentiating and using same |
| WO2025231174A1 (en) | 2024-04-30 | 2025-11-06 | Umoja Biopharma, Inc. | Manufacturing viral particles |
| WO2025231408A2 (en) | 2024-05-03 | 2025-11-06 | Janssen Biotech, Inc. | Methods for treating multiple myeloma with car-t cells and bispecific antibodies |
| WO2025231372A2 (en) | 2024-05-03 | 2025-11-06 | Janssen Biotech, Inc. | Methods for treating multiple myeloma with car-t cells and bispecific antibodies |
| WO2025235604A1 (en) | 2024-05-08 | 2025-11-13 | Umoja Biopharma, Inc. | Fusion protein for use as immune cell engager |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4956778A (en) | 1987-07-02 | 1990-09-11 | Mitsubishi Denki Kabushiki Kaisha | Constant speed holding device |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US20050196754A1 (en) | 2000-03-31 | 2005-09-08 | Drmanac Radoje T. | Novel nucleic acids and polypeptides |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US8389282B2 (en) | 2007-03-30 | 2013-03-05 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| WO2014087010A1 (en) | 2012-12-07 | 2014-06-12 | Ablynx N.V. | IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE |
| WO2014127261A1 (en) * | 2013-02-15 | 2014-08-21 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US20140322183A1 (en) * | 2013-03-15 | 2014-10-30 | The Trustees Of The University Of Pennsylvania | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| WO2014191128A1 (en) | 2013-05-29 | 2014-12-04 | Cellectis | Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system |
Family Cites Families (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2275449B1 (en) | 2000-06-16 | 2016-09-28 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to BLyS |
| WO2003016553A2 (en) | 2001-08-20 | 2003-02-27 | Genentech, Inc. | Gpcr-like retinoic acid-induced gene 1 protein and nucleic acid |
| JPWO2003055507A1 (ja) * | 2001-12-27 | 2005-04-28 | 住友製薬株式会社 | 拒食症又は生活習慣病治療薬及びそのスクリーニング方法 |
| US20040110139A1 (en) * | 2002-12-10 | 2004-06-10 | Isis Pharmaceuticals Inc. | Modulation of G protein-coupled receptor 3 expression |
| ES2388280T3 (es) | 2002-12-20 | 2012-10-11 | Abbott Biotherapeutics Corp. | Anticuerpos que reaccionan frente a GPR64 y utilización de los mismos |
| BRPI0407446A (pt) | 2003-02-13 | 2006-01-31 | Pharmacia Corp | Anticorpos para c-met para o tratamento de cânceres |
| WO2005019258A2 (en) | 2003-08-11 | 2005-03-03 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| ZA200604620B (en) * | 2003-12-10 | 2007-10-31 | Medarex Inc | IP-10 antibodies and their uses |
| US20050266008A1 (en) * | 2004-03-29 | 2005-12-01 | Medarex, Inc. | Human anti-IRTA-5 antibodies |
| CA2658612C (en) | 2006-08-03 | 2015-11-17 | Astrazeneca Ab | Antibodies directed to .alpha.v.beta.6 and uses thereof |
| US9512236B2 (en) | 2006-12-19 | 2016-12-06 | Ablynx N.V. | Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders |
| EP2348052A3 (en) | 2007-09-17 | 2011-10-26 | The Regents of The University of California | Internalizing human monoclonal antibodies targeting prostate cancer cells in situ |
| WO2009051633A1 (en) | 2007-10-15 | 2009-04-23 | The Board Of Trustees Of The Leland Stanford Junior University | Gpcr crystalization method using an antibody |
| NZ585589A (en) * | 2007-10-25 | 2012-07-27 | Trellis Bioscience Inc | Anti-rsv g protein antibodies |
| PL2242773T3 (pl) | 2008-02-11 | 2017-11-30 | Cure Tech Ltd. | Przeciwciała monoklonalne do leczenia nowotworu |
| US9217032B2 (en) | 2010-01-08 | 2015-12-22 | Les Laboratoires Servier | Methods for treating colorectal cancer |
| EP2596017B1 (en) | 2010-07-22 | 2019-04-03 | John W. Schrader | Cross-protective antibody against influenza viral infection |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| US9833476B2 (en) * | 2011-08-31 | 2017-12-05 | The Trustees Of Dartmouth College | NKP30 receptor targeted therapeutics |
| CN103483452B (zh) | 2012-06-12 | 2021-08-13 | 上海细胞治疗集团有限公司 | 双信号独立的嵌合抗原受体及其用途 |
| JO3519B1 (ar) | 2013-01-25 | 2020-07-05 | Amgen Inc | تركيبات أجسام مضادة لأجل cdh19 و cd3 |
| WO2015142675A2 (en) | 2014-03-15 | 2015-09-24 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
| US9884921B2 (en) | 2014-07-01 | 2018-02-06 | Pfizer Inc. | Bispecific heterodimeric diabodies and uses thereof |
| JP2017528433A (ja) | 2014-07-21 | 2017-09-28 | ノバルティス アーゲー | 低い免疫増強用量のmTOR阻害剤とCARの組み合わせ |
| RS62870B1 (sr) | 2014-12-05 | 2022-02-28 | Memorial Sloan Kettering Cancer Center | Himerni antigenski receptori sa ciljanim delovanjem na receptore spregnute sa g-proteinom i njihove upotrebe |
| SG10201913937QA (en) * | 2014-12-05 | 2020-03-30 | Memorial Sloan Kettering Cancer Center | Antibodies targeting g-protein coupled receptor and methods of use |
| AU2016342041B2 (en) | 2015-10-23 | 2021-12-02 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
| JP7267009B2 (ja) | 2015-12-04 | 2023-05-01 | メモリアル スローン ケタリング キャンサー センター | Fc受容体様5を標的とする抗体および使用方法 |
| AU2017244108B2 (en) | 2016-03-29 | 2021-03-18 | University Of Southern California | Chimeric antigen receptors targeting cancer |
| EP3436037A4 (en) | 2016-03-31 | 2019-12-04 | University of Southern California | HIGHLY SENSITIVE AND SPECIFIC LUCIFERASE-BASED REPORTER TEST FOR ANTIGEN DETECTION |
| CN112125976B (zh) | 2018-01-26 | 2022-06-03 | 重庆精准生物技术有限公司 | 改造的铰链及其在构建car骨架中的应用 |
| AU2019374103A1 (en) | 2018-11-01 | 2021-05-20 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for G Protein-Coupled Receptor Class C Group 5 Member D (GPRC5D) |
-
2015
- 2015-12-04 RS RS20211596A patent/RS62870B1/sr unknown
- 2015-12-04 IL IL252621A patent/IL252621B2/en unknown
- 2015-12-04 DK DK15865633.0T patent/DK3227339T3/da active
- 2015-12-04 LT LTEPPCT/US2015/064102T patent/LT3227339T/lt unknown
- 2015-12-04 RU RU2017123551A patent/RU2762359C2/ru active
- 2015-12-04 IL IL310130A patent/IL310130A/en unknown
- 2015-12-04 CN CN202111119531.9A patent/CN113968912B/zh active Active
- 2015-12-04 PL PL15865633T patent/PL3227339T3/pl unknown
- 2015-12-04 JP JP2017529741A patent/JP6919091B2/ja active Active
- 2015-12-04 AU AU2015357518A patent/AU2015357518B2/en active Active
- 2015-12-04 CN CN202410434671.2A patent/CN118271463A/zh active Pending
- 2015-12-04 PT PT158656330T patent/PT3227339T/pt unknown
- 2015-12-04 ES ES15865633T patent/ES2899779T3/es active Active
- 2015-12-04 WO PCT/US2015/064102 patent/WO2016090312A1/en not_active Ceased
- 2015-12-04 CA CA2969864A patent/CA2969864A1/en active Pending
- 2015-12-04 CN CN202111126092.4A patent/CN113683711A/zh active Pending
- 2015-12-04 CN CN201580075557.4A patent/CN107428829B/zh active Active
- 2015-12-04 EP EP15865633.0A patent/EP3227339B1/en active Active
- 2015-12-04 KR KR1020177018389A patent/KR102612367B1/ko active Active
- 2015-12-04 SI SI201531772T patent/SI3227339T1/sl unknown
- 2015-12-04 SG SG11201704547RA patent/SG11201704547RA/en unknown
- 2015-12-04 MX MX2017007242A patent/MX385156B/es unknown
- 2015-12-04 EP EP21201788.3A patent/EP4015534A1/en active Pending
- 2015-12-04 HR HRP20211978TT patent/HRP20211978T1/hr unknown
- 2015-12-04 HU HUE15865633A patent/HUE057777T2/hu unknown
- 2015-12-04 MY MYPI2017000855A patent/MY192065A/en unknown
- 2015-12-04 SM SM20220040T patent/SMT202200040T1/it unknown
- 2015-12-04 SG SG10202007326QA patent/SG10202007326QA/en unknown
-
2017
- 2017-06-05 MX MX2021008798A patent/MX2021008798A/es unknown
- 2017-06-05 PH PH12017501044A patent/PH12017501044A1/en unknown
- 2017-06-05 US US15/613,800 patent/US10633426B2/en active Active
- 2017-06-05 SA SA517381665A patent/SA517381665B1/ar unknown
-
2020
- 2020-02-21 US US16/798,104 patent/US11866478B2/en active Active
- 2020-02-21 US US16/798,059 patent/US11820806B2/en active Active
- 2020-02-21 US US16/798,151 patent/US10906956B2/en active Active
- 2020-11-30 JP JP2020198690A patent/JP2021040652A/ja not_active Withdrawn
-
2022
- 2022-01-06 AU AU2022200052A patent/AU2022200052A1/en not_active Abandoned
- 2022-02-07 CY CY20221100105T patent/CY1125008T1/el unknown
-
2023
- 2023-05-12 JP JP2023079310A patent/JP2023091037A/ja not_active Withdrawn
- 2023-11-22 US US18/517,766 patent/US20240294599A1/en active Pending
Patent Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4956778A (en) | 1987-07-02 | 1990-09-11 | Mitsubishi Denki Kabushiki Kaisha | Constant speed holding device |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US20050196754A1 (en) | 2000-03-31 | 2005-09-08 | Drmanac Radoje T. | Novel nucleic acids and polypeptides |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US8389282B2 (en) | 2007-03-30 | 2013-03-05 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| WO2014087010A1 (en) | 2012-12-07 | 2014-06-12 | Ablynx N.V. | IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE |
| WO2014127261A1 (en) * | 2013-02-15 | 2014-08-21 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US20140322183A1 (en) * | 2013-03-15 | 2014-10-30 | The Trustees Of The University Of Pennsylvania | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| WO2014191128A1 (en) | 2013-05-29 | 2014-12-04 | Cellectis | Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system |
Non-Patent Citations (100)
| Title |
|---|
| "NCBI", Database accession no. NP_036224 |
| "REMINGTON'S PHARMACEUTICAL SCIENCE", 1985 |
| "UniProtKB", Database accession no. P18627.5 |
| ANDERSON, SCIENCE, vol. 226, 1984, pages 401 - 409 |
| ATAMANIUK, J. ET AL.: "Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma", EUROPEAN JOURNAL OF CLINICAL INVESTIGATION, vol. 42, 2012, pages 953 - 960, XP055408192, DOI: 10.1111/j.1365-2362.2012.02679.x |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2001, WILEY INTERSCIENCE |
| AUSUBEL, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987 |
| BAM, R. ET AL.: "GPRC5D Is a Cell Surface Plasma Cell Marker Whose Expression Is High In Myeloma Cells and Reduced Following Coculture With Osteoclasts", BLOOD, vol. 122, 2013, pages 3099 |
| BATAILLE, R. ET AL.: "The phenotype of normal, reactive and malignant plasma cells. Identification of ''many and multiple myelomas'' and of new targets for myeloma therapy", HAEMATOLOGICA, vol. 91, 2006, pages 1234 - 1240, XP002444357 |
| BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180 |
| BLOOMER ET AL., JOURNAL OF VIROLOGY, vol. 71, 1997, pages 6641 - 6649 |
| BOYD, K.D. ET AL.: "The clinical impact and molecular biology of del(17p) in multiple myeloma treated with conventional or thalidomide-based therapy", GENES, CHROMOSOMES & CANCER, vol. 50, 2011, pages 765 - 774 |
| BREGNI ET AL., BLOOD, vol. 80, 1992, pages 1418 - 1422 |
| BRENTJENS, R.J. ET AL.: "CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 5, 2013, pages 177 - 138 |
| BRENTJENS, R.J. ET AL.: "Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15", NATURE MEDICINE, vol. 9, 2003, pages 279 - 286, XP002799040, DOI: 10.1038/nm827 |
| BRENTJENS, R.J. ET AL.: "Genetically targeted T cells eradicate systemic acute lymphoblastic leukemia xenografts", CLIN.CANCER RES., vol. 13, 2007, pages 5426 - 5435, XP055204921, DOI: 10.1158/1078-0432.CCR-07-0674 |
| BRENTJENS, R.J. ET AL.: "Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias", BLOOD, vol. 118, 2011, pages 4817 - 4828, XP055169039, DOI: 10.1182/blood-2011-04-348540 |
| BRIGHAM ET AL., AM. J. MED. SCI., vol. 298, 1989, pages 278 |
| BROCKS ET AL., IMMUNOTECHNOLOGY, vol. 3, no. 3, 1997, pages 173 - 84 |
| CAYOUETTE ET AL., HUMAN GENE THERAPY, vol. 8, 1997, pages 423 - 430 |
| COHEN, Y.GUTWEIN, O.GARACH-JEHOSHUA, O.BAR-HAIM, A.KORNBERG, A: "GPRC5D is a promising marker for monitoring the tumor load and to target multiple myeloma cells", HEMATOLOGY (AMSTERDAM, NETHERLANDS), vol. 18, 2013, pages 348 - 351, XP009195526, DOI: 10.1179/1607845413Y.0000000079 |
| COLIGAN, CURRENT PROTOCOLS IN IMMUNOLOGY, 1991 |
| CORNETTA ET AL., NUCLEIC ACID RESEARCH |
| DANOS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 6460 - 6464 |
| DAVILA, M.L. ET AL.: "Efficacy and Toxicity Management of 19-28z CAR T Cell Therapy in B Cell Acute Lymphoblastic Leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, 2014, pages 224 - 225 |
| DUDLEY, M.E. ET AL.: "Adoptive cell therapy for patients with metastatic melanoma: evaluation of intensive myeloablative chemoradiation preparative regimens", J CLIN ONCOL, vol. 26, 2008, pages 5233 - 5239, XP009117624, DOI: 10.1200/JCO.2008.16.5449 |
| DUPONT, J. ET AL., CANCER RES, vol. 65, 2005, pages 5417 - 5427 |
| EGLITIS ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 608 - 614 |
| FEIGNER ET AL., PROC. NAT'L. ACAD. SCI. U.S.A., vol. 84, 1987, pages 7413 |
| FIFE, J CLIN INVST, vol. 116, no. 8, 2006, pages 2252 - 61 |
| FRESHNEY, ANIMAL CELL CULTURE, 1987 |
| FRIEDMAN, SCIENCE, vol. 244, 1989, pages 1275 - 1281 |
| FRIGYESI, I. ET AL.: "Robust isolation of malignant plasma cells in multiple myeloma", BLOOD, vol. 123, 2014, pages 1336 - 1340 |
| GADE, T.P. ET AL.: "Targeted elimination of prostate cancer by genetically directed human T lymphocytes", CANCER RES., vol. 65, 2005, pages 9080 - 9088 |
| GAHRTON, G. ET AL.: "Allogeneic bone marrow transplantation in multiple myeloma. European Group for Bone Marrow Transplantation", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 325, 1991, pages 1267 - 1273 |
| GIOMARELLI ET AL., THROMB HAEMOST, vol. 97, no. 6, 2007, pages 955 - 63 |
| GONG, M.C. ET AL.: "Cancer patient T cells genetically targeted to prostate-specific membrane antigen specifically lyse prostate cancer cells and release cytokines in response to prostate-specific membrane antigen", NEOPLASIA, vol. 1, 1999, pages 123 - 127, XP055348359, DOI: 10.1038/sj.neo.7900018 |
| GRUNSTEINROGNESS, PROC. NATL. ACAD. SCI., USA, vol. 72, 1975, pages 3961 |
| HO ET AL., BIOCHIM BIOPHYS ACTA, vol. 1638, no. 3, 2003, pages 257 - 66 |
| HOLLYMAN, D. ET AL.: "Manufacturing validation of biologically functional T cells targeted to CD19 antigen for autologous adoptive cell therapy", J IMMUNOTHER, vol. 32, 2009, pages 169 - 180, XP055389370, DOI: 10.1097/CJI.0b013e318194a6e8 |
| HUGHES ET AL., J. CLIN. INVEST., vol. 89, 1992, pages 1817 |
| HUNDER, N.N. ET AL.: "Treatment of metastatic melanoma with autologous CD4+ T cells against NY-ESO-1", N.ENGL.J.MED., vol. 358, 2008, pages 2698 - 2703, XP055187197, DOI: 10.1056/NEJMoa0800251 |
| HUSTON ET AL., PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JOHNSON, CHEST, vol. 107, 1995, pages 77S - 83S |
| KERSHAW, M.H. ET AL.: "Gene-engineered T cells as a superior adjuvant therapy for metastatic cancer", J IMMUNOL, vol. 173, 2004, pages 2143 - 2150, XP002533910 |
| KIDO ET AL., CURRENT EYE RESEARCH, vol. 15, 1996, pages 833 - 844 |
| KIMMEL, A. R., METHODS ENZYMOL., vol. 152, 1987, pages 507 |
| KRAUSE, A. ET AL.: "Antigen-dependent CD28 signaling selectively enhances survival and proliferation in genetically modified activated human primary T lymphocytes", J EXP MED, vol. 188, 1998, pages 619 - 626, XP001240431, DOI: 10.1084/jem.188.4.619 |
| LE GAL LA SALLE ET AL., SCIENCE, vol. 259, 1993, pages 988 - 990 |
| LEDBETTER ET AL., CRIT REV IMMUNO1, vol. 17, no. 5-6, 1997, pages 427 - 55 |
| LYDDANE, C. ET AL.: "Cutting Edge: CD28 controls dominant regulatory T cell activity during active immunization", J.IMMUNOL., vol. 176, 2006, pages 3306 - 3310 |
| MAHER, J.BRENTJENS, R.J.GUNSET, G.RIVIERE, I.SADELAIN, M.: "Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta /CD28 receptor", NAT.BIOTECHNOL., vol. 20, 2002, pages 70 - 75, XP002588277 |
| MILLER ET AL., BIOTECHNOLOGY, vol. 7, 1989, pages 980 - 990 |
| MILLER ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 431 - 437 |
| MILLER ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 2895 - 2902 |
| MILLER, HUMAN GENE THERAPY, vol. 15-14, pages 1990 |
| MILLERCALOS, GENE TRANSFER VECTORS FOR MAMMALIAN CELLS, 1987 |
| MIYOSHI ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 94, 1997, pages 10319 |
| MOEN, BLOOD CELLS, vol. 17, 1991, pages 407 - 416 |
| MOLECULAR BIOLOGY, vol. 36, 1987, pages 311 - 322 |
| MOOSMAYER ET AL., THER IMMUNOL, vol. 2, no. 10, 1995, pages 31 - 40 |
| MORGAN, R.A. ET AL., SCIENCE, vol. 314, 2006, pages 126 - 129 |
| MORGAN, R.A. ET AL.: "Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 843 - 851, XP055023624, DOI: 10.1038/mt.2010.24 |
| MULLIS, PCR: THE POLYMERASE CHAIN REACTION, 1994 |
| NALDINI ET AL., SCIENCE, vol. 272, 1996, pages 263 - 267 |
| OLIGONUCLEOTIDE SYNTHESIS, 1984 |
| ONO ET AL., NEUROSCIENCE LETTERS, vol. 17, 1990, pages 259 |
| PANELLI, M.C. ET AL., J IMMUNOL, vol. 164, 2000, pages 4382 - 4392 |
| PAPANICOLAOU, G.A. ET AL., BLOOD, vol. 102, 2003, pages 2498 - 2505 |
| PEGRAM, H.J. ET AL.: "Tumor-targeted T cells modified to secrete IL-12 eradicate systemic tumors without need for prior conditioning", BLOOD, vol. 119, 2012, pages 4133 - 4141, XP055109416, DOI: 10.1182/blood-2011-12-400044 |
| PETER ET AL., J BIOI CHERN, vol. 25278, no. 38, 2003, pages 36740 - 7 |
| PETER ET AL., J CACHEXIA SARCOPENIA MUSCLE, 12 August 2012 (2012-08-12) |
| POSTHUMUS ET AL., J. VIROLOGY, vol. 64, 1990, pages 3304 - 3309 |
| RIVIERE, I.SADELAIN, M.BRENTJENS, R.J.: "Novel strategies for cancer therapy: the potential of genetically modified T lymphocytes", CURR HEMATOL REP, vol. 3, 2004, pages 290 - 297 |
| ROSENBERG ET AL., N. ENGL. J. MED, vol. 323, 1990, pages 370 |
| ROSENBERG, S.A.RESTIFO, N.P.YANG, J.C.MORGAN, R.A.DUDLEY, M.E: "Adoptive cell transfer: a clinical path to effective cancer immunotherapy", NAT.REV.CANCER, vol. 8, 2008, pages 299 - 308, XP002571413, DOI: 10.1038/nrc2355 |
| SABRINA BERTILACCIO, M.T. ET AL.: "Low-Dose Lenalidomide Improves CAR-Based Immunotherapy In CLL By Reverting T-Cell Defects In Vivo", BLOOD, vol. 122, 2013, pages 4171 |
| SADELAIN, M. ET AL., NAT REV CANCER, vol. 3, 2003, pages 35 - 45 |
| SADELAIN, M.BRENTJENS, R.RIVIERE, I.: "The basic principles of chimeric antigen receptor design", CANCER DISCOVERY, vol. 3, 2013, pages 388 - 398, XP055287277, DOI: 10.1158/2159-8290.CD-12-0548 |
| SADELAIN, M.BRENTJENS, R.RIVIERE, I.: "The promise and potential pitfalls of chimeric antigen receptors", CURR OPIN IMMUNOL, 2009 |
| SAMBROOK ET AL.: "Seventh Training Course on Radioligand Assay Techniques", March 1986, COLD SPRING HARBOR LABORATORY PRESS, article "Principles of Radioimmunoassays" |
| SAMBROOKFRITSCHMANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, CSH PRESS |
| SHARP, THE LANCET, vol. 337, 1991, pages 1277 - 1278 |
| SHAUGHNESSY, J.D., JR. ET AL.: "A validated gene expression model of high-risk multiple myeloma is defined by deregulated expression of genes mapping to chromosome 1", BLOOD, vol. 109, 2007, pages 2276 - 2284, XP086507984, DOI: 10.1182/blood-2006-07-038430 |
| SHEN ET AL., ANAL. CHEM., vol. 80, no. 6, 2008, pages 1910 - 1917 |
| SHIEH ET AL., J IMUNOL, vol. 183, no. 4, 2009, pages 2277 - 85 |
| SIEGEL, R.NAISHADHAM, D.JEMAL, A: "Cancer statistics", CA: A CANCER JOURNAL FOR CLINICIANS, vol. 63, 2013, pages 11 - 30 |
| STAUBINGER ET AL., METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 512 |
| STEPHAN, M.T. ET AL.: "T cell-encoded CD80 and 4-1BBL induce auto- and transco-stimulation, resulting in potent tumor rejection", NAT.MED., vol. 13, 2007, pages 1440 - 1449 |
| TIMMERMAN ET AL., J. MOL. RECOGNIT, vol. 20, 2007, pages 283 - 29 |
| TOLSTOSHEV ET AL., CURRENT OPINION IN BIOTECHNOLOGY, vol. 1, 1990, pages 55 - 61 |
| WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316 - 325 |
| WAHL, G. M.S. L. BERGER, METHODS ENZYMOL, vol. 152, 1987, pages 399 |
| WEIR: "Handbook of Experimental Immunology", 1996, article "Methods in Enzymology" |
| WOLFF ET AL., SCIENCE, vol. 247, 1990, pages 1465 |
| WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 263, 1988, pages 14621 |
| WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 264, 1989, pages 16985 |
| XIE ET AL., NAT BIOTECH, vol. 15, no. 8, 1997, pages 768 - 71 |
| XU ET AL., EXP. HEMAT., vol. 22, 1994, pages 223 - 230 |
| ZHAO ET AL., HYRBIDOMA (LARCHMT, vol. 27, no. 6, 2008, pages 455 - 51 |
Cited By (112)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3227324A4 (en) * | 2014-12-05 | 2018-08-29 | Memorial Sloan Kettering Cancer Center | Antibodies targeting g-protein coupled receptor and methods of use |
| US11820806B2 (en) | 2014-12-05 | 2023-11-21 | Memorial Sloan-Kettering Cancer Center | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof |
| US11566071B2 (en) | 2014-12-05 | 2023-01-31 | Memorial Sloan Kettering Cancer Center | Nucleic acid molecules encoding anti-GPRC5D antibodies |
| US11866478B2 (en) | 2014-12-05 | 2024-01-09 | Memorial Sloan-Kettering Cancer Center | Nucleic acid molecules encoding chimeric antigen receptors targeting G-protein coupled receptor |
| US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11028142B2 (en) | 2015-05-18 | 2021-06-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10442849B2 (en) | 2015-05-18 | 2019-10-15 | Tcr2 Therabeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10358473B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10358474B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11242376B2 (en) | 2016-08-02 | 2022-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| RU2721582C1 (ru) * | 2016-08-05 | 2020-05-20 | И-Байолоджикс Инк. | Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение |
| US10919966B2 (en) | 2016-08-05 | 2021-02-16 | Y-Biologics Inc. | Antibody to programmed death-ligand 1 (PD-L1) and use thereof |
| US11085021B2 (en) | 2016-10-07 | 2021-08-10 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11377638B2 (en) | 2016-10-07 | 2022-07-05 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10208285B2 (en) | 2016-10-07 | 2019-02-19 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11851491B2 (en) | 2016-11-22 | 2023-12-26 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| US12331098B2 (en) | 2017-01-05 | 2025-06-17 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11299530B2 (en) | 2017-01-05 | 2022-04-12 | Kahr Medical Ltd. | SIRP alpha-CD70 fusion protein and methods of use thereof |
| US11897937B2 (en) | 2017-01-05 | 2024-02-13 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11566060B2 (en) | 2017-01-05 | 2023-01-31 | Kahr Medical Ltd. | PD1-CD70 fusion protein and methods of use thereof |
| US11130796B2 (en) | 2017-01-05 | 2021-09-28 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11702458B2 (en) | 2017-01-05 | 2023-07-18 | Kahr Medical Ltd. | PD1-41BBL fusion protein and methods of use thereof |
| WO2018147245A1 (ja) * | 2017-02-07 | 2018-08-16 | 第一三共株式会社 | 抗gprc5d抗体及び該抗体を含む分子 |
| EP3581651A4 (en) * | 2017-02-07 | 2021-05-12 | Daiichi Sankyo Company, Limited | ANTI-GPRC5D ANTIBODY AND MOLECULE WITH IT |
| US10822413B2 (en) | 2017-04-26 | 2020-11-03 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
| WO2018200583A1 (en) | 2017-04-26 | 2018-11-01 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
| US11965021B2 (en) | 2017-04-26 | 2024-04-23 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
| US11613573B2 (en) | 2017-04-26 | 2023-03-28 | Eureka Therapeutics, Inc. | Chimeric antibody/T-cell receptor constructs and uses thereof |
| EP4516896A2 (en) | 2017-08-09 | 2025-03-05 | Juno Therapeutics, Inc. | Methods and compositions for preparing genetically engineered cells |
| US12215348B2 (en) | 2017-08-09 | 2025-02-04 | Juno Therapeutics, Inc. | Methods for producing genetically engineered cell compositions and related compositions |
| WO2019032927A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | METHODS FOR PRODUCING GENETICALLY MODIFIED CELL COMPOSITIONS AND COMPOSITIONS THEREOF |
| WO2019032929A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | METHODS AND COMPOSITIONS FOR PREPARING GENETICALLY MODIFIED CELLS |
| US11851678B2 (en) | 2017-08-09 | 2023-12-26 | Juno Therapeutics, Inc. | Methods for producing genetically engineered cell compositions and related compositions |
| WO2019051335A1 (en) | 2017-09-07 | 2019-03-14 | Juno Therapeutics, Inc. | METHODS OF IDENTIFYING CELLULAR CHARACTERISTICS RELATED TO RESPONSES ASSOCIATED WITH CELL THERAPY |
| WO2019089858A2 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods of assessing or monitoring a response to a cell therapy |
| US11623961B2 (en) | 2017-11-01 | 2023-04-11 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for B-cell maturation antigen |
| US12258580B2 (en) | 2017-11-01 | 2025-03-25 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
| US11066475B2 (en) | 2017-11-01 | 2021-07-20 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides |
| US12168027B2 (en) | 2017-11-01 | 2024-12-17 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
| WO2019090004A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for producing a t cell composition |
| WO2019089855A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
| US12031975B2 (en) | 2017-11-01 | 2024-07-09 | Juno Therapeutics, Inc. | Methods of assessing or monitoring a response to a cell therapy |
| US12428486B2 (en) | 2017-11-01 | 2025-09-30 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides |
| WO2019089848A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
| US11564946B2 (en) | 2017-11-01 | 2023-01-31 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
| EP4512823A2 (en) | 2017-11-01 | 2025-02-26 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
| US11766474B2 (en) | 2017-11-14 | 2023-09-26 | Memorial Sloan-Kettering Cancer Center | IL-36 secreting immunoresponsive cells and uses thereof |
| WO2019099483A1 (en) * | 2017-11-14 | 2019-05-23 | Memorial Sloan-Kettering Cancer Center | Il-36 secreting immunoresponsive cells and uses thereof |
| WO2019109053A1 (en) | 2017-12-01 | 2019-06-06 | Juno Therapeutics, Inc. | Methods for dosing and for modulation of genetically engineered cells |
| US12161670B2 (en) | 2017-12-08 | 2024-12-10 | Juno Therapeutics, Inc. | Phenotypic markers for cell therapy and related methods |
| WO2019113559A2 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Phenotypic markers for cell therapy and related methods |
| WO2019113557A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Process for producing a composition of engineered t cells |
| WO2019113556A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Serum-free media formulation for culturing cells and methods of use thereof |
| WO2019191704A1 (en) * | 2018-03-30 | 2019-10-03 | Eureka Therapeutics, Inc. | Constructs targeting cd22 and uses thereof |
| US11827672B2 (en) | 2018-03-30 | 2023-11-28 | Eureka Therapeutics, Inc. | Constructs trageting CD22 and uses thereof |
| EP3774919A4 (en) * | 2018-03-30 | 2021-12-29 | Eureka Therapeutics, Inc. | Constructs targeting cd22 and uses thereof |
| EP3793606A4 (en) * | 2018-05-16 | 2022-08-31 | Janssen Biotech, Inc. | METHODS OF TREATMENT OF CANCER AND ENHANCEMENT OF THE EFFECTIVENESS OF T-CELL REFERRING THERAPEUTICS |
| US12012461B2 (en) | 2018-05-16 | 2024-06-18 | Janssen Biotech, Inc. | Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics |
| US12065500B2 (en) | 2018-05-16 | 2024-08-20 | Janssen Biotech, Inc. | Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics |
| WO2019220368A1 (en) * | 2018-05-16 | 2019-11-21 | Janssen Biotech, Inc. | Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy |
| US12134638B2 (en) | 2018-07-11 | 2024-11-05 | Kahr Medical Ltd. | SIRPalpha-4-1BBL variant fusion protein and methods of use thereof |
| US12286466B2 (en) | 2018-07-11 | 2025-04-29 | Kahr Medical Ltd. | PD1-4-1BBL variant fusion protein and methods of use thereof |
| WO2020033916A1 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Methods for assessing integrated nucleic acids |
| WO2020033927A2 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Processes for generating engineered cells and compositions thereof |
| WO2020089343A1 (en) | 2018-10-31 | 2020-05-07 | Juno Therapeutics Gmbh | Methods for selection and stimulation of cells and apparatus for same |
| WO2020092854A3 (en) * | 2018-11-01 | 2020-07-02 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d) |
| WO2020092854A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d) |
| US12473345B2 (en) | 2018-11-01 | 2025-11-18 | Juno Therapeutics, Inc. | Methods for treatment using chimeric antigen receptors specific for B-cell maturation antigen |
| WO2020113194A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for treatment using adoptive cell therapy |
| EP4427810A2 (en) | 2018-11-30 | 2024-09-11 | Juno Therapeutics, Inc. | Methods for treatment using adoptive cell therapy |
| CN113597433A (zh) * | 2019-01-18 | 2021-11-02 | 詹森生物科技公司 | Gprc5d嵌合抗原受体以及表达这些受体的细胞 |
| JP7303314B2 (ja) | 2019-01-18 | 2023-07-04 | ヤンセン バイオテツク,インコーポレーテツド | Gprc5dキメラ抗原受容体及びそれを発現する細胞 |
| JP7605912B2 (ja) | 2019-01-18 | 2024-12-24 | ヤンセン バイオテツク,インコーポレーテツド | Gprc5dキメラ抗原受容体及びそれを発現する細胞 |
| WO2020148677A1 (en) * | 2019-01-18 | 2020-07-23 | Janssen Biotech, Inc. | Gprc5d chimeric antigen receptors and cells expressing the same |
| US12077592B2 (en) | 2019-01-18 | 2024-09-03 | Janssen Biotech, Inc. | GPRC5D chimeric antigen receptors and cells expressing the same |
| TWI851650B (zh) * | 2019-01-18 | 2024-08-11 | 美商健生生物科技公司 | Gprc5d嵌合抗原受體及表現其之細胞 |
| IL284744B1 (en) * | 2019-01-18 | 2025-10-01 | Janssen Biotech Inc | Chimeric antigen receptors gprc5d and cells expressing them |
| JP2023130380A (ja) * | 2019-01-18 | 2023-09-20 | ヤンセン バイオテツク,インコーポレーテツド | Gprc5dキメラ抗原受容体及びそれを発現する細胞 |
| JP2022518708A (ja) * | 2019-01-18 | 2022-03-16 | ヤンセン バイオテツク,インコーポレーテツド | Gprc5dキメラ抗原受容体及びそれを発現する細胞 |
| US12435120B2 (en) | 2019-05-01 | 2025-10-07 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified CD247 locus, related polynucleotides and methods |
| WO2020223535A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods |
| WO2020223571A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods |
| WO2020252218A1 (en) | 2019-06-12 | 2020-12-17 | Juno Therapeutics, Inc. | Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein |
| WO2021035194A1 (en) | 2019-08-22 | 2021-02-25 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods |
| WO2021084050A1 (en) | 2019-10-30 | 2021-05-06 | Juno Therapeutics Gmbh | Cell selection and/or stimulation devices and methods of use |
| WO2021154887A1 (en) | 2020-01-28 | 2021-08-05 | Juno Therapeutics, Inc. | Methods for t cell transduction |
| WO2021231657A1 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Methods of identifying features associated with clinical response and uses thereof |
| WO2021260186A1 (en) | 2020-06-26 | 2021-12-30 | Juno Therapeutics Gmbh | Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods |
| WO2022098787A1 (en) | 2020-11-04 | 2022-05-12 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| WO2022148370A1 (en) * | 2021-01-05 | 2022-07-14 | Lanova Medicines Development Co., Ltd. | Anti-gprc5d monoclonal antibodies and uses thereof |
| WO2022187406A1 (en) | 2021-03-03 | 2022-09-09 | Juno Therapeutics, Inc. | Combination of a t cell therapy and a dgk inhibitor |
| WO2022204070A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Methods of determining potency of a therapeutic cell composition |
| WO2022204071A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Method to assess potency of viral vector particles |
| WO2022234009A2 (en) | 2021-05-06 | 2022-11-10 | Juno Therapeutics Gmbh | Methods for stimulating and transducing t cells |
| WO2023079494A1 (en) | 2021-11-03 | 2023-05-11 | Janssen Biotech, Inc. | Corticosteriod reduction in treatment with anti-cd38 antibodies |
| WO2023147515A1 (en) | 2022-01-28 | 2023-08-03 | Juno Therapeutics, Inc. | Methods of manufacturing cellular compositions |
| WO2023213969A1 (en) | 2022-05-05 | 2023-11-09 | Juno Therapeutics Gmbh | Viral-binding protein and related reagents, articles, and methods of use |
| WO2023220655A1 (en) | 2022-05-11 | 2023-11-16 | Celgene Corporation | Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy |
| WO2023230581A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Methods of manufacturing t cell therapies |
| WO2024007020A1 (en) | 2022-06-30 | 2024-01-04 | Indapta Therapeutics, Inc. | Combination of engineered natural killer (nk) cells and antibody therapy and related methods |
| WO2024031091A2 (en) | 2022-08-05 | 2024-02-08 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for gprc5d and bcma |
| WO2024054944A1 (en) | 2022-09-08 | 2024-03-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing |
| WO2024100604A1 (en) | 2022-11-09 | 2024-05-16 | Juno Therapeutics Gmbh | Methods for manufacturing engineered immune cells |
| WO2024161021A1 (en) | 2023-02-03 | 2024-08-08 | Juno Therapeutics Gmbh | Methods for non-viral manufacturing of engineered immune cells |
| WO2024220588A1 (en) | 2023-04-18 | 2024-10-24 | Juno Therapeutics, Inc. | Cytotoxicity assay for assessing potency of therapeutic cell compositions |
| WO2024243365A2 (en) | 2023-05-23 | 2024-11-28 | Juno Therapeutics, Inc. | Activation markers of t cells and method for assessing t cell activation |
| EP4520346A1 (en) * | 2023-09-06 | 2025-03-12 | Gyncentrum Sp. z o.o. | Cells, methods and systems for use in the treatment of a cancer with dual-car-t |
| WO2025059362A1 (en) | 2023-09-13 | 2025-03-20 | Juno Therapeutics, Inc. | Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses |
| WO2025076472A1 (en) | 2023-10-06 | 2025-04-10 | Juno Therapeutics, Inc. | Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses |
| WO2025147545A1 (en) | 2024-01-03 | 2025-07-10 | Juno Therapeutics, Inc. | Lipid nanoparticles for delivery of nucleic acids and related methods and uses |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240294599A1 (en) | Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof | |
| US20240335475A1 (en) | Methods of using chimeric antigen receptors targeting b-cell maturation antigen and uses thereof | |
| US12139538B2 (en) | Chimeric antigen receptors targeting Fc receptor-like 5 and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15865633 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 252621 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2017529741 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2969864 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021001154 Country of ref document: BR Ref document number: 11201704547R Country of ref document: SG Ref document number: MX/A/2017/007242 Country of ref document: MX Ref document number: 12017501044 Country of ref document: PH |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017011920 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2015357518 Country of ref document: AU Date of ref document: 20151204 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015865633 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20177018389 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017123551 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017011920 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170605 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 521421487 Country of ref document: SA Ref document number: 517381665 Country of ref document: SA |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 310130 Country of ref document: IL |