WO2016085934A1 - Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells - Google Patents
Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells Download PDFInfo
- Publication number
- WO2016085934A1 WO2016085934A1 PCT/US2015/062333 US2015062333W WO2016085934A1 WO 2016085934 A1 WO2016085934 A1 WO 2016085934A1 US 2015062333 W US2015062333 W US 2015062333W WO 2016085934 A1 WO2016085934 A1 WO 2016085934A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- sh2b3
- cell
- population
- stem cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0641—Erythrocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/18—Erythrocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/115—Basic fibroblast growth factor (bFGF, FGF-2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/125—Stem cell factor [SCF], c-kit ligand [KL]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/14—Erythropoietin [EPO]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/155—Bone morphogenic proteins [BMP]; Osteogenins; Osteogenic factor; Bone inducing factor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/165—Vascular endothelial growth factor [VEGF]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2303—Interleukin-3 (IL-3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2306—Interleukin-6 (IL-6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/26—Flt-3 ligand (CD135L, flk-2 ligand)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/40—Regulators of development
- C12N2501/415—Wnt; Frizzeled
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/998—Proteins not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2506/00—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
- C12N2506/02—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from embryonic cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2506/00—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
- C12N2506/03—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from non-embryonic pluripotent stem cells
Definitions
- the present invention relates to red blood cell production from stem cells and/or progenitor cells.
- RBCs red blood cells
- Donated blood is a major source of RBCs.
- the amount and/or quality of donated blood are not guaranteed.
- Production of red blood cells (RBCs) ex vivo using hematopoietic and pluripotent stem cell sources is an area of major interest as possible transfusion replacements.
- RBCs produced ex vivo have been successfully transfused into recipients in clinical trials demonstrating the effectiveness of this approach (Giarratana et al., Blood, 201 1).
- the invention is based, in part, on the discovery that inhibition of the SH2B3 gene in a population of stem cells and/or progenitor cells can increase the amount and quality of red blood cells (RBCs) differentiated from the population of stem cells and/or progenitor cells.
- RBCs red blood cells
- the inventor has demonstrated using shRNA or CRISPR/Cas9 to knock down SH2B3 expression, that hematopoietic stem and progenitor cells (HSPCs) can be differentiated into mature RBCs, as shown by an increase in CD235a marker and a decrease in CD71 surface marker.
- HSPCs hematopoietic stem and progenitor cells
- inhibition of SH2B3 can be used to produce RBCs ex vivo from a population of stem cells and/or progenitor cells.
- the invention provides a method of producing red blood cells (RBCs) ex vivo from a population of stem cells and/or progenitor cells, the method comprising: (i) inhibiting SH2B3 in the population of stem cells and/or progenitor cells; (ii) culturing the population of stem cells and/or progenitor cells for a time sufficient to induce differentiation of at least one stem cell or progenitor cell to a RBC; and (iii) collecting a population of RBCs.
- RBCs red blood cells
- the inhibiting SH2B3 decreases SH2B3 protein level, SH2B3 mRNA level, SH2B3 protein activity, or combinations thereof.
- the inhibiting SH2B3 comprises contacting the population of stem cells and/or progenitor cells with a genome-editing agent for targeted excision of the SH2B3 gene from at least one stem cell or progenitor cell.
- the inhibiting SH2B3 comprises contacting the population of stem cells and/or progenitor cells with an antagonist of SH2B3.
- the invention provides a method of inducing a population of stem cells and/or progenitor cells to differentiate into red blood cells (RBCs), the method comprising: (i) contacting the population of stem cells and/or progenitor cells with an antagonist of SH2B3 and culturing the population of stem cells and/or progenitor cells for a time sufficient to induce the differentiation of at least one stem cell or progenitor cell into a RBC, wherein the antagonist of SH2B3 decreases the activity of the SH2B3 protein or decreases SH2B3 mRNA or protein levels; and (ii) collecting a population of RBCs.
- RBCs red blood cells
- the invention provides a method of inducing a population of stem cells and/or progenitor cells to differentiate into red blood cells (RBCs), the method comprising: (i) contacting the population of stem cells and/or progenitor cells with a genome-editing agent and culturing the population of stem cells and/or progenitor cells for a time sufficient to induce the differentiation of at least one stem cell or progenitor cell into a RBC, wherein the genome-editing agent excises the SH2B3 gene from at least one stem cell or progenitor cell; and (ii) collecting a population of RBCs.
- RBCs red blood cells
- the genome- editing agent is selected from the group consisting of a Zinc-Finger Nuclease (ZFN), a Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR associated (Cas) system, and a Transcription Activator-Like Effector Nuclease (TALEN).
- ZFN Zinc-Finger Nuclease
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- Cas CRISPR associated
- TALEN Transcription Activator-Like Effector Nuclease
- the genome- editing agent is present in a vector.
- the antagonist of SH2B3 is selected from the group consisting of an inorganic molecule, an organic molecule, a nucleic acid, a nucleic acid analog or derivative, a peptide, a peptidomimetic, a protein, an antibody or an antigen-binding fragment thereof, and combinations thereof.
- the antagonist of SH2B3 specifically binds to SH2 domain, PH domain, or both the SH2 and PH domains of the SH2B3 protein.
- the antagonist of SH2B3 is a RNAi agent that inhibits the expression of SH2B3.
- the RNAi agent is a siRNA, shRNA, dsRNA that hybridizes to SH2B3 mRNA.
- the population of stem cells and/or progenitor cells is selected from the group consisting of hematopoietic stem cells, hematopoietic progenitor cells, pluripotent stem cells, induced pluripotent stem cells (iPSCs), embryonic stem cells, and combinations thereof.
- the method increases the expansion of RBCs from the population of stem cells and/or progenitor cells.
- the method increases the quality of RBCs.
- the population of stem cells and/or progenitor cells is of mammalian origin.
- the population of stem cells and/or progenitor cells is of human origin.
- the RBCs are isolated by leukocyte filtration or flow cytometric sorting.
- the population of stem cells and/or progenitor cells is obtained from a donor subject.
- the population of stem cells and/or progenitor cells is derived from peripheral blood mononuclear cells, cord blood, bone marrow, cord tissue, or G-CSF mobilize peripheral blood of the donor subject.
- the method further comprises administering a population of RBCs to a subject in need thereof, wherein the RBCs are produced from the population of stem cells and/or progenitor cells obtained from the donor subject.
- the population of stem cells is iPSCs.
- Another aspect of the invention relates to a population of RBCs produced according to the methods described herein.
- Another aspect of the invention relates to an admixture comprising a population of RBCs and a population of stem cells and/or progenitor cells, wherein the RBCs are produced according to the methods described herein.
- Another aspect of the invention relates to a blood bank comprising a population of RBCs produced according to the methods described herein.
- Another aspect of the invention relates to a cell culture media comprising a population of stem cells and/or progenitor cells, at least one RBC differentiated from at least one stem cell or progenitor cell, and an antagonist of SH2B3.
- Another aspect of the invention relates to a method of administering a population of RBCs to a subject, comprising administering an effective amount of RBCs to the subject, wherein the RBCs have been contacted ex vivo or in vitro with an effective amount of an antagonist of SH2B3, wherein the antagonist of SH2B3 decreases the activity of the SH2B3 protein or decreases SH2B3 mRNA or protein levels.
- Another aspect of the invention relates to a method of administering a population of RBCs to a subject, comprising administering an effective amount of RBCs to the subject, wherein the RBCs are produced from a population of stem cells and/or progenitor cells having been contacted ex vivo or in vitro with an effective amount of a genome- editing agent, wherein the genome- editing agent excises the SH2B3 gene from at least one stem cell or progenitor cell.
- FIGS. 1A-1C shows a three-phase culture system to allow synchronous differentiation of CD34+ hematopoietic stem and progenitor cells (HSPCs) from cord blood and adult (bone marrow and mobilized peripheral blood) sources.
- FIG 1A shows a simplified scheme illustrating the method of differentiation of human CD34+ HSPCs into mature RBCs using inhibition of SH2B3.
- FIG. 1A shows a simplified scheme illustrating the method of differentiation of human CD34+ HSPCs into mature RBCs using inhibition of SH2B3.
- IB shows a Western blot showing SH2B3 protein levels 8 days following infection with sh83 (SEQ ID NO: 1) and sh84 (SEQ ID NO: 2) SH2B3 shRNAs, showing sh83 and sh84 shRNAs effectively reduce the level of SH2B3s protein in the cultures.
- FIG. 1C shows representative cytocentrifuge images of May-Griinwald-Giemsa stained SH2B3-KD (sh83 and/or sh84 SH2B3 shRNA treated) cells at the indicated days of differentiation.
- FIG. 2 shows that the cells undergoing differentiation were assessed using phenotypic surface markers CD71 and CD235a, in a fairly normal manner when compared to controls.
- FIGS. 3A-3B shows that the cells differentiate more effectively toward becoming mature RBCs with reduced levels of SH2B3.
- FIG. 3A shows a representative histogram plots of CD235a surface marker expression of sh83 and/or sh84 shRNA treated cells versus controls.
- FIG. 3B shows a representative plot of CD71 surface marker expression of sh83 and/or sh84 shRNA treated cells versus controls. More cells acquire CD235a and lose CD71 at earlier stages in the SH2B3 knockdown (sh83 and sh84 SH2B3 shRNA) cultures than in the shLuc control.
- FIG. 4 shows representative flow cytometry plots showing cells stained with CD235a and Hoechst 33342 on day 18 of differentiation, and shows that at the late stages of the culture (day 16- 18) more cells underwent enucleation (shown in the box), which is typical of mature RBCs. Numbers represent the mean percentage of CD235a+/Hoechst 33342- cells, indicative of enucleated RBCs, within the depicted gate ⁇ SD.
- FIG. 5 shows representative cytocentrifuge images of May-Griinwald-Giemsa stained control and SH2B3-KD (sh83 and sh84 SH2B3 shRNA treated) cells at the indicated days of differentiation. The results shows that the cells matured at a morphological level faster and acquired more hemoglobin with reduced SH2B3 levels. A scale bar is shown in upper left panel.
- FIG. 7 show improved expansion of Erythroid Cells with SH2B3 Suppression in Hematopoietic Stem Cells.
- FIGS. 8A-8C show improved expansion of Erythroid Cells with SH2B3 Suppression in Hematopoietic Stem Cells.
- FIG. 8C shows an algorithm to calculate the PKH signal reduction and cell division.
- FIG. 9 shows representative histogram plots showing eosin-5-maleimide signal on day 18 of mature RBCs derived from peripheral-blood-mobilized CD34+ cells, showing that the cells had similar eosin-5-maleimide fluorescence level as control cells, indicating that they matured similarly to control cells.
- FIG. 10 is a schematic of adherent differentiation.
- CRISPR/Cas9 was used to create SH2B3 knockout (KO) human embryonic stem cell (hESC) lines. Isogenic controls were isolated. These cells were induced to undergo hematopoietic differentiation. Once hematopoietic progenitor cells were obtained using this method, they were then differentiated toward the erythroid lineage as shown in the bottom of the figure.
- FIG. 11 shows that the SH2B3 KO hESCs differentiated as well or better than controls.
- SH2B3 KO (generataed using the CRISPR/Cas9 system) and isogenic control are shown with staining for erythroid surface phenotypic markers, CD71 and CD235a.
- FIGS. 12A-12B show improved expansion of Erythroid Cells with SH2B3 Suppression in Hematopoietic and Pluripotent Stem Cells.
- FIG. 12A and 12B show erythroid cell expansion of HPCs derived from two independent pairs of isogenic hESC clones; SH2B3 -knockout BB5 line (KO BB5) (FIG. 12A) and SH2B3 -knockout DB3 (KO DB3) (FIG. 12B), as compared to their wild-type isogenic controls (WT), showing that the cells with SH2B3 KO with CRISPR/Cas9 expanded to a considerably greater extent than controls.
- WT wild-type isogenic controls
- SH2B3 KO with CRISPR/Cas9 shows consistent increased expansion using a different KO clones (e.g., KO BB5 and KO DB3 clones) as compared to their respective isogenic controls (e.g, WT BB5 and WT DB3, respectively).
- FIGS. 13A-13C shows in vitro Suppression of SH2B3 in primary HSPCs.
- FIG. 13A shows a simplified scheme illustrating differentiation of human CD34+ HSPCs into mature RBCs.
- FIG. 13C shows enrichment profiles from gene set enrichment analysis comparing the relative expression of genes in SH2B3-KD samples versus control. An enrichment plot showing an erythroid differentiation signature derived by comparing early erythroid progenitors with more differentiated cells is shown (p ⁇ 0.0001 using a modified Kolmogorov-Smirnov statistical test).
- FIGS. 14A-14E show improved expansion of Erythroid Cells with SH2B3 Suppression in Hematopoietic and Pluripotent Stem Cells.
- FIG. 14A shows the mean yield of enucleated RBCs (CD235a+ /Hoechst 33342- ) observed for control and SH2B3 KD (sh83 and sh84 shRNA) samples derived from cord blood HSPCs. Values shown are mean ⁇ SD and were normalized to the control
- FIG. 14C shows a simplified schematic illustrating differentiation of hESCs into RBCs. The hESCs were cultured in sequential cytokine combinations to induce the production of multipotent hematopoietic progenitor cells (HPCs) that were released into the medium around day 8. The HPCs were collected and cultured further in medium with EPO and SCF to support erythroid differentiation.
- FIG. 14D shows representative cytospin images of May-Griinwald-Giemsa stained control and SH2B3-KO
- FIG. 14E shows representative flow cytometry plots depicting the expression of CD71 and CD235a on erythroblasts derived from SH2B3- KO and isogenic WT hESCs.
- FIGS. 15A-15E shows the characterization of Erythroid Cells from HSPCs Following SH2B3 Suppression (related to FIG. 14).
- FIG. 15A shows relative expansion of adult HSPCs observed for the indicated EPO concentrations. Erythroid expansion is calculated as total cell expansion until day 18 corrected for the percentage of CD235a positive cells observed by flow cytometry analysis on day 18.
- 15C shows Western blots showing activation of phosphorylated STAT5 (pSTAT5) and phosphorylated KIT Y568 (pKIT Y568) in the human TF-1 erythroid cell line transduced with control (shLuc) or SH2B3 (sh84) shRNAs following cytokine starvation and stimulation with EPO and SCF.
- Cells were selected in puromycin for 48 hours before cytokine starvation.
- pKIT Y568 can be completely eliminated with serum starvation of cells, suggesting baseline stimulation with serum alone.
- STAT5 activation only occurs downstream of specific cytokine receptors, such as the EPO receptor.
- FIGS. 16A-16H show the characterization of Erythroid Cells from SH2B3 knock-down HSPCs and Pluripotent Stem Cells (FIG 16A-16H is related to FIG. 14A-14E).
- FIG. 16A shows representative histogram plots showing Rh blood antigen expression on day 18 mature RBCs derived from adult CD34+ cells.
- FIG. 16C shows Coomassie blue stained SDS-PAGE gels showing major membrane protein bands from RBC ghosts derived from adult RBCs.
- FIG. 16D shows hemoglobin high performance liquid chromatography analysis of mature hemoglobin subtypes in hemolysates from the RBCs produced in culture.
- the peaks for HbF and HbA2 are shaded in the chromatograms with labels above the corresponding peaks.
- FIG. 16E is a schematic illustration showing the single guide RNA (gRNA) utilized to target the depicted SH2B3 DNA sequence adjacent to the protospacer adjacent motif (PAM) to cause double-strand breaks (DSB) by the Cas9 protein in exon 3 of the SH2B3 gene.
- FIG. 16F shows sequences for CRISPR/Cas9-targeted hESCs. The PAM sequence is highlighted in BOLD, and the predicted cleavage site is three bases upstream of the PAM.
- the present invention is directed to methods, systems, and compositions, and kits to produce red blood cells (RBCs) with increased quantity and quality from sources such as stem cells and/or progenitor cells.
- RBCs red blood cells
- SH2B3 has been identified herein as an important negative regulator of RBC production from these sources. That is, the inventor has discovered that SH2B3 inhibits production of RBCs from stem cells and/or progenitor cells.
- the inventor has discovered that lowering SH2B3 protein level and/or mRNA level and/or removing the SH2B3 gene using gene editing approaches (e.g., using a CRISPR/Cas9 or CRISPR/Cpfl) from the genome of the source stem cell or progenitor cell permit the generation of RBCs with increased quantity and quality from these sources.
- gene editing approaches e.g., using a CRISPR/Cas9 or CRISPR/Cpfl
- the present invention releates to the inhibition of SH2B3 in methods, compositions and kits to produce, and improve yields of RBCs produced from stem cells and/or progenitor cells, e.g., as a replacement product for standard transfusions. Accordingly, aspects and embodiments of the invention relate to methods and compositions to inhibit SH2B3 in stem cells and/or progenitor cells for RBC production and methods of use thereof. It has been previously reported in WO2013/019857 that inhibition of AhR, Proxl and/or SH2B3 increases the expansion of multipotent hematopoietic cells (MHCs).
- MHCs multipotent hematopoietic cells
- WO2013/019857 does not describe the differentiation of MHCs into RBCs or the collection of RBCs. And thus WO2013/019857 does not describe nor demonstrate that inhibition of SH2B3 in stem cells and/or progenitor cells can increase the quantity and/or quality of RBCs differentiated from these cells.
- the invention provides a method of producing red blood cells (RBCs) ex vivo from a population of stem cells and/or progenitor cells, the method comprising: (i) inhibiting SH2B3 in the population of stem cells and/or progenitor cells; (ii) culturing the population of stem cells and/or progenitor cells for a time sufficient to induce differentiation of at least one stem cell or progenitor cell to a RBC; and (iii) collecting a population of RBCs.
- RBCs red blood cells
- compositions and methods that reduce expression of SH2B3 mRNA or protein in a cell or in a mammal. Also described are compositions and methods for promoting RBC production and/or expansion from stem cells and/or progenitor cells ex vivo, thus permitting an increase in the amount of RBC for blood transfusions and/or blood banks available to patients as well as increasing the efficacy and/or potential of the same transplant material.
- compositions and methods allow increased yield of RBC from stem cells and/or progenitor cells ex vivo, in comparison to stem cells and/or progenitor cells not treated with an inhibitor of SH2B3, or not having the SH2B3 gene knocked out (i.e., using gene editing proceedures as disclosed herein).
- the compositions and methods allow increased yield of RBC from stem cells and/or progenitor cells obtained from a donor subject who has a blood Type O- (O, Rh-), thereby allowing increase of an unlimited supply of RBC from a universal donor subject. Also contemplated is administration of such iR A compositions to enhance RBC expansion in vivo.
- SH2B3 refers to either the SH2B3 protein or a nucleic acid encoding the SH2B3 protein, depending on the specific context.
- SH2B3 also known as SH2B adaptor protein 3 or Lnk; NCBI Gene ID: 10019
- the mR A of SH2B3 for homo sapiens is known to have at least two isoforms (NCBI Accession No: NM 005475, NM 001291424).
- SH2B3 is expressed primarily in lymphocytes and hematopoietic precursor cells and regulates early lymphohematopoiesis.
- ex vivo refers to a situation or condition where biological cells obtained from an organism (e.g., a mammal) are cultured outside the organism.
- stem cell refers to an undifferentiated cell which is capable of proliferation and giving rise to more progenitor cells having the ability to generate a large number of mother cells that can in turn give rise to differentiated, or differentiable daughter cells.
- the daughter cells themselves can be induced to proliferate and produce progeny that subsequently differentiate into one or more mature cell types, while also retaining one or more cells with parental developmental potential.
- a differentiated cell may derive from a multipotent cell which itself is derived from a multipotent cell, and so on. While each of these multipotent cells may be considered stem cells, the range of cell types each can give rise to may vary considerably. Some differentiated cells also have the capacity to give rise to cells of greater developmental potential. Such capacity may be natural or may be induced artificially upon treatment with various factors. In many biological instances, stem cells are also "multipotent" because they can produce progeny of more than one distinct cell type, but this is not required for "stem-ness.” Self-renewal is the other classical part of the stem cell definition, and it is essential as used in this document.
- Stem cells may divide asymmetrically, with one daughter retaining the stem state and the other daughter expressing some distinct other specific function and phenotype.
- some of the stem cells in a population can divide symmetrically into two stems, thus maintaining some stem cells in the population as a whole, while other cells in the population give rise to differentiated progeny only.
- stem cells that begin as stem cells might proceed toward a more differentiated phenotype, but then "reverse” and re-express a less differentiated phenotype, i.e., a stem cell or stem-cell like phenotype, a term often referred to as “dedifferentiation” or “reprogramming” or “retrodifferentiation” by persons of ordinary skill in the art.
- progenitor or "precursor” cell are used interchangeably herein and refer to cells that have a cellular phenotype that is more primitive (i.e., is at an earlier step along a developmental pathway than a fully differentiated cell) relative to a cell which it can give rise to by differentiation. Often, progenitor cells also have significant or very high proliferative potential. Progenitor cells can give rise to multiple distinct differentiated cell types or to a single differentiated cell type, depending on the developmental pathway and on the environment in which the cells develop and differentiate.
- pluripotent refers to a cell with the capacity, under different conditions, to differentiate to more than one differentiated cell type, and preferably to differentiate to cell types characteristic of all three germ cell layers.
- Pluripotent cells are characterized primarily by their ability to differentiate to more than one cell type, preferably to all three germ layers, using, for example, a nude mouse teratoma formation assay.
- Pluripotency is also evidenced by the expression of embryonic stem (ES) cell markers, although the preferred test for pluripotency is the demonstration of the capacity to differentiate into cells of each of the three germ layers. It should be noted that simply culturing such cells does not, on its own, render them pluripotent.
- Reprogrammed pluripotent cells e.g. induced pluripotent stem (iPS) cells as that term is defined herein
- iPS induced pluripotent stem
- embryonic stem cell or "ES cell” are used interchangeably to refer to the pluripotent stem cells of the inner cell mass of the embryonic blastocyst (see U.S. Pat. Nos. 5,843,780, 6,200,806). Such cells can similarly be obtained from the inner cell mass of blastocysts derived from somatic cell nuclear transfer (see, for example, U.S. Pat. Nos. 5,945,577, 5,994,619, 6,235,970). The distinguishing
- characteristics of an embryonic stem cell define an embryonic stem cell phenotype. Accordingly, a cell has the phenotype of an embryonic stem cell if it possesses one or more of the unique characteristics of an embryonic stem cell such that that cell can be distinguished from other cells. Exemplary distinguishing embryonic stem cell characteristics include, without limitation, gene expression profile, proliferative capacity, differentiation capacity, karyotype, responsiveness to particular culture conditions, and the like.
- HSCs hematopoietic stem cells
- pluripotent stem cells or multipotent stem cells or lymphoid or myeloid (derived from bone marrow) stem cells that can either differentiate into a progenitor cell of a lymphoid, erythroid or myeloid cell lineage or proliferate as a stem cell population without further differentiation having been initiated.
- HSCs can be isolated from bone marrow, peripheral blood, umbilical cord blood, or embryonic stem cells.
- HSCs can form cells such as erythrocytes (red blood cells), platelets, granulocytes (such as neutrophils, basophils, and eosinophils), macrophages, B-lymphocytes, T-lymphocytes, and Natural killer cells.
- HSC are capable of self -renewal or remaining a stem cell after cell division.
- HSCs are also capable of differentiation or starting a path to becoming a mature hematopoietic cell.
- HSCs can also be regulated in their mobility or migration or can be regulated by apoptosis or programmed cell death.
- hematopoietic progenitor cells or "HPCs” as used herein refer to primitive hematopoietic cells that have differentiated to a developmental stage that, when the cells are further exposed to an appropriate cytokine or a group of cytokines, they will differentiate further along the hematopoietic cell lineage. In contrast to HSCs, hematopoietic progenitor cells are only capable of limited self-renewal.
- Hematopoietic progenitor cells as used herein also include “precursor cells” that are derived from differentiation of hematopoietic progenitor cells and are the immediate precursors of mature differentiated hematopoietic cells.
- the term "hematopoietic progenitor cells”, as used herein include, but are not limited to, granulocyte-macrophage colony-forming cell (GM-CFC), megakaryocyte colony- forming cell (Mk-CFC), burst-forming unit erythroid (BFU-E), B cell colony- forming cell (B-CFC) and T cell colony-forming cell (T-CFC).
- GM-CFC granulocyte-macrophage colony-forming cell
- Mk-CFC megakaryocyte colony- forming cell
- BFU-E burst-forming unit erythroid
- B-CFC B cell colony- forming cell
- T-CFC T cell colony-forming
- Precursor cells include, but are not limited to, colony-forming unit- erythroid (CFU-E), granulocyte colony forming cell (G-CFC), colony- forming cell-basophil (CFC-Bas), colonyforming cell- eosinophil (CFC-Eo) and macrophage colonyforming cell (M-CFC) cells.
- CFU-E colony-forming unit- erythroid
- G-CFC granulocyte colony forming cell
- CFC-Bas colony- forming cell-basophil
- CFC-Eo colonyforming cell- eosinophil
- M-CFC macrophage colonyforming cell
- hematopoietic stem and progenitor cells or "HSPCs” as used herein refer to a mixture of hematopoietic stem cells and hematopoietic progenitor cells.
- expanding and “expansion” refer to substantially differentiation-less cell growth, i.e., increase of a cell population without differentiation accompanying such increase.
- differentiated is a relative term, where a “differentiated cell” is a cell that has progressed further down the developmental pathway than the cell it is being compared with.
- stem cells can differentiate to lineage-restricted precursor cells (such as a hematopoietic stem cell), which in turn can differentiate into other types of precursor cells further down the pathway (such as a thymocyte, or a T lymphocyte precursor), and then to an end-stage
- differentiated cell which plays a characteristic role in a certain tissue type, and may or may not retain the capacity to proliferate further.
- cell culture medium (also referred to herein as a “culture medium” or “medium”) as referred to herein is a medium for culturing cells containing nutrients that maintain cell viability and support proliferation.
- the cell culture medium may contain any of the following in an appropriate combination: salt(s), buffer(s), amino acids, glucose or other sugar(s), antibiotics, serum or serum replacement, and other components such as peptide growth factors, etc.
- Cell culture media ordinarily used for particular cell types are known to those skilled in the art.
- the terms “increased,” “increase,” “enhance,” or “expand” are all used herein to generally mean an increase in the number of cells (e.g., stem cells, progenitor cells, or RBCs) or in the quality of cells by a statically significant amount; for the avoidance of any doubt, the terms “increased,” “increase,” “expand,” “expanded,” or “enhance” mean an increase, as compared to a reference level, of at least about 10%, of at least about 15%, of at least about 20%, of at least about 25%, of at least about 30%, of at least about 35%, of at least about 40%, of at least about 45%, of at least about 50%, of at least about 55%, of at least about 60%, of at least about 65%, of at least about 70%, of at least about 75%, of at least about 80%, of at least about 85%, of at least about 90%, of at least about 95%, or up to and including a 100%, or at least about a
- the terms “decrease” , “reduced”, “reduction” , “decrease” or “inhibit” are all used herein generally to mean a decrease by a statistically significant amount. However, for avoidance of doubt, “reduced”, “reduction” or “decrease” or “inhibit” typically means a decrease by at least about 5%- 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% decrease (i.e. absent level as compared to a reference sample), or any decrease between 10- 100% as compared to a reference level.
- statically significant or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
- nucleic acid refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
- the nucleic acid can be either single-stranded or double-stranded.
- a single- stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA.
- the nucleic acid can be DNA.
- nucleic acid can be RNA.
- Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
- protein and “polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues.
- protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
- modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
- amino acid analogs regardless of its size or function.
- Protein and “polypeptide” are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
- polypeptide proteins and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof.
- exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
- an "antibody” refers to IgG, IgM, IgA, IgD or IgE molecules or antigen-specific antibody fragments thereof (including, but not limited to, a Fab, F(ab')2, Fv, disulphide linked Fv, scFv, single domain antibody, closed conformation multispecific antibody, disulphide-linked scfv, diabody), whether derived from any species that naturally produces an antibody, or created by recombinant DNA technology; whether isolated from serum, B-cells, hybridomas, transfectomas, yeast or bacteria.
- an "antigen” is a molecule that is bound by a binding site comprising the complementarity determining regions (CDRs) of an antibody agent.
- CDRs complementarity determining regions
- antigens are bound by antibody ligands and are capable of raising an antibody response in vivo.
- An antigen can be a polypeptide, protein, nucleic acid or other molecule or portion thereof.
- antigenic determinant refers to an epitope on the antigen recognized by an antigen-binding molecule, and more particularly, by the antigen- binding site of said molecule.
- an antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds to a given antigen.
- An antibody reagent can comprise an antibody or a polypeptide comprising an antigen- binding domain of an antibody.
- an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody.
- an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL).
- an antibody in another example, includes two heavy (H) chain variable regions and two light (L) chain variable regions.
- antibody reagent encompasses antigen- binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J.
- An antibody can have the structural features of IgA, IgG, IgE, IgD, IgM (as well as subtypes and combinations thereof).
- Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies.
- Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like.
- VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” ("CDR"), interspersed with regions that are more conserved, termed “framework regions” ("FR").
- CDR complementarity determining regions
- FR framework regions
- the extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; which are incorporated by reference herein in their entireties).
- Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- binding fragments encompassed within the term "antigen-binding fragment" of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CHI domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341 :544-546; which is incorporated by reference herein in its entirety), which consists of a VH or VL domain; and (vi) an isolated complementarity determining region (CDR) that retains
- specific binding refers to a chemical interaction between two molecules, compounds, cells and/or particles wherein the first entity binds to the second, target entity with greater specificity and affinity than it binds to a third entity which is a non-target.
- specific binding can refer to an affinity of the first entity for the second target entity which is at least 10 times, at least 50 times, at least 100 times, at least 500 times, at least 1000 times or greater than the affinity for the third nontarget entity.
- a reagent specific for a given target is one that exhibits specific binding for that target under the conditions of the assay being utilized.
- specific binding is indicated by a dissociation constant on the order of ⁇ 10 "8 M, ⁇ 10 "9 M, ⁇ 10 "10 M or below.
- expression level refers to the number of mRNA molecules and/or polypeptide molecules encoded by a given gene that are present in a cell or sample. Expression levels can be increased or decreased relative to a reference level.
- iR A agent or "RNAi agent” refers to an agent that contains RNA as that term is defined herein, and which mediates the targeted cleavage of an RNA transcript via an RNA- induced silencing complex (RISC) pathway.
- RISC RNA- induced silencing complex
- an iRNA as described herein inhibits the expression SH2B3/Lnk a stem cell or progenitor cell, e.g., HSC or a mammal.
- target sequence refers to a contiguous portion of the nucleotide sequence of a messenger RNA (mRNA) molecule formed during the transcription of a gene, including mRNA that is a product of RNA processing of a primary transcription product.
- mRNA messenger RNA
- the target portion of the sequence will be at least long enough to serve as a specific binding site for an iRNA agent and/or as a substrate for iRNA- directed cleavage at or near that portion.
- the target sequence will generally be from 9-36 nucleotides in length, e.g., 15-30 nucleotides in length, including all sub-ranges therebetween.
- the target sequence can be from 15-30 nucleotides, 15- 26 nucleotides, 15-23 nucleotides, 15-22 nucleotides, 15-21 nucleotides, 15-20 nucleotides, 15- 19 nucleotides, 15-18 nucleotides, 15-17 nucleotides, 18-30 nucleotides, 18-26 nucleotides, 18- 23 nucleotides, 18-22 nucleotides, 18-21 nucleotides, 18-20 nucleotides, 19-30 nucleotides, 19-26 nucleotides, 19-23 nucleotides, 19-22 nucleotides, 19-21 nucleotides, 19-20 nucleotides, 20-30 nucleotides, 20-26 nucleotides, 20-25 nucleotides, 20-24
- strand comprising a sequence refers to an oligonucleotide comprising a chain of nucleotides that is described by the sequence referred to using the standard nucleotide
- the term "complementary,” when used to describe a first nucleotide sequence in relation to a second nucleotide sequence, refers to the ability of an oligonucleotide or polynucleotide comprising the first nucleotide sequence to hybridize and form a duplex structure under certain conditions with an oligonucleotide or polynucleotide comprising the second nucleotide sequence, as will be understood by the skilled person.
- Such conditions can, for example, be stringent conditions, where stringent conditions can include: 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 50°C or 70°C for 12-16 hours followed by washing.
- stringent conditions can include: 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 50°C or 70°C for 12-16 hours followed by washing.
- Other conditions such as physiologically relevant conditions as can be encountered inside an organism, can apply. The skilled person will be able to determine the set of conditions most appropriate for a test of complementarity of two sequences in accordance with the ultimate application of the hybridized nucleotides.
- Complementary sequences within an iRNA include base-pairing of the oligonucleotide or polynucleotide comprising a first nucleotide sequence to an oligonucleotide or polynucleotide comprising a second nucleotide sequence over the entire length of one or both nucleotide sequences.
- Such sequences can be referred to as "fully complementary” with respect to each other herein.
- first sequence is referred to as “substantially complementary” with respect to a second sequence herein
- the two sequences can be fully complementary, or they can form one or more, but generally not more than 5, 4, 3 or 2 mismatched base pairs upon hybridization for a duplex up to 30 base pairs, while retaining the ability to hybridize under the conditions most relevant to their ultimate application, e.g., inhibition of gene expression via a RISC pathway.
- two oligonucleotides are designed to form, upon hybridization, one or more single stranded overhangs, such overhangs shall not be regarded as mismatches with regard to the determination of complementarity.
- a dsRNA comprising one oligonucleotide 21 nucleotides in length and another oligonucleotide 23 nucleotides in length, wherein the longer oligonucleotide comprises a sequence of 21 nucleotides that is fully complementary to the shorter oligonucleotide, can yet be referred to as "fully complementary" for the purposes described herein.
- “Complementary” sequences can also include, or be formed entirely from, non- Watson-Crick base pairs and/or base pairs formed from non-natural and modified nucleotides, in as far as the above requirements with respect to their ability to hybridize are fulfilled.
- non- Watson-Crick base pairs includes, but are not limited to, G:U Wobble or Hoogstein base pairing.
- a polynucleotide that is "substantially complementary to at least part of a messenger RNA (mRNA) refers to a polynucleotide that is substantially complementary to a contiguous portion of the mRNA of interest (e.g., an mRNA encoding SH2B3).
- mRNA messenger RNA
- a polynucleotide is complementary to at least a part of a mRNA if the sequence is substantially complementary to a non- interrupted portion of the mRNA.
- double-stranded RNA refers to an iRNA that includes an RNA molecule or complex of molecules having a hybridized duplex region that comprises two anti- parallel and substantially complementary nucleic acid strands, which will be referred to as having "sense” and “antisense” orientations with respect to a target RNA.
- the duplex region can be of any length that permits specific degradation of a desired target RNA through a RISC pathway, but will typically range from 9 to 36 base pairs in length, e.g., 15-30 base pairs in length.
- the duplex can be any length in this range, for example, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, or 36 and any sub-range therein between, including, but not limited to 15-30 base pairs, 15-26 base pairs, 15-23 base pairs, 15-22 base pairs, 15-21 base pairs, 15-20 base pairs, 15-19 base pairs, 15-18 base pairs, 15-17 base pairs, 18-30 base pairs, 18-26 base pairs, 18-23 base pairs, 18-22 base pairs, 18-21 base pairs, 18-20 base pairs, 19-30 base pairs, 19-26 base pairs, 19-23 base pairs, 19-22 base pairs, 19-21 base pairs, 19-20 base pairs, 20- 30 base pairs, 20-26 base pairs, 20-25 base pairs, 20-24 base pairs, 20-23 base pairs, 20-22 base pairs, 20-21 base pairs, 21-30 base pairs, 21-26 base pairs, 21-25 base pairs, 21-24 base pairs, 21- 23 base pairs, or 21-22 base pairs,
- the two strands forming the duplex structure can be from a single RNA molecule having at least one self-complementary region, or can be formed from two or more separate RNA molecules. Where the duplex region is formed from two strands of a single molecule, the molecule can have a duplex region separated by a single stranded chain of nucleotides (herein referred to as a "hairpin loop") between the 3'-end of one strand and the 5'-end of the respective other strand forming the duplex structure.
- a single stranded chain of nucleotides herein referred to as a "hairpin loop
- the hairpin loop can comprise at least one unpaired nucleotide; in some embodiments the hairpin loop can comprise at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 23 or more unpaired nucleotides.
- the two substantially complementary strands of a dsRNA are comprised by separate RNA molecules, those molecules need not, but can be covalently connected.
- the connecting structure is referred to as a "linker.”
- the term "siRNA” is also used herein to refer to a dsRNA as described above.
- RNA molecule or "ribonucleic acid molecule” encompasses not only RNA molecules as expressed or found in nature, but also analogs and derivatives of RNA comprising one or more ribonucleotide/ribonucleoside analogs or derivatives as described herein or as known in the art.
- ribonucleoside includes a nucleoside base and a ribose sugar
- ribonucleotide is a ribonucleoside with one, two or three phosphate moieties.
- ribonucleoside and ribonucleotide can be considered to be equivalent as used herein.
- the RNA can be modified in the nucleobase structure or in the ribose-phosphate backbone structure, e.g., as described herein below.
- the molecules comprising ribonucleoside analogs or derivatives must retain the ability to form a duplex.
- an RNA molecule can also include at least one modified ribonucleoside including but not limited to a 2'-0-methyl modified nucleoside, a nucleoside comprising a 5' phosphorothioate group, a terminal nucleoside linked to a cholesteryl derivative or dodecanoic acid bisdecylamide group, a locked nucleoside, an abasic nucleoside, a 2'-deoxy-2'-fluoro modified nucleoside, a 2'-amino-modified nucleoside, 2'-alkyl-modified nucleoside, morpholino nucleoside, a phosphoramidate or a non-natural base comprising nucleoside, or any combination thereof.
- a 2'-0-methyl modified nucleoside a nucleoside comprising a 5' phosphorothioate group, a terminal nucleoside linked to a cholesteryl derivative or dodecanoic acid bisdecyl
- an RNA molecule can comprise at least two modified ribonucleosides, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more, up to the entire length of the dsRNA molecule.
- the modifications need not be the same for each of such a plurality of modified ribonucleosides in an RNA molecule.
- modified RNAs contemplated for use in methods and compositions described herein are peptide nucleic acids (PNAs) that have the ability to form the required duplex structure and that permit or mediate the specific degradation of a target RNA via a RISC pathway.
- PNAs peptide nucleic acids
- a modified ribonucleoside includes a deoxyribonucleoside.
- an iRNA agent can comprise one or more deoxynucleosides, including, for example, a deoxynucleoside overhang(s), or one or more deoxynucleosides within the double stranded portion of a dsRNA.
- iRNA double stranded DNA molecule encompassed by the term "iRNA.”
- an RNA interference agent includes a single stranded RNA that interacts with a target RNA sequence to direct the cleavage of the target RNA.
- a Type III endonuclease known as Dicer (Sharp et al., Genes Dev. 2001, 15:485).
- Dicer a ribonuclease-III-like enzyme, processes the dsRNA into 19-23 base pair short interfering RNAs with characteristic two base 3' overhangs (Bernstein, et al., (2001) Nature 409:363).
- RNA- induced silencing complex RISC
- one or more helicases unwind the siRNA duplex, enabling the complementary antisense strand to guide target recognition (Nykanen, et al., (2001) Cell 107:309).
- target recognition Nykanen, et al., (2001) Cell 107:309
- one or more endonucleases within the RISC cleaves the target to induce silencing (Elbashir, et al., (2001) Genes Dev. 15: 188).
- the technology described herein relates to a single stranded RNA that promotes the formation of a RISC complex to effect silencing of the target gene.
- nucleotide overhang refers to at least one unpaired nucleotide that protrudes from the duplex structure of an iRNA, e.g., a dsRNA.
- a dsRNA can comprise an overhang of at least one nucleotide; alternatively the overhang can comprise at least two nucleotides, at least three nucleotides, at least four nucleotides, at least five nucleotides or more.
- a nucleotide overhang can comprise or consist of a nucleotide/nucleoside analog, including a
- the overhang(s) can be on the sense strand, the antisense strand or any combination thereof. Furthermore, the nucleotide(s) of an overhang can be present on the 5' end, 3' end or both ends of either an antisense or sense strand of a dsRNA.
- the antisense strand of a dsRNA has a 1-10 nucleotide overhang at the 3' end and/or the 5' end. In one embodiment, the sense strand of a dsRNA has a 1-10 nucleotide overhang at the 3' end and/or the 5' end. In another embodiment, one or more of the nucleotides in the overhang is replaced with a nucleoside thiophosphate.
- dsRNA or dsDNA mean that there are no unpaired nucleotides or nucleotide analogs at a given terminal end of a dsRNA or dsDNA molecule, i.e., no nucleotide overhang.
- One or both ends of a dsRNA or dsDNA can be blunt. Where both ends of a dsRNA or dsDNA are blunt, the dsRNA or dsDNAis said to be blunt ended.
- a "blunt ended" dsRNA or dsDNA is a dsRNA or dsDNAthat is blunt at both ends, i.e., no nucleotide overhang at either end of the molecule. Most often such a molecule will be double-stranded over its entire length.
- blunt ends refers to dsDNA or dsRNA molecule that has at least 1 or more (typically 2-5 or more) nucleocleotide overhang.
- antisense strand or "guide strand” refers to the strand of an iRNA, e.g., a dsRNA, which includes a region that is substantially complementary to a target sequence.
- region of complementarity refers to the region on the antisense strand that is substantially complementary to a sequence, for example a target sequence, as defined herein. Where the region of complementarity is not fully complementary to the target sequence, the mismatches can be in the internal or terminal regions of the molecule. Generally, the most tolerated mismatches are in the terminal regions, e.g., within 5, 4, 3, or 2 nucleotides of the 5' and/or 3' terminus.
- sense strand refers to the strand of an iRNA that includes a region that is substantially complementary to a region of the antisense strand as that term is defined herein.
- SNALP refers to a stable nucleic acid-lipid particle.
- a SNALP represents a vesicle of lipids coating a reduced aqueous interior comprising a nucleic acid such as an iRNA or a plasmid from which an iRNA is transcribed.
- SNALPs are described, e.g., in U.S. Patent Application Publication Nos. 20060240093, 20070135372, and in International Application No. WO 2009082817. These applications are incorporated herein by reference in their entirety. Examples of "SNALP" formulations are described elsewhere herein.
- the phrase "inhibit the expression of,” refers to at an least partial reduction of gene expression of a gene encoding SH2B3 in a cell treated with SH2B3 inhibitor (e.g., an iRNA composition as described herein) compared to the expression of SH2B3 in an untreated cell.
- SH2B3 inhibitor e.g., an iRNA composition as described herein
- the degree of inhibition is usually expressed in terms of [mRNA in control cells] - [mRNA in treated cells ]
- the degree of inhibition can be given in terms of a reduction of a parameter that is functionally linked to gene expression, e.g., the amount of protein encoded by a gene, or the number of cells displaying a certain phenotype.
- gene silencing can be determined in any cell expressing, either constitutively or by genomic engineering, and by any appropriate assay.
- the assays provided in the Examples below shall serve as such reference.
- expression of SH2B3 is suppressed by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% by administration of an iRNA featured herein.
- a gene encoding SH2B3 in a cell is suppressed by at least about 60%, 70%, or 80% or more than 80% by administration of an iRNA or gene editing proceedures (i.e., CRISPR/Cas9 or CRISPR/Cpfl) as featured herein.
- a gene encoding SH2B3 is suppressed by at least about 85%, 90%, 95%, 98%, 99% or more by administration of an iRNA (or gene editing proceedures) as described herein.
- iRNA means facilitating or effecting uptake or absorption into the cell, as is understood by those skilled in the art. Absorption or uptake of an iRNA can occur through unaided diffusive or active cellular processes, or by auxiliary agents or devices. The meaning of this term is not limited to cells in vitro; an iRNA can also be “introduced into a cell,” wherein the cell is part of a living organism. In such an instance, introduction into the cell will include the delivery to the organism.
- iRNA can be injected into a tissue site or administered systemically. In vivo delivery can also be by a beta-glucan delivery system, such as those described in U.S.
- subject and “individual” are used interchangeably herein, and refer to an animal, for example, a human from whom cells for use in the methods described herein can be obtained (i.e., donor subject) and/or to whom treatment, including prophylactic treatment, with the cells as described herein, is provided, i.e., recipient subject.
- treatment including prophylactic treatment, with the cells as described herein, is provided, i.e., recipient subject.
- recipient subject for treatment of those conditions or disease states that are specific for a specific animal such as a human subject, the term subject refers to that specific animal.
- the "non-human animals” and “non-human mammals” as used interchangeably herein, includes mammals such as rats, mice, rabbits, sheep, cats, dogs, cows, pigs, and non-human primates.
- subject also encompasses any vertebrate including but not limited to mammals, reptiles, amphibians and fish.
- the subject is a mammal such as a human, or other mammals such as a domesticated mammal, e.g. dog, cat, horse, and the like, or production mammal, e.g. cow, sheep, pig, and the like.
- administering refers to the placement of a compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the agent at a desired site.
- Pharmaceutical compositions comprising the compounds disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject.
- the administration can be systemic or local.
- the term "effective amount" when used to describe an antagonist of SH2B3, refers to an amount sufficient to decrease the activity of the SH2B3 protein or decrease SH2B3 mRNA or protein level by at least 10%, e.g., at least 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, or at least about 90%.
- the term "consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
- the population of stem cells and/or progenitor cells can be hematopoietic stem cells, hematopoietic progenitor cells, pluripotent stem cells, induced pluripotent stem cells (iPSCs), embryonic stem cells, or combinations thereof.
- the population of stem cells and/or progenitor cells is of mammalian origin. In some embodiments, the population of stem cells and/or progenitor cells is of human origin.
- the stem cells and/or progenitor cells can be obtained from an autologous donor. That is, the donor of the stem cells or progenitor cells will also be the recipient of the RBCs derived from such stem cells and/or progenitor cells.
- the stem cells and/or progenitor cells can be obtained from an allogenic donor, such as a sibling, parent, or other relative of a subject in need of blood transfusion. Examples of patients that can benefit from autologous and/or allogenic donation are well known in the art and include, without limitation, those suffering from an autoimmune disorder, blood disease or disorder, immune disease or disorder, or other related diseases or conditions.
- RBC compatibility is well known in the art and is summarized in Table 1.
- the population of stem cells is a population of hematopoietic stem cells. It is known in the art that HSCs may or may not include CD34+ cells. CD34+ cells are immature cells that express the CD34 cell surface marker. CD34+ cells are believed to include a subpopulation of cells with stem cell properties. HSCs include pluripotent stem cells, multipotent stem cells (e.g., a lymphoid stem cell), and/or stem cells committed to specific hematopoietic lineages.
- the stem cells committed to specific hematopoietic lineages can be of T cell lineage, B cell lineage, dendritic cell lineage, Langerhans cell lineage and/or lymphoid tissue- specific macrophage cell lineage.
- HSCs also refer to long term HSC (LT-HSC) and short term HSC (ST-HSC).
- LT-HSC long term HSC
- ST-HSC short term HSC
- a long term stem cell typically includes the long term (more than three months) contribution to multilineage engraftment after transplantation.
- a short term stem cell is typically anything that lasts shorter than three months, and/or that is not multilineage.
- LT- HSC and ST-HSC are distinguished, for example, based on their cell surface marker expression.
- LT-HSC are CD34-, SCA-1+, Thyl.l+/lo, C-kit+, Un-, CD135-, Slamfl/CD150+
- ST- HSC are CD34+, SCA-1+ , Thyl.BVlo, C- kit+, lin-, CD 135-, Slamfl/CD150+, Mac- 1 (CDlIb)lo (Handbook of Stem Cells. Lanza, R.P. et al. (Eds.) Elsevier Academic Press Burlington, MA (2004)).
- ST-HSC are less quiescent (i.e., more active) and more proliferative than LT-HSC.
- LT-HSC have unlimited self-renewal (i.e., they survive throughout adulthood), whereas ST-HSC have limited self-renewal (i.e., they survive for only a limited period of time). Any of these HSCs can be used advantageously in any of the methods described herein.
- hematopoietic stem cells encompassed for use in the methods, compositions and kits as disclosed herein include primitive cells capable of differentiating to generate all cells of the hematopoietic lineage.
- HSC encompassed for use in the methods and compositions as disclosed herein also includes more generally to immature blood cells having the capacity to self-renew and to differentiate into more mature blood cells comprising granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), and/or monocytes (e.g., monocytes, macrophages).
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.
- the stem cells or progenitor cells are obtained from a donor subject who is Type O blood type, and therefore is a universal donor.
- the stem cells or progenitor cells are obtained from a donor subject who is O negative (0-) blood type (i.e.., Type O, Rh factor negative), and therefore is a universal donor.
- the stem cells or progenitor cells or HSCs are obtained from a subject whom is Type AB bloot type, and is a universal plasma donor.
- the stem cells or progenitor cells are obtained from a subject of the same ethnic background as the recipient subject.
- Table 2 shows the distribution of different blood types in different enthic backgrounds.
- HSCs can be obtained from blood products.
- a blood product includes a product obtained from the body or an organ of the body containing cells of hematopoietic origin. Such sources include
- unfractionated bone marrow peripheral blood mononuclear cells, umbilical cord blood, umbilical cord tissue, peripheral blood (e.g., G-CSF mobilize peripheral blood), liver, thymus, lymph and spleen.
- All of the aforementioned crude or unfractionated blood products can be enriched for cells having hematopoietic stem cell characteristics in a number of ways. For example, the more mature, differentiated cells are selected against, via cell surface molecules they express.
- the blood product is fractionated by selecting for CD34+ cells.
- CD34+ cells include a subpopulation of cells capable of self -renewal and pluripotentiality. Such selection is accomplished using, for example, commercially available magnetic anti-CD34 beads (Dynal, Lake Success, NY).
- Sources for HSC expansion also include aorta-gonad-mesonephros (AGM) derived cells, embryonic stem cells (ESCs) and induced pluripotent stem cells (iPSCs).
- AGM aorta-gonad-mesonephros
- ESCs embryonic stem cells
- iPSCs induced pluripotent stem cells
- ESCs are well- known in the art, and can be obtained from commercial or academic sources (Thomson et al., 282 Sci. 1 145-47 (1998)).
- iPSCs are a type of pluripotent stem cell artificially derived from a non-pluripotent cell, typically an adult somatic cell, by inducing a "forced" expression of certain genes (Baker, Nature Rep. Stem Cells (Dec.
- ESCs, AGM, and iPSCs can be derived from animal or human sources.
- the AGM stem cell is a cell that is born inside the aorta, and colonizes the fetal liver.
- the population of stem cells is a population of iPSCs.
- induced pluripotent stem cell or "iPSC” or “iPS cell” refers to a cell derived from reprogramming of the differentiation state of a differentiated cell (e.g. a somatic cell) into a pluripotent cell.
- An induced pluripotent stem cell a) can self- renew, and b) can differentiate to produce all types of cells in an organism.
- iPS cells have an ES cell-like morphology, growing as flat colonies with large nucleo-cytoplasmic ratios, defined borders and prominent nucleoli.
- iPS cells express one or more key pluripotency markers known by one of ordinary skill in the art, including but not limited to Alkaline Phosphatase, SSEA3, SSEA4, Sox2, Oct3/4, Nanog, T AI60, TRA 181 , TDGF 1 , Dnmt3b, FoxD3, GDF3, Cyp26al, TERT, and zfp42.
- IPS cells may be generated by providing the cell with "reprogramming factors", i.e., one or more, e.g., a cocktail, of biologically active factors that act on a cell to alter transcription, thereby reprogramming a cell to pluripotency.
- the population of stem cells is a population of nuclear-transfer stem cells (NT-ESCs), or human NT-ESCs (hNT-ESCs).
- NT-ESCs nuclear-transfer stem cells
- hNT-ESCs human NT-ESCs
- SCNT somatic cell nuclear transfer
- the distinguishing characteristics of an embryonic stem cell define an embryonic stem cell phenotype. Accordingly, a cell has the phenotype of an embryonic stem cell if it possesses one or more of the unique characteristics of an embryonic stem cell such that that cell can be distinguished from other cells. Exemplary distinguishing embryonic stem cell characteristics include, without limitation, gene expression profile, proliferative capacity, differentiation capacity, karyotype, responsiveness to particular culture conditions, and the like.
- the disclosure described herein does not concern a process for cloning human beings, processes for modifying the germ line genetic identity of human beings, uses of human embryos for industrial or commercial purposes or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes.
- the population of progenitor cells is a population of hematopoietic progenitor cells.
- Hematopoietic progenitor cells can be obtained from a variety of sources including, for example, bone marrow, peripheral blood, and umbilical cord blood.
- Hematopoietic progenitor cells can also be obtained from peripheral blood of a progenitor cell donor. Prior to harvest of the cells from peripheral blood, the donor can be treated with a cytokine, such as granulocyte-colony stimulating factor, to promote cell migration from the bone marrow to the blood compartment.
- a cytokine such as granulocyte-colony stimulating factor
- the white blood cell population obtained i.e., a mixture of stem cells, progenitors and white blood cells of various degrees of maturity
- Hematopoietic progenitor cells are capable of differentiation into one or more mature cell types of the hematopoietic lineage, but are not capable of long-term self-renewal. Thus, hematopoietic progenitor cells can restore and sustain hematopoiesis for three to four months (Marshak, D. Pv., et al. (2001). Stem cell biology, Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press) and are important for recovery in the period immediately following a hematopoietic progenitor cell transplant in an individual. Hematopoietic progenitor cells useful for transplantation can be obtained from a variety of sources including, for example, bone marrow, peripheral blood, and umbilical cord blood.
- Bone marrow can be obtained by puncturing bone with a needle and removing bone marrow cells with a syringe (herein called "bone marrow aspirate").
- Hematopoietic progenitor cells can be isolated from the bone marrow aspirate prior to transplantation by using surface markers specific for hematopoietic progenitor cells, or alternatively whole bone marrow can be transplanted into an individual to be treated with the methods described herein.
- Hematopoietic progenitor cells and/or a heterogeneous hematopoietic progenitor cell population can also be isolated from human umbilical cord and/or placental blood.
- Such blood can be collected by several methods known in the art.
- umbilical cord blood is a rich source of HSPCs (see Nakahata & Ogawa, 70 J. Clin. Invest. 1324-28 (1982); Prindull et al., 67 Acta. Paediatr. Scand. 413-16 (1978); Tchernia et al., 97(3) J. Lab. Clin. Med. 322-31 (1981))
- an excellent source for neonatal blood is the umbilical cord and placenta.
- the neonatal blood Prior to cryopreservation, the neonatal blood can be obtained by direct drainage from the cord and/or by needle aspiration from the delivered placenta at the root and at distended veins. See, e.g., U.S. Pat. No. 7,160,714; No. 5,1 14,672; No. 5,004,681 ; U.S. patent application Ser. No. 10/076, 180, Pub. No. 20030032179. Indeed, umbilical cord blood stem cells have been used to reconstitute
- fetal blood can be taken from the fetal circulation at the placental root with the use of a needle guided by ultrasound (Daffos et al., 153 Am. J. Obstet. Gynecol. 655-60 (1985); Daffos et al., 146 Am. J. Obstet. Gynecol. 985-87 (1983), by placentocentesis (Valenti, 1 15 Am. J. Obstet. Gynecol. 851- 53 (1973); Cao et al., 19 J. Med. Genet.
- chorionic villus and amniotic fluid in addition to cord blood and placenta, are sources of pluripotent fetal stem cells (see WO 2003 042405).
- kits and collection devices are known for the collection, processing, and storage of cord blood. See, e.g., U.S. Pat. No. 7, 147,626; No. 7, 131,958. Collections should be made under sterile conditions, and the blood can be treated with an anticoagulant.
- anticoagulants include, for example, citrate -phosphate-dextrose, acid citrate-dextrose, Alsever's solution (Alsever & Ainslie, 41 N.Y. St. J. Med. 126-35 (1941), DeGowin's Solution (DeGowin et al., 1 14 JAMA 850-55 (1940)), Edglugate-Mg (Smith et al., 38 J. Thorac.
- the HSPCs can be obtained from crypgenically prepared blood.
- collected blood is prepared for cryogenic storage by addition of cryoprotective agents such as DMSO (Lovelock & Bishop, 183 Nature 1394-95 (1959); Ashwood-Smith 190 Nature 1204-05 (1961)), glycerol, polyvinylpyrrolidine (Rinfret, 85 Ann. N.Y. Acad. Sci.
- hematopoietic stem cells can be isolated using commercially available antibodies that bind to hematopoietic stem cell surface antigens, e.g. CD34, using methods known to those of skill in the art.
- cells as described herein can be maintained and expanded in culture medium that is available to and well-known in the art.
- Such media include, but are not limited to, Dulbecco's Modified Eagle's, F-12KTM., EAGLE'S MINIMUM ESSENTIAL MEDIUMTM (DMEM), DMEM F12 Medium.RTM., and Serum-FreeTM, RPMI-1640 MediumTM, Iscove's Modified Dulbecco's MediumTM (IMDM).
- DMEM Dulbecco's Modified Eagle's
- F-12KTM EAGLE'S MINIMUM ESSENTIAL MEDIUMTM
- DMEM DMEM F12 Medium.RTM.
- Serum-FreeTM RPMI-1640 MediumTM
- Iscove's Modified Dulbecco's MediumTM IMDM
- Many media for culture and expansion of hematopoietic cells are also available as low-glucose formulations, with or without sodium pyruvate.
- Also contemplated herein is supplementation of cell culture medium with mammalian sera.
- Sera often contain cellular factors and components that are necessary for viability and expansion.
- examples of sera include fetal bovine serum (FBS), bovine serum (BS), calf serum (CS), fetal calf serum (FCS), newborn calf serum (NCS), goat serum (GS), horse serum (HS), human serum, chicken serum, porcine serum, sheep serum, rabbit serum, serum replacements and bovine embryonic fluid. It is understood that sera can be heat- inactivated at 55-65. degree. C. if deemed necessary to inactivate components of the complement cascade.
- Additional supplements also can be used advantageously to supply the cells with the necessary trace elements for optimal growth and expansion.
- Such supplements include, for example, insulin, transferrin, sodium selenium and combinations thereof.
- These components can be included in a salt solution including, but not limited to, (HBSS), EARLE'S SALTTM, Hanks' Balanced Salt Solution, antioxidant supplements, MCDB-201TM.
- Solution saline (PBS) ascorbic acid and ascorbic acid-2-phosphate, as well as additional amino acids.
- Many cell culture media already contain amino acids, however, some require supplementation prior to culturing cells.
- Such amino acids include, but are not limited to, L-alanine, L- arginine, L-aspartic acid, L-asparagine, L-cysteine, L-cystine, L-glutamic acid, L-glutamine, L-glycine, L- histidine, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-serine, L-threonine, L-tryptophan, L-tyrosine, and L-valine. It is well within the skill of one in the art to determine the proper concentrations of these supplements.
- Hormones also can be advantageously used in the cell cultures described herein and include, but are not limited to, D-aldosterone, diethylstilbestrol (DES), dexamethasone, .beta.-estradiol, hydrocortisone, insulin, prolactin, progesterone, somatostatin/human growth hormone (HGH), thyrotropin, thyroxine and L- thyronine.
- DES diethylstilbestrol
- dexamethasone .beta.-estradiol
- hydrocortisone hydrocortisone
- insulin prolactin
- progesterone progesterone
- HGH somatostatin/human growth hormone
- thyrotropin thyroxine
- L- thyronine L- thyronine
- Lipids and lipid carriers also can be used to supplement cell culture media, depending on the type of cell and the fate of the differentiated cell.
- Such lipids and carriers can include, but are not limited to, cholesterol, linoleic acid conjugated to albumin, cyclodextrin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, linoleic-oleic-arachidonic acid conjugated to albumin and oleic acid unconjugated and conjugated to albumin, among others.
- HSPCs can be cultured in low-serum or serum-free culture medium.
- Serum-free medium used to culture cells is described in, for example, U.S. Pat. No. 7,015,037. Many cells have been grown in serum- free or low-serum medium.
- the medium can be supplemented with one or more growth factors.
- Commonly used growth factors include, but are not limited to, bone morphogenic protein, basic fibroblast growth factor, platelet-derived growth factor and epidermal growth factor, Stem cell factor, thrombopoietin, Flt3Ligand and l'-3. See, for example, U.S. Pat. Nos. 7, 169,610; 7, 109,032; 7,037,721 ; 6,617,161 ;
- Cells in culture can be maintained either in suspension or attached to a solid support, such as extracellular matrix components.
- a solid support such as extracellular matrix components.
- Stem cells often require additional factors that encourage their attachment to a solid support, such as type I and type II collagen, chondroitin sulfate, fibronectin, "superfibronectin” and fibronectin-like polymers, gelatin, poly-D and poly-L-lysine, thrombospondin and vitronectin.
- HSPCs can also be cultured in low attachment flasks such as but not limited to Corning Low attachment plates.
- hematopoietic stem and/or progenitor cells are treated ex vivo by contacting a population of hematopoetic cells with compositions comprising at least one SH2B3 inhibitor (i.e., SH2B3 iRNA or gene editing system) as described here into differentiate them into RBC, which are collected and then subsequently transplanted to an individual in need thereof.
- SH2B3 inhibitor i.e., SH2B3 iRNA or gene editing system
- the effective concentration of the SH2B3 inhibitor can be determined by those of skill in the art, for example by performing serial dilutions and testing efficacy in an appropriate in vitro assay , or other suitable system.
- Example concentration ranges for the treatment of the hematopoietic stem and/or progenitor cells include, but are not limited to, about 1 nanomolar to about 10 millimolar; about 1 mM to about 5 mM; about 1 nM to about 500 nM; about 500 nM to about 1,000 nM; about 1 nM to about 1,000 nM; about 1 uM to about 1,000 uM; 1 uM to about 500 uM; about 1 uM to about 100 uM; about 1 uM to about 10 uM. In one embodiment, the range is about 5 uM to about 500 uM.
- HSPCs can be treated for various times. Suitable times can be determined by those of skill in the art. For example, cells can be treated for minutes, e.g. 5 minutes, 10 minutes, 15 minutes, 30 minutes etc, or treated for hours e.g., 1 hour, 2 hours, 3 hours, 4 hours, up to 24 hours or even days. In one embodiment the cells are treated for 2 hours prior to changing to medium without a composition comprising at least one of the iRNAs described herein.
- cells treated as described herein to enhance HSPC populations, and/or untreated cells can be used fresh or frozen and stored as frozen stocks, using, for example, DMEM with 40% FCS and 10% DMSO.
- DMEM with 40% FCS and 10% DMSO.
- Other methods for preparing frozen stocks for cultured cells also are available to those skilled in the art.
- RBCs obtained using the methods and compositions as disclosed herein can be expanded via the methods described herein, and can be subsequently cryopreserved using techniques known in the art for RBC cryopreservation. Accordingly, using cryopreservation, the RBCs can be maintained such that once it is determined that a subject is in need of a blood transfusion, the RBCs can be thawed and transplanted into the subject.
- the inhibition of SH2B3 can result in a decrease in SH2B3 protein level, a decrease in SH2B3 mRNA level, a decrease in SH2B3 protein activity, or combinations thereof.
- the inhibition of SH2B3 can be done using a variety of methods known in the art including, but not limited to, genome editing, gene silencing, disruption of normal SH2B3 protein activity, and combinations thereof.
- SH2B3 can be inhibited in the stem cells and/or progenitor cells before the cells are expanded and/or enriched. In some embodiments, the stem cells and/or progenitor cells are expanded and/or enriched prior to SH2B3 inhibition.
- the inhibition of SH2B3 comprises contacting the population of stem cells and/or progenitor cells with a genome- editing agent for targeted excision of the SH2B3 gene from at least one stem cell.
- a genome-editing agent refers to a compound or a composition that can modify a nucleotide sequence in the genome of an organism.
- the genome- editing agent can excise a specific nucleotide sequence from the target genome.
- the genome-editing agent can disrupt the function of a specific nucleotide sequence, for example, by breaking one or more bonds in the sequence. Genome editing can be achieved through processes such as nuclease- mediated mutagenesis, chemical mutagenesis, radiation mutagenesis, or meganuclease-mediated mutagenesis.
- the genome-editing agent comprises a DNA-binding member and a nuclease, wherein the DNA-binding member localizes the nuclease to a target site which is then cut by the nuclease.
- the genome-editing agent is a CRISPR/Cas system. In some embodiments, the genome-editing agent is a CRISPR/Cas system. In some
- the CRISPR/Cas system is CRISPR Cas9, which is disclosed in US Patent 8,697,359 and US Application 2015/0291966, which is corporated herein in its entirety by reference.
- the CRISPR Cas system is CRISPR Cpfl, as disclosed in Zetsche et al., 2015; Cell 163(3); 759-777 "Cpfl Is a Single RNA-Guided Endonuclease of a Class 2 CRISPR-Cas System", which is incorporated herein in its entirety by reference.
- the CRISPR Cas is an engineered nuclease system based on a bacterial system that can be used for genome engineering.
- CRISPR RNAs CRISPR RNAs
- This crRNA associates, through a region of partial complementarity, with another type of RNA called tracrRNA to guide the Cas9 or Cpfl nuclease to a region homologous to the crRNA in the target DNA called a "protospacer".
- Cas9 cleaves the DNA to generate blunt ends at the double-strand break (DSB) at sites specified by a 20- nucleotide guide sequence contained within the crRNA transcript.
- Cas9 requires both the crRNA and the tracrRNA for site specific DNA recognition and cleavage.
- This system has now been engineered such that the crRNA and tracrRNA can be combined into one molecule (the "single guide RNA"), and the crRNA equivalent portion of the single guide RNA can be engineered to guide the Cas9 nuclease to target any desired sequence (see Jinek et al (2012) Science 337, p. 816-821, Jinek et al, (2013), eLife 2:e00471, and David Segal, (2013) eLife 2:e00563).
- the CRISPR/Cpfl system is used, where Cpfl requires only one RNA template in the gene-editing complex and cleaves the DNA resulting in a 5nt staggered cut distal to the 5' T-rich PAM, resulting in sticky ends (rather than blunt ends as when Cas9 is used).
- a replacement gene can be used in the place of a SH2B3 gene, e.g., a marker gene or in some embodiments, an cell death gene which is operatively linked to an inducible promoter, thereby allowing specific inducable cell death of the modified (i.e., SH2B3 gene deleted) cells with a drug to turn on expression from the inducible promoter, should it be necessary to eliminate such modified cells after they are transplanted into a subject.
- the CRISPR/Cas (cas9 or cpfl) system can be engineered to create a double strand break (i.e., blunt ends (i.e., using cas9)) or sticky ends (i.e., using cpfl)) at a desired target in a genome, and repair of the double strand break can be influenced by the use of repair inhibitors to cause an increase in error prone repair.
- a double strand break i.e., blunt ends (i.e., using cas9)
- sticky ends i.e., using cpfl
- Types I and III both have Cas endonucleases that process the pre-crRNAs, that, when fully processed into crRNAs, assemble a multi-Cas protein complex that is capable of cleaving nucleic acids that are complementary to the crRNA.
- Type II CRISPR (exemplified by Cas9) is one of the most well characterized systems.
- the Cas9 protein has at least two nuclease domains: one nuclease domain is similar to a HNH endonuclease, while the other resembles a Ruv endonuclease domain.
- the HNH-type domain appears to be responsible for cleaving the DNA strand that is complementary to the crRNA while the Ruv domain cleaves the non-complementary strand.
- Cas protein can be a "functional derivative” of a naturally occurring Cas protein.
- a “functional derivative” of a native sequence polypeptide is a compound having a qualitative biological property in common with a native sequence polypeptide.
- “Functional derivatives” include, but are not limited to, fragments of a native sequence and derivatives of a native sequence polypeptide and its fragments, provided that they have a biological activity in common with a corresponding native sequence polypeptide.
- a biological activity contemplated herein is the ability of the functional derivative to hydrolyze a DNA substrate into fragments.
- the term “derivative” encompasses both amino acid sequence variants of polypeptide, covalent modifications, and fusions thereof.
- Cas polypeptide encompasses a full-length Cas polypeptide, an enzymatically active fragment of a Cas polypeptide, and enzymatically active derivatives of a Cas polypeptide or fragment thereof.
- Suitable derivatives of a Cas polypeptide or a fragment thereof include, but are not limited to, mutants, fusions, covalent modifications of Cas protein or a fragment thereof
- Cas proteins and Cas polypeptides can be obtained from a cell or synthesized chemically or by a combination of these two procedures.
- the cell can be a cell that naturally produces Cas protein, or a cell that naturally produces Cas protein and is genetically engineered to produce the endogenous Cas protein at a higher expression level or to produce a Cas protein from an exogenously introduced nucleic acid, which encodes a Cas that is same or different from the endogenous Cas.
- the cell can be a cell that does not naturally produce Cas protein and is genetically engineered to produce a Cas protein.
- the CRISPR/Cas system can also be used to inhibit gene expression. Lei et al.
- CRISPR interference CRISPR interference
- Cas proteins have been developed which comprise mutations in their cleavage domains to render them incapable of inducing a DSB, and instead introduce a nick into the target DNA.
- the Cas nuclease comprises two nuclease domains, the HNH and RuvC-like, for cleaving the sense and the antisense strands of the target DNA, respectively.
- the Cas nuclease can thus be engineered such that only one of the nuclease domains is functional, thus creating a Cas nickase.
- the Cas9 related CRISPR/Cas system comprises two RNA non-coding components: tracrRNA and a pre-crRNA array containing nuclease guide sequences (spacers) interspaced by identical direct repeats (DRs).
- tracrRNA and pre-crRNA array containing nuclease guide sequences (spacers) interspaced by identical direct repeats (DRs).
- DRs direct repeats
- both functions of these RNAs must be present (see Cong et al, (2013) Sciencexpress 1/10.1 126/science 1231 143).
- the tracrRNA and pre-crRNAs are supplied via separate expression constructs or as separate RNAs.
- a chimeric RNA is constructed where an engineered mature crRNA (conferring target specificity) is fused to a tracrRNA (supplying interaction with the Cas9) to create a chimeric cr-RNA- tracrRNA hybrid (also termed a single guide RNA).
- the Cpfl system is related to the CRISPR/Cas9 system, although the Cpfl protein is very different from Cas9, but is present in some bacteria with CRISPR.
- Cpfl and Cas9 work differently, in that Cas9 requires two RNA molecules to cut DNA; Cpfl needs only one. The proteins also cut DNA at different places, offering researchers more options when selecting a site to edit. Cpfl also cuts DNA in a different way. Cas9 cuts both strands in a DNA molecule at the same position, leaving behind 'blunt' ends.
- Cpfl leaves one strand longer than the other, creating a 'sticky' end, reducing chances of abnormal/random DNA being inserted at the cleavage site, and also allowing better control of DNA to be inserted at the Cpfl cleavage site. Cuts left by Cas9 tend to be repaired by sticking the two ends back together, that can leave errors. In contrast, Cpfl sticky end cleavage allows more accurate and frequent insertions.
- the genome-editing agent is a ZFN.
- a ZFN generally comprises a zinc finger DNA binding protein and a DNA-cleavage domain.
- a "zinc finger DNA binding protein” or “zinc finger DNA binding domain” is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion.
- the term zinc finger DNA binding protein is often abbreviated as zinc finger protein (ZFP).
- Zinc finger binding domains can be "engineered” to bind to a predetermined nucleotide sequence.
- Non-limiting examples of methods for engineering zinc finger proteins are design and selection.
- a designed zinc finger protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP designs and binding data.
- the genome-editing agent is a TALEN.
- the term TALEN As used herein, the term
- transcription activator-like effector nuclease or “TAL effector nuclease” or “TALEN” refers to a class of artificial restriction endonucleases that are generated by fusing a TAL effector DNA binding domain to a DNA cleavage domain.
- the TALEN is a monomeric TALEN that can cleave double stranded DNA without assistance from another TALEN.
- the term "TALEN” is also used to refer to one or both members of a pair of TALENs that are engineered to work together to cleave DNA at the same site. TALENs that work together can be referred to as a left-TALEN and a right-TALEN, which references the handedness of DNA.
- a combination of genome- editing agents can be used.
- a CRISPR/Cas, TALEN, or ZFN molecule e.g. a peptide and/or peptide/nucleic acid complex
- a cell e.g. a cultured stem cell or progenitor cell, such that the presence of the CRISPR/Cas, TALEN, or ZFN molecule is transient and will not be detectable in the progeny that cell.
- a nucleic acid encoding a CRISPR/Cas, TALEN, or ZFN molecule e.g.
- a peptide and/or multiple nucleic acids encoding the parts of a peptide/nucleic acid complex can be introduced into a cell, e.g. a cultured stem cell or progenitor cell, such that the nucleic acid is present in the cell transiently and the nucleic acid encoding the CRISPR/Cas, TALEN, or ZFN molecule as well as the CRISPR/Cas, TALEN, or ZFN molecule itself will not be detectable in the progeny of that cell.
- a nucleic acid encoding a CRISPR/Cas, TALEN, or ZFN molecule e.g.
- a peptide and/or multiple nucleic acids encoding the parts of a peptide/nucleic acid complex can be introduced into a cell, e.g. a cultured stem cell or progenitor cell, such that the nucleic acid is maintained in the cell (e.g.
- the nucleic acid encoding the CRISPR/Cas, TALEN, or ZFN molecule and/or the CRISPR/Cas, TALEN, or ZFN molecule will be detectable in the progeny of that cell.
- the genome- editing agents can be delivered to a target cell by any suitable means.
- the genome-editing agent e.g., CRISPR/Cas, TALEN, or ZFN
- the genome-editing agent is a protein and can be delivered by any suitable means for delivering a protein into a cell such as electroporation, sonoporation, microinjection, liposomal delivery, and nanomaterial-based delivery.
- the genome-editing agent can also be encoded by a nucleotide sequence.
- the genome- editing agent can be delivered using a vector known to those of ordinary skill in the art.
- Viral vector systems which can be utilized in the present invention include, but are not limited to, (a) adenovirus vectors; (b) retrovirus vectors; (c) adeno- associated virus vectors; (d) herpes simplex virus vectors; (e) SV 40 vectors; (f) polyoma virus vectors; (g) papilloma virus vectors; (h) picornavirus vectors; (i) pox virus vectors such as an orthopox, e.g., vaccinia virus vectors or avipox, e.g.
- a helper- dependent or gutless adenovirus a helper- dependent or gutless adenovirus
- k a lentiviral vector
- l adenovirus vectors
- herpesvirus vectors See, also, U.S. Pat. Nos. 6,534,261; 6,607,882; 6,824,978; 6,933, 1 13; 6,979,539; 7,013,219; and 7,163,824, each of which are incorporated by reference herein in their entireties. Replication-defective viruses can also be advantageous.
- Plasmid expression vectors include, but are not limited to, pcDNA3.1, pET vectors (Novagen ®), pGEX vectors (GE Life Sciences), and pMAL vectors (New England labs. Inc.) for protein expression in E.
- coli host cell such as BL21, BL21(DE3) and AD494(DE3)pLysS, Rosetta (DE3), and Origami(DE3) (( Novagen ®); the strong CMV promoter-based pcDNA3.1 ( InvitrogenTM Inc.) and pCIneo vectors (Promega) for expression in mammalian cell lines such as CHO, COS, HEK-293, Jurkat, and MCF-7; replication incompetent adenoviral vector vectors pAdeno X, pAd5F35, pLP-Adeno-X-CMV ( Clontech ®), pAd/CMV/V5-DEST, pAd-DEST vector ( InvitrogenTM Inc.) for adenovirus-mediated gene transfer and expression in mammalian cells; pLNCX2, pLXSN, and pLAPSN retrovirus vectors for use with the Retro-XTM system from Clontech for retroviral-
- adenovirus-associated virus expression vectors such as pAAV-MCS and pAAV-IRES-hrGFP for adeno- associated virus-mediated gene transfer and expression in mammalian cells.
- the vector may or may not be incorporated into the cell genome.
- the constructs may include viral sequences for transfection, if desired.
- the construct may be incorporated into vectors capable of episomal replication, e.g., EPV and EBV vectors.
- each vector can comprise a sequence encoding one or multiple ZFPs,
- Non- viral based delivery methods can also be used to introduce nucleic acids encoding engineered ZFPs, CRISPR/Cas molecules, and/or TALENs into cells (e.g., stem cells and/or progenitor cells).
- Methods of non- viral delivery of nucleic acids include electroporation, sonoporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid-nucleic acid conjugates, naked DNA, mRNA, artificial virions, and agent-enhanced uptake of DNA.
- Additional exemplary nucleic acid delivery systems include those provided by Amaxa® Biosystems (Cologne, Germany), Maxcyte, Inc. (Rockville, Md.), BTX Molecular Delivery Systems (Holliston, Mass.) and Copernicus Therapeutics Inc, (see for example U.S. Pat. No. 6,008,336).
- Lipofection is described in e.g., U.S. Pat. No. 5,049,386, U.S. Pat. No. 4,946,787; and U.S. Pat. No. 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectinTM).
- Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424, WO 91/16024.
- the inhibition of SH2B3 comprises contacting the population of stem cells and/or progenitor cells with an antagonist of SH2B3.
- the term "antagonist of SH2B3” refers to any agent that decreases the level and/or activity of SH2B3.
- the term "antagonist of SH2B3” refers to an agent which decreases the expression and/or activity SH2B3 by at least 10%, e.g. by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
- antagonists of SH2B3 include, but are not limited to, an inorganic molecule, an organic molecule, a nucleic acid, a nucleic acid analog or derivative, a peptide, a peptidomimetic, a protein, an antibody or an antigen-binding fragment thereof, and combinations thereof.
- the antagonist of SH2B3 is a nucleic acid or a nucleic acid analog or derivative thereof, also referred to as a nucleic acid agent herein.
- a nucleic acid agent also referred to as a nucleic acid agent herein.
- the nucleic acid agent can be single-stranded or double-stranded.
- a single- stranded nucleic acid agent can have double-stranded regions, e.g., where there is internal self- complementarity, and a double-stranded nucleic acid agent can have single-stranded regions.
- the nucleic acid can be of any desired length. In particular embodiments, nucleic acid can range from about 10 to 100 nucleotides in length.
- nucleic acid agents single- stranded, double-stranded, and triple-stranded, can range in length from about 10 to about 50 nucleotides, from about 20 to about 50 nucleotides, from about 15 to about 30 nucleotides, from about 20 to about 30 nucleotides in length. In some embodiments, a nucleic acid agent is from about 9 to about 39 nucleotides in length. In some other embodiments, a nucleic acid agent is at least 30 nucleotides in length.
- the nucleic acid agent can comprise modified nucleosides as known in the art. Modifications can alter, for example, the stability, solubility, or interaction of the nucleic acid agent with cellular or extracellular components that modify activity. In certain instances, it can be desirable to modify one or both strands of a double-stranded nucleic acid agent. In some cases, the two strands will include different modifications. In other instances, multiple different modifications can be included on each of the strands. The various modifications on a given strand can differ from each other, and can also differ from the various modifications on other strands. For example, one strand can have a modification, and a different strand can have a different modification. In other cases, one strand can have two or more different modifications, and the another strand can include a modification that differs from the at least two modifications on the first strand.
- the antagonist of SH2B3 is a single-stranded and double-stranded nucleic acid agent that is effective in inducing RNA interference, referred to as siRNA, RNAi agent, or iRNA agent herein.
- siRNA siRNA
- RNAi agent RNAi agent
- iRNA agent iRNA agents suitable for inducing RNA interference in SH2B3 are disclosed, for example, in WO2013/019857, the contents of which are incorporated herein by reference in their entirety.
- the iRNA agent includes double-stranded ribonucleic acid (dsRNA) molecules for inhibiting the expression of a gene encoding SH2B3 in a cell, e.g., a cell in a population of human stem cells and/or progenitor cells, where the dsRNA includes an antisense strand having a region of complementarity which is complementary to at least a part of an mRNA formed in the expression of a gene encoding SH2B3, and where the region of complementarity is 30 nucleotides or less in length, generally 19- 24 nucleotides in length, and where the dsRNA, upon contact with or introduction to a cell expressing the gene SH2B3, inhibits the expression of the gene by at least 10% as assayed by, for example, a PCR or branched DNA (bDNA)-based method, or by a protein-based method, such as by immunoassay or Western blot.
- dsRNA double-stranded ribonucle
- SH2B3 in cell culture can be assayed by measuring SH2B3 mRNA levels, such as by bDNA or TaqMan assay, or by measuring protein levels, such as by immunofluorescence analysis, using, for example, Western Blotting or flow cytometric techniques.
- the iRNA agent is an antisense oligonucleotide.
- an antisense oligonucleotide One of skill in the art is well aware that single-stranded oligonucleotides can hybridize to a complementary target sequence and prevent access of the translation machinery to the target RNA transcript, thereby preventing protein synthesis.
- the single-stranded oligonucleotide can also hybridize to a complementary RNA and the RNA target can be subsequently cleaved by an enzyme such as RNase H and thus preventing translation of target RNA.
- the single-stranded oligonucleotide can modulate the expression of a target sequence via RISC mediated cleavage of the target sequence, i.e., the single-stranded oligonucleotide acts as a single-stranded RNAi agent.
- a "single-stranded RNAi agent" as used herein, is an RNAi agent which is made up of a single molecule.
- a single- stranded RNAi agent can include a duplexed region, formed by intra-strand pairing, e.g., it can be, or include, a hairpin or pan-handle structure.
- the iRNA agent is a small hairpin RNA or short hairpin RNA (shRNA), a sequence of RNA that makes a tight hairpin turn that can be used to silence target gene expression via RNA interference (RNAi).
- RNAi RNA interference
- SH2B3 is also known by aliases SH2B adaptor protein 3 or Lnk; NCBI Gene ID: 10019) is a member of intracellular adaptor protein family.
- the mRNA of SH2B3 for homo sapiens is known to have at least two isoforms (NCBI Accession No: NM 005475.5 (transcript variant 1) and NM 001291424 (transcript variant 2).
- SH2B3 encoded by transcript variant 1 has an amino acid sequence of NP 005466.1 (SEQ ID NO: 51) which is as follows:
- Inhibition of the SH2B3 gene can be by gene silencing RNAi molecules according to methods commonly known by a skilled artisan.
- a gene silencing siRNA oligonucleotide duplexes targeted specifically to human SH2B3 (GenBank No: NM 005475.5 or NM 001291424) can readily be used to knockdown SH2B3 expression.
- SH2B3 mRNA can be successfully targeted using siRNAs; and other siRNA molecules may be readily prepared by those of skill in the art based on the known sequence of the target mRNA.
- the sequence of a human SH2B3 is provided at, for example, GenBank Accession Nos. NM 005475.5 (SEQ ID NO: 52).
- nucleic acid inhibitors such as RNAi (RNA silencing) agents to the nucleic acid sequence of NM 001005735.1 (SEQ ID NO: 52) which is as follows:
- the shRNA for targeting SH2B3 has a nucleotide sequence of
- the shRNA for targeting SH2B3 has a nucleotide sequence of
- polynucleotides of SEQ ID NO: 1 and SEQ ID NO: 2 or a fragment of at least 10, at least 15, at least 20, or at least 25 contiguous nucleotides thereof can be used in combination for targeting SH2B3.
- an antagonist of SH2B3 is a miRNA (also referred to as "miR").
- miRs that have been shown to target SH2B3 include, but are not limited to; miR- 153, miR-9, miR- 181, miR-101, miR-384/384-3p, miR- 124/506, miR-320/320abcd, miR-138, miR-421, miR-320/320abcd, miR-30a/30a- 5p/30b/30b-5p/30cde/384-5p, miR-134, miR-488, miR-300, miR-148/152, miR-202/202-3p, miR-30a/30a- 5p/30b/30b-5p/30cde/384-5p, miR-384/384-3p, miR-138, miR-33/33ab, miR-125/351, miR-326/330/330-5p, miR-326/330/330-5p, miR-326
- RNA interference agents e.g., an siR A, or vectors containing an R A interference agent
- target cells e.g., stem cells and/or progenitor cells
- RNA interference agent e.g., an siRNA
- RNA interference agent e.g., an siRNA
- RNA interference agent e.g., an siRNA may be injected directly into any blood vessel, such as vein, artery, venule or arteriole, via, e.g., hydrodynamic injection or catheterization.
- Administration may be by a single injection or by two or more injections.
- the RNA interference agent is delivered in a pharmaceutically acceptable carrier.
- One or more RNA interference agents may be used simultaneously.
- specific cells are targeted with RNA interference, limiting potential side effects.
- the method can use, for example, a complex or a fusion molecule comprising a cell targeting moiety and an RNA interference binding moiety that is used to deliver RNA interference effectively into cells.
- an antibody-protamine fusion protein when mixed with siRNA, binds siRNA and selectively delivers the siRNA into cells expressing an antigen recognized by the antibody, resulting in silencing of gene expression only in those cells that express the antigen.
- the siRNA or RNA interference-inducing molecule binding moiety is a protein or a nucleic acid binding domain or fragment of a protein, and the binding moiety is fused to a portion of the targeting moiety.
- the location of the targeting moiety can be either in the carboxyl-terminal or amino-terminal end of the construct or in the middle of the fusion protein.
- a viral-mediated delivery mechanism can also be employed to deliver siRNAs to cells in vitro and in vivo as described in Xia, H. et al. (2002) Nat Biotechnol
- Plasmid- or viral-mediated delivery mechanisms of shRNA may also be employed to deliver shRNAs to cells in vitro and in vivo as described in Rubinson, D.A., et al. ((2003) Nat. Genet. 33:401-406) and Stewart, S.A., et al. ((2003) RNA 9:493-501).
- RNA interference agents e.g., the siRNAs or shRNAs
- the RNA interference agents can be introduced along with components that perform one or more of the following activities: enhance uptake of the RNA interfering agents, e.g., siRNA, by the cell, inhibit annealing of single strands, stabilize single strands, or otherwise facilitate delivery to the target cell and increase inhibition of the target gene, e.g., SH2B3.
- the dose of the particular RNA interfering agent will be in an amount necessary to effect RNA interference, e.g., post translational gene silencing (PTGS), of the particular target gene, thereby leading to inhibition of target gene expression or inhibition of activity or level of the protein encoded by the target gene.
- PTGS post translational gene silencing
- RNAi agents that inhibit SH2B3 for use in the aspects of the invention as disclosed herein can include oligonucleotide modifications.
- Unmodified oligonucleotides can be less than optimal in some applications, e.g., unmodified oligonucleotides can be prone to degradation by e.g., cellular nucleases.
- chemical modifications to one or more of the subunits of oligonucleotide can confer improved properties, e.g., can render oligonucleotides more stable to nucleases.
- Typical oligonucleotide modifications can include one or more of: (i) alteration, e.g., replacement, of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens in the phosphodiester intersugar linkage; (ii) alteration, e.g., replacement, of a constituent of the ribose sugar, e.g., of the 2' hydroxyl on the ribose sugar; (iii) wholesale replacement of the phosphate moiety with "dephospho" linkers; (iv) modification or replacement of a naturally occurring base with a non-natural base; (v) replacement or modification of the ribose-phosphate backbone, e.g.
- PNA peptide nucleic acid
- modification of the 3' end or 5' end of the oligonucleotide e.g., removal, modification or replacement of a terminal phosphate group or conjugation of a moiety, e.g., conjugation of a ligand, to either the 3' or 5' end of oligonucleotide
- modification of the sugar e.g., six membered rings.
- a modification described herein can be the sole modification, or the sole type of modification included on multiple nucleotides, or a modification can be combined with one or more other modifications described herein.
- the modifications described herein can also be combined onto an oligonucleotide, e.g. different nucleotides of an oligonucleotide have different modifications described herein.
- the iRNA agent includes double-stranded ribonucleic acid (dsRNA) molecules for inhibiting the expression of SH2B3 in a cell ex vivo, e.g., in HSPCs ex vivo obtained from blood or UCB, where the dsRNA includes an antisense strand having a region of complementarity which is complementary to at least a part of an mRNA formed in the expression of SH2B3, and where the region of complementarity is 30 nucleotides or less in length, generally 19-24 nucleotides in length, and where the dsRNA, upon contact with or introduction to a cell expressing the gene encoding SH2B3, inhibits the expression of the gene by at least 10% as assayed by, for example, a PCR or branched DNA (bDNA)-based method, or by a protein-based method, such as by immunoassay or Western blot
- dsRNA double-stranded ribonucleic acid
- SH2B3 in cell culture can be assayed by measuring mRNA levels of SH2B3, such as by bDNA or TaqMan assay, or by measuring protein levels, such as by immunofluorescence analysis, using, for example, Western Blotting or flowcytometric techniques.
- a dsRNA includes two RNA strands that are complementary to hybridize to form a duplex structure under conditions in which the dsRNA will be used.
- One strand of a dsRNA (the antisense strand) includes a region of complementarity that is substantially complementary, and generally fully
- the target sequence can be derived from the sequence of SH2B3 mRNA, e.g, SEQ ID NO: 52 as disclosed herein.
- the other strand includes a region that is complementary to the antisense strand, such that the two strands hybridize and form a duplex structure when combined under suitable conditions.
- the duplex structure is between 15 and 30 inclusive, more generally between 18 and 25 inclusive, yet more generally between 19 and 24 inclusive, and most generally between 19 and 21 base pairs in length, inclusive.
- the region of complementarity to the target sequence is between 15 and 30 inclusive, more generally between 18 and 25 inclusive, yet more generally between 19 and 24 inclusive, and most generally between 19 and 21 nucleotides in length, inclusive.
- the dsRNA is between 15 and 20 nucleotides in length, inclusive, and in other embodiments, the dsRNA is between 25 and 30 nucleotides in length, inclusive.
- the targeted region of an RNA targeted for cleavage will most often be part of a larger RNA molecule, often an mRNA molecule.
- a "part" of an mRNA target is a contiguous sequence of an mRNA target of sufficient length to be a substrate for RNAi-directed cleavage (i.e., cleavage through a RISC pathway).
- dsRNAs having duplexes as short as 9 base pairs can, under some circumstances, mediate RNAi-directed RNA cleavage. Most often a target will be at least 15 nucleotides in length, preferably 15-30 nucleotides in length.
- the duplex region is a primary functional portion of a dsRNA, e.g., a duplex region of 9 to 36, e.g., 15-30 base pairs.
- a dsRNA RNA molecule or complex of RNA molecules having a duplex region greater than 30 base pairs.
- an miRNA is a dsRNA.
- a dsRNA is not a naturally occurring miRNA.
- an iRNA agent useful to target expression of SH2B3 is not generated in the target cell by cleavage of a larger dsRNA.
- a dsRNA as described herein can further include one or more single-stranded nucleotide overhangs.
- the dsRNA can be synthesized by standard methods known in the art as further discussed below, e.g., by use of an automated DNA synthesizer, such as are commercially available from, for example, Biosearch, Applied Biosystems, Inc.
- a gene encoding SH2B3 is a human gene.
- the gene encoding SH2B3 is a mouse or rat gene.
- a dsR A will include at least two nucleotide sequences, a sense and an anti-sense sequence, wherein the sense strand is SEQ ID NO: 52.
- one of the two sequences is complementary to the other of the two sequences, with one of the sequences being substantially
- complementary to a sequence of the SH2B3 mRNA can also be contained as self-complementary regions of a single nucleic acid molecule, as opposed to being on separate oligonucleotides.
- dsRNAs having a duplex structure of between 20 and 23, but specifically 21 , base pairs have been hailed as particularly effective in inducing RNA interference (Elbashir et al., EMBO 2001, 20:6877-6888). However, others have found that shorter or longer RNA duplex structures can be effective as well.
- dsRNAs described herein can include at least one strand of a length of minimally 21 nt.
- dsRNAs having a partial sequence of at least 15, 16, 17, 18, 19, 20, or more contiguous nucleotides from one of the sequences of SEQ ID NO: 1 or 2, and differing in their ability to inhibit the expression of a gene encoding SH2B3 by not more than 5, 10, 15, 20, 25, or 30% inhibition from a dsRNA comprising the full sequence are contemplated according to the technology described herein.
- a target sequence is generally 15-30 nucleotides in length, there is wide variation in the suitability of particular sequences in this range for directing cleavage of any given target RNA.
- Various software packages and the guidelines set out herein provide guidance for the identification of optimal target sequences for any given gene target, but an empirical approach can also be taken in which a "window” or “mask” of a given size (as a non- limiting example, 21 nucleotides) is literally or figuratively (including, e.g., in silico) placed on the target RNA sequence to identify sequences in the size range that can serve as target sequences.
- the next potential target sequence can be identified, until the complete set of possible sequences is identified for any given target size selected.
- This process coupled with systematic synthesis and testing of the identified sequences (using assays as described herein or as known in the art) to identify those sequences that perform optimally can identify those RNA sequences that, when targeted with an iRNA agent, mediate the best inhibition of target gene expression.
- sequences identified for example, by sequence identifiers in Tables 2-7 represent effective target sequences
- further optimization of inhibition efficiency can be achieved by progressively "walking the window" one nucleotide upstream or downstream of the given sequences to identify sequences with equal or better inhibition characteristics.
- sequences identified by a sequence identifier NO: 1 or 2 can be further optimization could be achieved by systematically either adding or removing nucleotides to generate longer or shorter sequences and testing those and sequences generated by walking a window of the longer or shorter size up or down the target RNA from that point.
- An iRNA as described herein can contain one or more mismatches to the target sequence. In one embodiment, an iRNA as described herein contains no more than 3 mismatches. If the antisense strand of the iRNA contains mismatches to a target sequence, it is preferable that the area of mismatch not be located in the center of the region of complementarity. If the antisense strand of the iRNA contains mismatches to the target sequence, it is preferable that the mismatch be restricted to be within the last 5 nucleotides from either the 5' or 3' end of the region of complementarity.
- RNA strand which is complementary to a region of a gene encoding SH2B3
- the RNA strand generally does not contain any mismatch within the central 13 nucleotides.
- the methods described herein or methods known in the art can be used to determine whether an iRNA containing a mismatch to a target sequence is effective in inhibiting the expression of SH2B3. Consideration of the efficacy of iRNAs with mismatches in inhibiting expression of SH2B3 is important, especially if the particular region of complementarity to the SH2B3 gene is known to have polymorphic sequence variation within the population.
- a dsRNA has a single-stranded nucleotide overhang of 1 to 4, generally 1 or 2 nucleotides. dsRNAs having at least one nucleotide overhang have unexpectedly superior inhibitory properties relative to their blunt-ended counterparts.
- the RNA of an iRNA e.g., a dsRNA
- the nucleic acids featured in the technology described herein can be synthesized and/or modified by methods well established in the art, such as those described in "Current protocols in nucleic acid chemistry," Beaucage, S. L. et al.
- Modifications include, for example, (a) end modifications, e.g., 5' end modifications (phosphorylation, conjugation, inverted linkages, etc.) 3' end modifications (conjugation, DNA nucleotides, inverted linkages, etc.), (b) base modifications, e.g., replacement with stabilizing bases, destabilizing bases, or bases that base pair with an expanded repertoire of partners, removal of bases (abasic nucleotides), or conjugated bases, (c) sugar modifications (e.g., at the 2' position or 4' position) or replacement of the sugar, as well as (d) backbone modifications, including modification or replacement of the phosphodiester linkages.
- end modifications e.g., 5' end modifications (phosphorylation, conjugation, inverted linkages, etc.) 3' end modifications (conjugation, DNA nucleotides, inverted linkages, etc.
- base modifications e.g., replacement with stabilizing bases, destabilizing bases, or bases that base pair with an expanded repertoire of partners
- RNA compounds useful in the embodiments described herein include, but are not limited to RNAs containing modified backbones or no natural internucleoside linkages.
- RNAs having modified backbones include, among others, those that do not have a phosphorus atom in the backbone.
- modified RNAs that do not have a phosphorus atom in their internucleoside backbone can also be considered to be oligonucleosides.
- the modified RNA will have a phosphorus atom in its internucleoside backbone.
- Modified RNA backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'- amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates,
- thionoalkylphosphonates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those) having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'.
- Various salts, mixed salts and free acid forms are also included.
- Modified RNA backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatoms and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages.
- morpholino linkages formed in part from the sugar portion of a nucleoside
- siloxane backbones sulfide, sulfoxide and sulfone backbones
- formacetyl and thioformacetyl backbones methylene formacetyl and thioformacetyl backbones
- alkene containing backbones sulfamate backbones
- sulfonate and sulfonamide backbones amide backbones; and others having mixed N, O, S and CH.sub.2 component parts.
- Representative U.S. patents that teach the preparation of the above oligonucleosides include, but are not limited to, U.S. Pat. Nos. 5,034,506; 5, 166,315; 5,185,444; 5,214,134; 5,216,141 ; 5,235,033; 5,64,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541,307; 5,561,225; 5,596,086;
- RNA mimetics suitable are contemplated for use in iRNAs, in which both the sugar and the internucleoside linkage, i.e., the backbone, of the nucleotide units are replaced with novel groups.
- the base units are maintained for hybridization with an appropriate nucleic acid target compound.
- a peptide nucleic acid PNA
- PNA compounds the sugar backbone of an RNA is replaced with an amide containing backbone, in particular an aminoethylglycine backbone.
- nucleobases are retained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone.
- Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331 ; and 5,719,262, each of which is herein incorporated by reference. Further teaching of PNA compounds can be found, for example, in Nielsen et al., Science, 1991, 254, 1497-1500.
- Modifications of phosphate group The phosphate group in the intersugar linkage can be modified by replacing one of the oxygens with a different substituent.
- One result of this modification to RNA phosphate intersugar linkages can be increased resistance of the oligonucleotide to nucleolytic breakdown.
- modified phosphate groups include phosphorothioate, phosphoroselenates, borano phosphates, borano phosphate esters, hydrogen phosphonates, phosphoroamidates, alkyl or aryl phosphonates and phosphotriesters.
- one of the non-bridging phosphate oxygen atoms in the intersugar linkage can be replaced by any of the following: S, Se, BR 3 (R is hydrogen, alkyl, aryl), C (i.e. an alkyl group, an aryl group, etc...), H, NR 2 (R is hydrogen, optionally substituted alkyl, aryl), or OR (R is optionally substituted alkyl or aryl).
- the phosphorous atom in an unmodified phosphate group is achiral.
- the stereogenic phosphorous atom can possess either the "R" configuration (herein Rp) or the "S” configuration (herein Sp).
- Phosphorodithioates have both non-bridging oxygens replaced by sulfur.
- the phosphorus center in the phosphorodithioates is achiral which precludes the formation of oligonucleotides diastereomers.
- modifications to both non-bridging oxygens, which eliminate the chiral center, e.g. phosphorodithioate formation can be desirable in that they cannot produce diastereomer mixtures.
- the non-bridging oxygens can be independently any one of O, S, Se, B, C, H, N, or OR (R is alkyl or aryl).
- the phosphate linker can also be modified by replacement of bridging oxygen, (i.e. oxygen that links the phosphate to the nucleoside), with nitrogen (bridged phosphoroamidates), sulfur (bridged phosphorothioates) and carbon (bridged methylenephosphonates).
- bridging oxygen i.e. oxygen that links the phosphate to the nucleoside
- nitrogen bridged phosphoroamidates
- sulfur bridged phosphorothioates
- carbon bridged methylenephosphonates
- Modified phosphate linkages where at least one of the oxygen linked to the phosphate has been replaced or the phosphate group has been replaced by a non-phosphorous group are also referred to as "non- phosphodiester intersugar linkage" or “non-phosphodiester linker.”
- the phosphate group can be replaced by non-phosphorus containing connectors, e.g. dephospho linkers.
- Dephospho linkers are also referred to as non-phosphodiester linkers herein. While not wishing to be bound by theory, it is believed that since the charged phosphodiester group is the reaction center in nucleolytic degradation, its replacement with neutral structural mimics should impart enhanced nuclease stability. Again, while not wishing to be bound by theory, it can be desirable, in some embodiment, to introduce alterations in which the charged phosphate group is replaced by a neutral moiety.
- Preferred embodiments include methylenemethylimino (MMI), methylenecarbonylamino, amides,carbamate and ethylene oxide linker.
- a modification of a non-bridging oxygen can necessitate modification of 2'-OH, e.g., a modification that does not participate in cleavage of the neighboring intersugar linkage, e.g., arabinose sugar, 2'-0-alkyl, 2'-F, LNA and ENA.
- Preferred non-phosphodiester intersugar linkages include phosphorothioates, phosphorothioates with an at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% , 90% 95% or more enantiomeric excess of Sp isomer, phosphorothioates with an at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% , 90% 95% or more enantiomeric excess of Rp isomer, phosphorodithioates, phsophotriesters, aminoalkylphosphotrioesters, alkyl-phosphonaters (e.g., methyl-phosphonate), selenophosphates, phosphoramidates (e.g., N-alkylphosphoramidate), and boranophosphonates.
- phosphorodithioates e.g., methyl-phosphonate
- selenophosphates e.g., N-alkyl
- Oligonucleotide-mimicking scaffolds can also be constructed wherein the phosphate linker and ribose sugar are replaced by nuclease resistant nucleoside or nucleotide surrogates. While not wishing to be bound by theory, it is believed that the absence of a repetitively charged backbone diminishes binding to proteins that recognize polyanions (e.g. nucleases). Again, while not wishing to be bound by theory, it can be desirable in some embodiment, to introduce alterations in which the bases are tethered by a neutral surrogate backbone.
- the oligonucleotide is a peptide nucleic acid, e.g., the ribophosphate backbone of the oligonucleotide is completely replaced by peptide nucleic acid (PNA).
- An oligonucleotide can include modification of all or some of the sugar groups of the nucleic acid.
- the 2' position H, DNA;or OH, RNA
- a number of different "oxy" or "deoxy" substituents While not being bound by theory, enhanced stability is expected since the 2'-hydroxyl can no longer be deprotonated to form a 2'-alkoxide ion.
- the 2'-alkoxide can catalyze degradation by intramolecular nucleophilic attack on the linker phosphorus atom.
- the sugar group can also contain one or more carbons that possess the opposite stereochemical configuration than that of the corresponding carbon in the ribose sugar.
- an oligonucleotide can include nucleotides containing e.g., arabinose, as the sugar.
- a modification at the 2' position can be present in the arabinose configuration
- arabinose configuration refers to the placement of a substituent on the C2' of ribose in the same configuration as the 2'-OH is in the arabinose.
- a nucleotide can have an alpha linkage at the 1 ' position on the sugar, e.g., alpha-nucleosides.
- the monomer can also have the opposite configuration at the 4'-position, e.g., C5' and H4' or substituents replacing them are interchanged with each other. When the C5' and H4' or substituents replacing them are interchanged with each other, the sugar is said to be modified at the 4' position.
- Oligonucleotides can also include abasic sugars, i.e., monomers which lack a nucleobase at C- or has other chemical groups in place of a nucleobase at CI '. See for example U.S. Pat. No. 5,998,203, contents of which are herein incorporated in their entirety. These abasic sugars can also be further containing modifications at one or more of the constituent sugar atoms. Oligonucleotides can also contain one or more sugars that are the L isomer, e.g. L-nucleosides. Modification to the sugar group can also include replacement of the 4'-0 with a sulfur, optionally substituted nitrogen or CH 2 group. In some embodiments, linkage between C 1 ' and nucleobase is in the a configuration.
- Oligonucleotide modifications can also include acyclic nucleotides, wherein a C-C bonds between ribose carbons (e.g., Cl '-C2', C2'-C3', C3'-C4', C4'-04', CI '-04') is absent and/or at least one of ribose carbons or oxygen (e.g., CI ', C2', C3', C4' or 04') are independently or in combination absent from the
- acyclic nucleotide is or
- Ri and R 2 independently are H, halogen, OR 3 , or alkyl; and R 3 is H, alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar).
- Preferred sugar modifications are 2'-0-Me (2'-0-methyl), 2'-0-MOE (2'-0-methoxyethyl), 2'-F, 2'- 0-[2-(methylamino)-2-oxoethyl] (2'- ⁇ 9-NMA), 2'-S-methyl, 2'-0-CH 2 -(4'-C) (LNA), 2'-0-CH 2 CH 2 -(4'-C) (ENA), 2'-0-aminopropyl (2'-0-AP), 2'-0-dimethylaminoethyl (2'-0-DMAOE), 2'-0-dimethylaminopropyl (2'-0-DMAP), and 2'-0-dimethylaminoethyloxyethyl (2'-0-DMAEOE).
- nucleotide when a particular nucleotide is linked through its 2 '-position to the next nucleotide, the sugar modifications described herein can be placed at the 3 '-position of the sugar for that particular nucleotide, e.g., the nucleotide that is linked through its 2' -position.
- a modification at the 3' position can be present in the xylose configuration.
- xylose configuration refers to the placement of a substituent on the C3' of ribose in the same configuration as the 3' -OH is in the xylose sugar.
- the hydrogen attached to C4' and/or CI ' can be replaced by a straight- or branched- optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, wherein backbone of the alkyl, alkenyl and alkynyl can contain one or more of O, S, S(O), S0 2 , N(R'), C(O), N(R')C(0)0,
- the hydrogen attached to the C4' of the 5' terminal nucleotide is replaced.
- C4' and C5' together form an optionally substituted heterocyclic, preferably comprising at least one -PX(Y)-, wherein X is H, OH, OM, SH, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkylthio, optionally substituted alkylamino or optionally substituted dialkylamino, where M is independently for each occurrence an alki metal or transition metal with an overall charge of +1 ; and Y is O, S, or NR', where R' is hydrogen, optionally substituted aliphatic.
- this modification is at the 5 terminal of the oligonucleotide.
- Nucleobase modifications are the most common bases (or nucleobases) found in nucleic acids. These bases can be modified or replaced to provide oligonucleotides having improved properties.
- nuclease resistant oligonucleotides can be prepared with these bases or with synthetic and natural nucleobases (e.g., inosine, xanthine, hypoxanthine, nubularine, isoguanisine, or tubercidine) and any one of the above modifications.
- substituted or modified analogs of any of the above bases and "universal bases" can be employed.
- nucleotide When a natural base is replaced by a non-natural and/or universal base, the nucleotide is said to comprise a modified nucleobase and/or a nucleobase modification herein.
- Modified nucleobase and/or nucleobase modifications also include natural, non-natural and universal bases, which comprise conjugated moieties, e.g. a ligand described herein.
- Preferred conjugate moieties for conjugation with nucleobases include cationic amino groups which can be conjugated to the nucleobase via an appropriate alkyl, alkenyl or a linker with an amide linkage.
- An oligonucleotide can also include nucleobase (often referred to in the art simply as "base”) modifications or substitutions.
- unmodified or “natural” nucleobases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U).
- Modified nucleobases include other synthetic and natural nucleobases such as inosine, xanthine, hypoxanthine, nubularine, isoguanisine, tubercidine, 2-(halo)adenine, 2-(alkyl)adenine, 2-(propyl)adenine, 2-(amino)adenine, 2-(aminoalkyll)adenine, 2-(aminopropyl)adenine,
- 5- (aminoalkyl)uracil 5-(guanidiniumalkyl)uracil, 5-(l,3-diazole-l-alkyl)uracil, 5-(cyanoalkyl)uracil, 5- (dialkylaminoalkyl)uracil, 5-(dimethylaminoalkyl)uracil, 5-(halo)uracil, 5-(methoxy)uracil, uracil- 5-oxyacetic acid, 5-(methoxycarbonylmethyl)-2-(thio)uracil, 5-(methoxycarbonyl-methyl)uracil,
- l-(aminocarbonylethylenyl)-4-(thio)pseudouracil l-(aminocarbonylethylenyl)-2,4-(dithio)pseudouracil, l-(aminoalkylaminocarbonylethylenyl)-pseudouracil, l-(aminoalkylamino-carbonylethylenyl)-2(thio)- pseudouracil, l-(aminoalkylaminocarbonylethylenyl)-4-(thio)pseudouracil,
- a universal nucleobase is any modified or nucleobase that can base pair with all of the four naturally occurring nucleobases without substantially affecting the melting behavior, recognition by intracellular enzymes or activity of the oligonucleotide duplex.
- Some exemplary universal nucleobases include, but are not limited to, 2,4-difluorotoluene, nitropyrrolyl, nitroindolyl, 8-aza-7-deazaadenine, 4- fluoro-6-methylbenzimidazle, 4-methylbenzimidazle, 3-methyl isocarbostyrilyl, 5- methyl isocarbostyrilyl,
- nucleobases include those disclosed in U.S. Pat. No. 3,687,808; those disclosed in
- Terminal modifications In vivo applications of oligonucleotides can be limited due to presence of nucleases in the serum and/or blood. Thus in certain instances it is preferable to modify the 3', 5' or both ends of an oligonucleotide to make the oligonucleotide resistant against exonucleases. In some instances
- the oligonucleotide comprises a cap structure at 3' (3'-cap), 5' (5'-cap) or both ends. In some embodiments, oligonucleotide comprises a 3'-cap. In another embodiment, oligonucleotide comprises a 5'- cap. In yet another embodiment, oligonucleotide comprises both a 3' cap and a 5' cap. It is to be understood that when an oligonucleotide comprises both a 3' cap and a 5' cap, such caps can be same or they can be different.
- cap structure refers to chemical modifications, which have been incorporated at either terminus of oligonucleotide. See for example U.S. Pat. No. 5,998,203 and International Patent Publication WO03/70918, contents of which are herein incorporated in their entireties.
- Exemplary 5 '-caps include, but are not limited to, ligands, 5'-5'-inverted nucleotide, 5'-5'-inverted abasic nucleotide residue, 2'-5' linkage, 5'-amino, 5'-amino-alkyl phosphate, 5'-hexylphosphate, 5'- aminohexyl phosphate, bridging and/or non-bridging 5'-phosphoramidate, bridging and/or non-bridging 5'- phosphorothioate and/or 5'-phosphorodithioate, bridging or non bridging 5'-methylphosphonate, non- phosphodiester intersugar linkage between the end two nucleotides, 4',5'-methylene nucleotide, I-(beta-D- erythrofuranosyl) nucleotide, 4'-thio nucleotide, carbocyclic nucleotide,
- Exemplary 3'-caps include, but are not limited to, ligands, 3 '-3 '-inverted nucleotide, 3 '-3 '-inverted abasic nucleotide residue, 3'-2'-inverted nucleotide moiety, 3'-2'-inverted abasic moiety, 2 '-5 '-linkage, 3'- amino, 3'-amino-alkyl phosphate, 3'-hexylphosphate, 3'-aminohexyl phosphate, bridging and/or non- bridging 3'-phosphoramidate, bridging and/or non-bridging 3'-phosphorothioate and/or 3'- phosphorodithioate, bridging or non bridging 3'-methylphosphonate, non-phosphodiester intersugar linkage between the end two nucleotides, I-(beta-D-erythrofuranosyl) nucleotide, 4
- the 3' and/or 5' ends of an oligonucleotide can also be conjugated to other functional molecular entities such as labeling moieties, e.g., fluorophore (e.g., pyrene, TAMRA, fluorescein, Cy3 or Cy5 dyes) or protecting groups (based e.g., on sulfur, silicon, boron or ester).
- the functional molecular entities can be attached to the sugar through a phosphate group and/or a linker.
- the terminal atom of the linker can connect to or replace the linking atom of the phosphate group or the C-3' or C-5' O, N, S or C group of the sugar.
- the linker can connect to or replace the terminal atom of a nucleotide surrogate (e.g., PNAs).
- Terminal modifications useful for modulating activity include modification of the 5' end with phosphate or phosphate analogs.
- the 5' end of the oligonucleotide can be phosphorylated or includes a phosphoryl analog at the 5' terminus.
- the 5'-phosphate modifications can include those which are compatible with RISC mediated gene silencing. Modifications at the 5 '-terminal end can also be useful in stimulating or inhibiting the immune system of a subject.
- the 5 '-end of the oligonucleotide comprises the modification L J n , wherein W, X and Y are each independently selected from the group consisting of O, OR (R is hydrogen, alkyl, aryl), S, Se, BR 3 (R is hydrogen, alkyl, aryl), BH 3 " , C (i.e.
- a and Z are each independently for each occurrence absent, O, S, CH 2 , NR (R is hydrogen, alkyl, aryl), or optionally substituted alkylene, wherein backbone of the alkylene can comprise one or more of O, S, SS and NR (R is hydrogen, alkyl, aryl) internally and/or at the end; and n is 0-2. In some embodiments n is 1 or 2. It is understood that A is replacing the oxygen linked to 5' carbon of sugar.
- one or both hydrogen on C5' of the 5'- terminal nucleotides can be replaced with a halogen, e.g., F.
- Exemplary 5'-modificaitons include, but are not limited to, 5'-monophosphate ((HO)2(0)P-0-5'); 5'-diphosphate ((HO) 2 (0)P-0-P(HO)(0)-0-5'); 5 '-triphosphate ((HO) 2 (0)P-0-(HO)(0)P-0-P(HO)(0)-0-5'); 5'-monothiophosphate (phosphorothioate; (HO)2(S)P-0-5'); 5'-monodithiophosphate (phosphorodithioate; (HO)(HS)(S)P-0-5'), 5'-phosphorothiolate ((HO)2(0)P-S-5'); 5'-alpha-thiotriphosphate; 5'-beta- thiotriphosphate; 5'-gamma-thiotriphosphate; 5'-phosphoramidates (( ⁇ ) 2 (0) ⁇ - ⁇ -5', (HO)(NH 2
- exemplary 5 '-modifications include where Z is optionally substituted alkyl at least once, e.g., ((HO) 2 (X)P-0[-(CH 2 ) a -0-P(X)(OH)-0] b - 5', ((HO)2(X)P-0[-(CH 2 ) a - P(X)(OH)-0] b - 5', ((HO)2(X)P-[-(CH 2 ) a -0-P(X)(OH)-0] b - 5'; dialkyl terminal phosphates and phosphate mimics: HO[-(CH 2 ) a -0-P(X)(OH)-0] b - 5' , H 2 N[-(CH 2 ) a -0-P(X)(OH)-0] b - 5', H[-(CH 2 ) a -0-P(X)(OH)-0] b -
- Terminal modifications can also be useful for monitoring distribution, and in such cases the preferred groups to be added include fluorophores, e.g., fluorescein or an Alexa dye, e.g., Alexa 488.
- fluorophores e.g., fluorescein
- Alexa dye e.g., Alexa 488.
- Terminal modifications can also be useful for enhancing uptake, useful modifications for this include targeting ligands. Terminal modifications can also be useful for cross-linking an oligonucleotide to another moiety; modifications useful for this include mitomycin C, psoralen, and derivatives thereof.
- Ligands A wide variety of entities, e.g., ligands, can be coupled to the oligonucleotides described herein. Ligands can include naturally occurring molecules, or recombinant or synthetic molecules.
- Exemplary ligands include, but are not limited to, polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid, styrene-maleic acid anhydride copolymer, poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG, e.g., PEG-2K, PEG-5K, PEG- 1 OK, PEG-12K, PEG-15K, PEG-20K, PEG-40K), MPEG, [MPEG] 2 , polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, polyphosphazine, polyethylenimine, cationic groups, spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidom
- psoralen mitomycin C
- porphyrins e.g., TPPC4, texaphyrin, Sapphyrin
- polycyclic aromatic hydrocarbons e.g., phenazine, dihydrophenazine
- artificial endonucleases e.g., EDTA
- lipophilic molecules e.g, steroids, bile acids, cholesterol, cholic acid, adamantane acetic acid, 1-pyrene butyric acid, dihydrotestosterone, 1,3-Bis- 0(hexadecyl)glycerol, geranyloxyhexyl group, hexadecylglycerol, borneol, menthol, 1,3 -propanediol, heptadecyl group, palmitic acid, myristic acid,03-(oleoyl)lithocholic acid, 03-(oleoyl)cholenic acid, dimeth
- transport/absorption facilitators e.g., naproxen, aspirin, vitamin E, folic acid
- synthetic ribonucleases e.g., imidazole, bisimidazole, histamine, imidazole clusters, acridine-imidazole conjugates, Eu3+ complexes of tetraazamacrocycles), dinitrophenyl, HRP, AP, antibodies, hormones and hormone receptors, lectins, carbohydrates, multivalent carbohydrates, vitamins (e.g., vitamin A, vitamin E, vitamin K, vitamin B, e.g., folic acid, B12, riboflavin, biotin and pyridoxal), vitamin cofactors, lipopolysaccharide, an activator of p38 MAP kinase, an activator of NF- ⁇ , tax on, vincristine, vinblastine, cytochalasin, nocodazole, japlakinolide, latrunculin A
- Peptide and peptidomimetic ligands include those having naturally occurring or modified peptides, e.g., D or L peptides; ⁇ , ⁇ , or ⁇ peptides; N-methyl peptides; azapeptides; peptides having one or more amide, i.e., peptide, linkages replaced with one or more urea, thiourea, carbamate, or sulfonyl urea linkages; or cyclic peptides.
- a peptidomimetic also referred to herein as an oligopeptidomimetic is a molecule capable of folding into a defined three-dimensional structure similar to a natural peptide.
- the peptide or peptidomimetic ligand can be about 5-50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
- amphipathic peptides include, but are not limited to, cecropins, lycotoxins, paradaxins, buforin, CPF, bombinin-like peptide (BLP), cathelicidins, ceratotoxins, S. clava peptides, hagfish intestinal antimicrobial peptides (HFIAPs), magainines, brevinins-2, dermaseptins, melittins, pleurocidin, H 2 A peptides, Xenopus peptides, esculentinis- 1 , and caerins.
- endosomolytic ligand refers to molecules having endosomolytic properties. Endosomolytic ligands promote the lysis of and/or transport of the composition of the invention, or its components, from the cellular compartments such as the endosome, lysosome, endoplasmic reticulum (ER), golgi apparatus, microtubule, peroxisome, or other vesicular bodies within the cell, to the cytoplasm of the cell.
- Some exemplary endosomolytic ligands include, but are not limited to, imidazoles, poly or oligoimidazoles, linear or branched polyethyleneimines (PEIs), linear and brached polyamines, e.g.
- spermine cationic linear and branched polyamines, polycarboxylates, polycations, masked oligo or poly cations or anions, acetals, polyacetals, ketals/polyketals, orthoesters, linear or branched polymers with masked or unmasked cationic or anionic charges, dendrimers with masked or unmasked cationic or anionic charges, polyanionic peptides, polyanionic peptidomimetics, pH-sensitive peptides, natural and synthetic fusogenic lipids, natural and synthetic cationic lipids.
- Exemplary endosomolytic/fusogenic peptides include, but are not limited to,
- fusogenic lipids fuse with and consequently destabilize a membrane.
- Fusogenic lipids usually have small head groups and unsaturated acyl chains.
- Exemplary fusogenic lipids include, but are not limited to, l,2-dileoyl-sn-3-phosphoethanolamine (DOPE), phosphatidylethanolamine (POPE), palmitoyloleoylphosphatidylcholine (POPC), (6Z,9Z,28Z,31Z)- heptatriaconta-6,9,28,31 -tetraen- 19-ol (Di-Lin), N-methyl(2,2-di((9Z, 12Z)-octadeca-9, 12-dienyl)- 1 ,3- dioxolan-4-yl)methanamine (DLin-k-DMA) and N-methyl-2-(2,2-di((9Z,12Z)-octadeca-9
- Exemplary cell permeation peptides include, but are not limited to, SEQ ID NO: 34, RQIKIWFQNRRMKWKK (penetratin);
- SEQ ID NO: 36 GALFLGWLGAAGSTMGAWSQPKKKRKV (signal sequence based peptide);
- SEQ ID NO: 37 LLIILRRRIRKQ AHAH SK (PVEC);
- SEQ ID NO: 38 SEQ ID NO: 38, GWTLNSAGYLLKINLKALAALAKKIL (transportan);
- SEQ ID NO: 42 [LL-37, 37 aa] (LL-37);
- SEQ ID NO: 43 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR (cecropin PI);
- SEQ ID NO: 44 ACYCRIPACIAGERRYGTCIYQGRLWAFCC (a-defensin)
- SEQ ID NO: 45 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK ( ⁇ -defensin);
- SEQ ID NO: 46 RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPGKR-NH2 (PR-39);
- SEQ ID NO: 48 AAVALLPAVLLALLAP (RFGF);
- SEQ ID NO: 50 RKCRIVVIRVCR (bactenecin).
- AMINE NH 2 ; alkylamino, dialkylamino, heterocyclyl, arylamino, diaryl amino, heteroaryl amino, or diheteroaryl amino).
- targeting ligand refers to any molecule that provides an enhanced affinity for a selected target, e.g., a cell, cell type, tissue, organ, region of the body, or a compartment, e.g., a cellular, tissue or organ compartment.
- Some exemplary targeting ligands include, but are not limited to, antibodies, antigens, folates, receptor ligands, carbohydrates, aptamers, integrin receptor ligands, chemokine receptor ligands, transferrin, biotin, serotonin receptor ligands, PSMA, endothelin, GCPII, somatostatin, LDL and HDL ligands.
- Carbohydrate based targeting ligands include, but are not limited to, D-galactose, multivalent galactose, N-acetyl-D-galactose (GalNAc), multivalent GalNAc, e.g. GalNAc2 and GalNAc3; D-mannose, multivalent mannose, multivalent lactose, N-acetyl-galactosamine, N-acetyl-gulucosamine, multivalent fucose, glycosylated polyaminoacids and lectins.
- the term multivalent indicates that more than one monosaccharide unit is present. Such monosaccharide subunits can be linked to each other through glycosidic linkages or linked to a scaffold molecule.
- PK modulating ligand and “PK modulator” refers to molecules which can modulate the pharmacokinetics of the oligoncucleotide.
- Some exemplary PK modulator include, but are not limited to, lipophilic molecules, bile acids, sterols, phospholipid analogues, peptides, protein binding agents, vitamins, fatty acids, phenoxazine, aspirin, naproxen, ibuprofen, suprofen, ketoprofen, (S)-(+)- pranoprofen, carprofen, PEGs, biotin, and transthyretia-binding ligands (e.g., tetraiidothyroacetic acid, 2, 4, 6-triiodophenol and flufenamic acid). Oligonucleotides that comprise a number of phosphorothioate intersugar linkages are also known to bind to serum protein, thus short
- oligonucleotides of comprising from about 5 to 30 nucleotides (e.g., 5 to 25 nulceotides, preferably 5 to 20 nucleotides, e.g., 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides), and that comprise a plurality of phosphorothioate linkages in the backbone are also amenable to the present invention as ligands (e.g. as PK modulating ligands).
- the PK modulating oligonucleotide can comprise at least 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15 or more phosphorothioate and/or phosphorodithioate linkages.
- all internucleotide linkages in PK modulating oligonucleotide are phosphorothioate and/or
- aptamers that bind serum components are also amenable to the present invention as PK modulating ligands. Binding to serum components (e.g. serum proteins) can be predicted from albumin binding assays, scuh as those described in Oravcova, et al., Journal of Chromatography B (1996), 677: 1-27.
- the ligands can all have same properties, all have different properties or some ligands have the same properties while others have different properties.
- a ligand can have targeting properties, have endosomolytic activity or have PK modulating properties.
- all the ligands have different properties.
- Ligands can be coupled to the oligonucleotides at various places, for example, 3 '-end, 5 '-end, and/or at an internal position. When two or more ligands are present, the ligand can be on opposite ends of an oligonucleotide. In preferred embodiments, the ligand is attached to the oligonucleotides via an intervening tether/linker. The ligand or tethered ligand can be present on a monomer when said monomer is incorporated into the growing strand. In some embodiments, the ligand can be incorporated via coupling to a "precursor" monomer after said "precursor" monomer has been incorporated into the growing strand.
- a monomer having, e.g., an amino-terminated tether (i.e., having no associated ligand), e.g., monomer-linker-NH 2 can be incorporated into a growing oligonucleotide strand.
- a ligand having an electrophilic group e.g., a pentafluorophenyl ester or aldehyde group, can subsequently be attached to the precursor monomer by coupling the electrophilic group of the ligand with the terminal nucleophilic group of the precursor monomer's tether.
- a monomer having a chemical group suitable for taking part in Click Chemistry reaction can be incorporated e.g., an azide or alkyne terminated tether/linker.
- a ligand having complementary chemical group e.g. an alkyne or azide can be attached to the precursor monomer by coupling the alkyne and the azide together.
- ligands can be attached to one or both strands.
- ligand can be conjugated to nucleobases, sugar moieties, or internucleosidic linkages of nucleic acid molecules. Conjugation to purine nucleobases or derivatives thereof can occur at any position including, endocyclic and exocyclic atoms. In some embodiments, the 2-, 6-, 7-, or 8-positions of a purine nucleobase are attached to a conjugate moiety. Conjugation to pyrimidine nucleobases or derivatives thereof can also occur at any position. In some embodiments, the 2-, 5-, and 6-positions of a pyrimidine nucleobase can be substituted with a conjugate moiety. When a ligand is conjugated to a nucleobase, the preferred position is one that does not interfere with hybridization, i.e., does not interfere with the hydrogen bonding interactions needed for base pairing.
- Conjugation to sugar moieties of nucleosides can occur at any carbon atom.
- Example carbon atoms of a sugar moiety that can be attached to a conjugate moiety include the 2', 3', and 5' carbon atoms.
- the ⁇ position can also be attached to a conjugate moiety, such as in an abasic residue.
- Internucleosidic linkages can also bear conjugate moieties.
- phosphorus-containing linkages e.g., phosphodiester
- the conjugate moiety can be attached directly to the phosphorus atom or to an O, N, or S atom bound to the phosphorus atom.
- the conjugate moiety can be attached to the nitrogen atom of the amine or amide or to an adjacent carbon atom.
- an oligomeric compound is attached to a conjugate moiety by contacting a reactive group (e.g., OH, SH, amine, carboxyl, aldehyde, and the like) on the oligomeric compound with a reactive group on the conjugate moiety.
- a reactive group e.g., OH, SH, amine, carboxyl, aldehyde, and the like
- one reactive group is electrophilic and the other is nucleophilic.
- an electrophilic group can be a carbonyl-containing functionality and a nucleophilic group can be an amine or thiol.
- Methods for conjugation of nucleic acids and related oligomeric compounds with and without linking groups are well described in the literature such as, for example, in Manoharan in Antisense Research and Applications, Crooke and LeBleu, eds., CRC Press, Boca Raton, Fla., 1993, Chapter 17, which is incorporated herein by reference in its entirety.
- Ligand carriers In some embodiments, the ligands, e.g. endosomolytic ligands, targeting ligands or other ligands, are linked to a monomer which is then incorporated into the growing oligonucleotide strand during chemical synthesis. Such monomers are also referred to as carrier monomers herein.
- the carrier monomer is a cyclic group or acyclic group; preferably, the cyclic group is selected from the group consisting of pyrrolidinyl, pyrazolinyl, pyrazolidinyl, imidazolinyl, imidazolidinyl, piperidinyl, piperazinyl, [l,3]-dioxolane, oxazolidinyl, isoxazolidinyl, morpholinyl, thiazolidinyl, isothiazolidinyl, quinoxalinyl, pyridazinonyl, tetrahydrofuryl and decalin; preferably, the acyclic group is selected from serinol backbone or diethanolamine backbone.
- the cyclic carrier monomer is based on pyrrolidinyl such as 4-hydroxyproline or a derivative thereof.
- Linkers In some embodiments, the covalent linkages between the oligonucleotide and other components, e.g. a ligand or a ligand carrying monomer can be mediated by a linker. This linker can be cleavable linker or non-cleavable linker, depending on the application.
- a "cleavable linker” refers to linkers that are capable of cleavage under various conditions. Conditions suitable for cleavage can include, but are not limited to, pH, UV irradiation, enzymatic activity, temperature, hydrolysis, elimination and substitution reactions, redox reactions, and thermodynamic properties of the linkage. In some embodiments, a cleavable linker can be used to release the oligonucleotide after transport to the desired target. The intended nature of the conjugation or coupling interaction, or the desired biological effect, will determine the choice of linker group.
- linker means an organic moiety that connects two parts of a compound.
- Linkers typically comprise a direct bond or an atom such as oxygen or sulfur, a unit such as NR 1 , C(O), C(0)NH, SO, SO 2 , SO 2 NH or a chain of atoms, such as substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, arylalkyl, arylalkenyl, arylalkynyl,
- heteroarylalkyl heteroarylalkenyl, heteroarylalkynyl, heterocyclylalkyl, heterocyclylalkenyl,
- heterocyclylalkynyl aryl, heteroaryl, heterocyclyl, cycloalkyl, cycloalkenyl, alkylarylalkyl, alkylarylalkenyl, alkylarylalkynyl, alkenylarylalkyl, alkenylarylalkenyl, alkenylarylalkynyl, alkynylarylalkyl,
- the linker is a branched linker.
- the branchpoint of the branched linker may be at least trivalent, but can be a tetravalent, pentavalent or hexavalent atom, or a group presenting such multiple valencies.
- the branchpoint is -N, -N(Q)-C, -O-C, -S-C, -SS-C, -C(0)N(Q)- C, -OC(0)N(Q)-C, -N(Q)C(0)-C, or -N(Q)C(0)0-C; wherein Q is independently for each occurrence H or optionally substituted alkyl.
- the branchpoint is glycerol or derivative thereof.
- a cleavable linking group is one which is sufficiently stable outside the cell, but which upon entry into a target cell is cleaved to release the two parts the linker is holding together.
- the cleavable linking group is cleaved at least 10 times or more, preferably at least 100 times faster in the target cell or under a first reference condition (which can, e.g., be selected to mimic or represent intracellular conditions) than in the blood or serum of a subject, or under a second reference condition (which can, e.g., be selected to mimic or represent conditions found in the blood or serum).
- Cleavable linking groups are susceptible to cleavage agents, e.g., pH, redox potential or the presence of degradative molecules. Generally, cleavage agents are more prevalent or found at higher levels or activities inside cells than in serum or blood.
- degradative agents include: redox agents which are selected for particular substrates or which have no substrate specificity, including, e.g., oxidative or reductive enzymes or reductive agents such as mercaptans, present in cells, that can degrade a redox cleavable linking group by reduction; esterases; amidases; endosomes or agents that can create an acidic environment, e.g., those that result in a pH of five or lower; enzymes that can hydrolyze or degrade an acid cleavable linking group by acting as a general acid, peptidases (which can be substrate specific) and proteases, and phosphatases.
- redox agents which are selected for particular substrates or which have no substrate specificity, including, e.g., oxidative or reductive enzymes or reductive agents such as mercaptans, present in cells, that can degrade a redox cleavable linking group by reduction; esterases; amidases; endosomes or
- a linker can include a cleavable linking group that is cleavable by a particular enzyme.
- the type of cleavable linking group incorporated into a linker can depend on the cell to be targeted. For example, liver targeting ligands can be linked to the cationic lipids through a linker that includes an ester group. Liver cells are rich in esterases, and therefore the linker will be cleaved more efficiently in liver cells than in cell types that are not esterase-rich. Other cell-types rich in esterases include cells of the lung, renal cortex, and testis.
- Linkers that contain peptide bonds can be used when targeting cell types rich in peptidases, such as liver cells and synoviocytes.
- cleavable linking group is cleaved at least 1.25, 1.5, 1.75, 2, 3, 4, 5, 10, 25, 50, or 100 times faster in the cell (or under in vitro conditions selected to mimic intracellular conditions) as compared to blood or serum (or under in vitro conditions selected to mimic extracellular conditions). In some embodiments, the cleavable linking group is cleaved by less than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, or 1% in the blood (or in vitro conditions selected to mimic extracellular conditions) as compared to in the cell (or under in vitro conditions selected to mimic intracellular conditions)
- Exemplary cleavable linking groups include, but are not limited to, redox cleavable linking groups (e.g., -S-S- and -C(R) 2 -S-S-, wherein R is H or Ci-C6 alkyl and at least one R is Ci-C6 alkyl such as CH 3 or CH 2 CH 3 ); phosphate-based cleavable linking groups (e.g., -0-P(0)(OR)-0-, -0-P(S)(OR)-0-, -0-P(S)(SR)- 0-, -S-P(0)(OR)-0-, -0-P(0)(OR)-S-, -S-P(0)(OR)-S-, -0-P(S)(ORk)-S-, -S-P(S)(OR)-0-, -0-P(0)(R)-0-, -0-P(S)(R)-0-, -S-P(0)(R)-0-, -S-P
- a peptide based cleavable linking group comprises two or more amino acids.
- the peptide -based cleavage linkage comprises the amino acid sequence that is the substrate for a peptidase or a protease found in cells.
- an acid cleavable linking group is cleaveable in an acidic environment with a pH of about 6.5 or lower (e.g., about 6.5, 6.0, 5.5, 5.0, or lower), or by agents such as enzymes that can act as a general acid.
- RNAi agents that inhibit SH2B3 and oligonucleotides used in accordance with this invention can be synthesized with solid phase synthesis, see for example "Oligonucleotide synthesis, a practical approach", Ed. M. J. Gait, IRL Press, 1984; “Oligonucleotides and Analogues, A Practical Approach”, Ed. F.
- Carbonate replacements are described in Tittensor, J.R. J. Chem. Soc. C 1971, 1933. Carboxymethyl replacements are described in Edge, M.D. et al. J. Chem. Soc. Perkin Trans. 1 1972, 1991. Carbamate replacements are described in Stirchak, E.P. Nucleic Acids Res. 1989, 17, 6129.
- Cyclobutyl sugar surrogate compounds can be prepared as is described in U.S. Pat. No. 5,359,044.
- Pyrrolidine sugar surrogate can be prepared as is described in U.S. Pat. No. 5,519, 134.
- Morpholino sugar surrogates can be prepared as is described in U.S. Pat. Nos. 5, 142,047 and 5,235,033, and other related patent disclosures.
- PNAs Peptide Nucleic Acids
- PNA Peptide Nucleic Acids
- Terminal modifications are described in Manoharan, M. et al. Antisense and Nucleic Acid Drug Development 12, 103- 128 (2002) and references therein. Placement of modifications within an oligonucleotide (e.g., placement within an RNAi agents that inhibits SH2B3)
- oligonucleotides such as RNAi agents that inhibit SH2B3 can be are polymers of subunits or monomers, many of the modifications described herein can occur at a position which is repeated within an oligonucleotide, e.g., a modification of a nucleobase, a sugar, a phosphate moiety, or the non-bridging oxygen of a phosphate moiety. It is not necessary for all positions in a given oligonucleotide to be uniformly modified, and in fact more than one of the aforementioned modifications can be incorporated in a single oligonucleotide or even at a single nucleoside within an oligonucleotide.
- the modification will occur at all of the subject positions in the oligonucleotide but in many, and in fact in most cases it will not.
- a modification can occur at a 3' or 5' terminus position, can occur in the internal region, can occur in 3', 5' or both terminal regions, e.g. at a position on a termus nucleotide or in the last 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of an oligonucleotide.
- the terminus nucleotide does not comprise a modification.
- the terminus nucleotide or the last 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of at least one end of the oligonucleotide all comprise at least one modification.
- the modification is same.
- the terminus nucleotide or the last 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at both ends of the oligonucleotide all comprise at least one modification. It is to be understood that type of modification and number of modified nucleotides on one end of the oligonucleotide is independent of type of modification and number of modified nucleotides on the other end of the
- a modification can occur in the double strand region, the single strand region, or in both the double- and single-stranded regions.
- a modification described herein does not occur in the region corresponding to the target cleavage site region.
- a phosphorothioate modification at a non-bridging oxygen position can occur at one or both termini, can occur in a terminal regions, e.g., at a position on a terminal nucleotide or in the last 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of a strand, or can occur in double strand and single strand regions, particularly at termini.
- Some modifications can preferably be included on an oligonucleotide at a particular location, e.g., at an internal position of a strand, or on the 5' or 3' end of an oligonucleotide.
- a preferred location of a modification on an oligonucleotide can confer preferred properties on the oligonucleotide.
- preferred locations of particular modifications can confer increased resistance to endonuclease or exonuclease activity.
- RNAi agents that inhibit SH2B3 as disclosed herien can be prepared using solution-phase or solid-phase organic synthesis, or enzymatically by methods known in the art.
- Organic synthesis offers the advantage that the oligonucleotide strands comprising non-natural or modified nucleotides can be easily prepared. Any other means for such synthesis known in the art can additionally or alternatively be employed. It is also known to use similar techniques to prepare other oligonucleotides, such as the phosphorothioates, phosphorodithioates and alkylated derivatives.
- oligonucleotide compounds of the invention can be prepared using a two-step procedure. First, the individual strands of the double-stranded molecule are prepared separately. Then, the component strands are annealed.
- MicroRNAs have also been implicated in modulation of pathogens in hosts. For example, see Jopling, C.L., et al., Science (2005) vol. 309, pp 1577-1581.
- the oligonucleotide can be prepared in a solution (e.g., an aqueous and/or organic solution) that is appropriate for formulation.
- a solution e.g., an aqueous and/or organic solution
- the oligonucleotide preparation can be precipitated and redissolved in pure double-distilled water, and lyophilized. The dried oligonucleotide can then be resuspended in a solution appropriate for the intended formulation process.
- oligonucleotides U.S. Pat. No. 5,578,718, drawn to nucleosides having alkylthio groups, wherein such groups can be used as linkers to other moieties attached at any of a variety of positions of the nucleoside; U.S. Pat. Nos. 5,587,361 and 5,599,797, drawn to oligonucleotides having phosphorothioate linkages of high chiral purity; U.S. Pat. No. 5,506,351, drawn to processes for the preparation of 2'-0-alkyl guanosine and related compounds, including 2,6-diaminopurine compounds; U.S. Pat. No. 5,587,469, drawn to
- oligonucleotides having N-2 substituted purines U.S. Pat. No. 5,587,470, drawn to oligonucleotides having 3-deazapurines; U.S. Pat. No. 5,223, 168, and U.S. Pat. No. 5,608,046, both drawn to conjugated 4'- desmethyl nucleoside analogs; U.S. Pat. Nos. 5,602,240, and 5,610,289, drawn to backbone -modified oligonucleotide analogs; and U.S. Pat. Nos. 6,262,241, and 5,459,255, drawn to, inter alia, methods of synthesizing 2'-fluoro-oligonucleotides.
- RNAi agents that inhibit SH2B3 can be recombinantly produced, or synthesized in vitro by a variety of techniques well known to one of ordinary skill in the art.
- RNAi agents that inhibit SH2B3 can be obtained by preparing a recombinant version thereof (i.e. , by using the techniques of genetic engineering to produce a recombinant nucleic acid which can then be isolated or purified by techniques well known to one of ordinary skill in the art). This approach involves growing a culture of host cells in a suitable culture medium, and purifying the RNAi agents that inhibit SH2B3 from the cells or the culture in which the cells are grown.
- the methods include a process for producing a RNAi agents that inhibit SH2B3 in which a host cell, containing a suitable expression vector that includes a nucleic acid encoding a RNAi agent that inhibits SH2B3, is cultured under conditions that allow expression of the encoded RNAi agent.
- the RNAi can be recovered from the culture, from the culture medium or from a lysate prepared from the host cells, and further purified.
- the host cell can be a higher eukaryotic host cell such as a mammalian cell, a lower eukaryotic host cell such as a yeast cell, or the host cell can be a prokaryotic cell such as a bacterial cell.
- RNAi agent is a miRNA or the like.
- Any host/vector system can be used to express one or more RNAi agents that inhibits SH2B3.
- RNAi agents that inhibits SH2B3 include, but are not limited to, eukaryotic hosts such as HeLa cells and yeast, as well as prokaryotic host such as E. coli and B. subtilis.
- An RNAi agents that inhibits SH2B3, e.g., miRNA that inhibits SH2B3 is under the control of an appropriate promoter.
- Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by Sambrook, et al., in Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y. (1989).
- RNAi agent that inhibits SH2B3, e.g., miRNA is expressed in mammalian cells.
- mammalian expression systems include CI 27, monkey COS cells, Chinese Hamster Ovary (CHO) cells, human kidney 293 cells, human epidermal A43 1 cells, human Colo205 cells, 3T3 cells, CV-1 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HeLa cells, mouse L cells, BILK, HL-60, U937, HaK or Jurkat cells.
- Mammalian expression vectors will comprise an origin of replication, a suitable promoter, polyadenylation site, transcriptional termination sequences, and 5 ' flanking non-transcribed sequences.
- DNA sequences derived from the SV40 viral genome for example, SV40 origin, early promoter, enhancer, splice, and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
- Potentially suitable yeast strains include Saccharomyces cerevsiae, Schizosaccharomyces pombe, Klayveromyces strains, Candida, or any yeast strain capable of expressing a RNAi agent that inhibits SH2B3, e.g., miRNA.
- Potentially suitable bacterial strains include Escherichia coli, Bacillus subtilis, Salmonella typhimurium, or any bacterial strain capable of expressing a RNAi agent that inhibits SH2B3, e.g., miRNA.
- genomic DNA encoding a RNAi agent that inhibits SH2B3, e.g., miRNA is isolated, the genomic DNA is expressed in a mammalian expression system, and RNA is purified and modified as necessary for administration to a patient.
- a RNAi agent that inhibits SH2B3 which is a miRNA is in the form of a pre-miRNA, which can be modified as desired (i.e. for increased stability or cellular uptake).
- RNAi agent that inhibits SH2B3, e.g., shRNA or miRNA allows for modification of cells to permit or increase expression of an endogenous miRNA.
- Cells can be modified (e.g., by homologous recombination) to provide increased miRNA expression by replacing, in whole or in part, the naturally occurring promoter with all or part of a heterologous promoter so that the cells express the RNAi agent that inhibits SH2B3, e.g., miRNA at higher levels.
- the heterologous promoter is inserted in such a manner that it is operatively linked to the desired a RNAi agent that inhibits SH2B3, e.g., miRNA encoding sequences.
- RNAi agent that inhibits SH2B3 may be prepared by culturing transformed host cells under culture conditions suitable to express the RNAi agent that inhibits SH2B3.
- the resulting expressed RNAi agent that inhibits SH2B3 may then be purified from such culture (i.e., from culture medium or cell extracts) using known purification processes, such as gel filtration and ion exchange chromatography.
- the purification of the RNAi agent that inhibits SH2B3, e.g., miR may also include an affinity column containing agents which will bind to the protein; one or more column steps over such affinity resins as concanavalin A-agarose, heparin-toyopearlTM or Cibacrom blue 3GA SepharoseTM; one or more steps involving hydrophobic interaction chromatography using such resins as phenyl ether, butyl ether, or propyl ether; immunoaffnity chromatography, or complementary cDNA affinity chromatography.
- affinity resins as concanavalin A-agarose, heparin-toyopearlTM or Cibacrom blue 3GA SepharoseTM
- hydrophobic interaction chromatography using such resins as phenyl ether, butyl ether, or propyl ether
- immunoaffnity chromatography or complementary cDNA affinity chromatography.
- RNAi agent that inhibits SH2B3 can also be expressed as a product of transgenic animals, which are characterized by somatic or germ cells containing a nucleotide sequence encoding the RNAi agent that inhibits SH2B3.
- a vector containing DNA encoding RNAi agent that inhibits SH2B3 and appropriate regulatory elements can be inserted in the germ line of animals using homologous recombination (Capecchi, Science 1 244: 1288-1292 (1989)), such that they express the RNAi agent that inhibits SH2B3.
- Transgenic animals preferably non-human mammals, are produced using methods as described in U.S. Patent No 5,489,743 to Robinson, et al., and PCT Publication No. WO 94/28122 by Ontario Cancer Institute.
- a RNAi agent that inhibits SH2B3 can be isolated from cells or tissue isolated from transgenic animals as discussed above.
- the RNAi agent that inhibits SH2B3 can be obtained synthetically, for example, by chemically synthesizing a nucleic acid by any method of synthesis known to the skilled artisan.
- the synthesized RNAi agent that inhibits SH2B3 can then be purified by any method known in the art.
- Methods for chemical synthesis of nucleic acids include, but are not limited to, in vitro chemical synthesis using phosphotriester, phosphate or phosphoramidite chemistry and solid phase techniques, or via deoxynucleoside H-phosphonate intermediates (see U.S. Patent No. 5,705,629 to Bhongle).
- nucleic acids having nucleic acid analogs and/or modified internucleoside linkages may be preferred.
- Nucleic acids containing modified internucleoside linkages can also be synthesized using reagents and methods that are well known in the art.
- RNAi agent that inhibits SH2B3 can comprise locked nucleotides, e.g., as disclosed in US patent 8,642,751, which is incorporated herein in its entirety by reference.
- Other chemical modifications of motifs for RNAi agent that inhibits SH2B3 as disclosed herein are disclosed in US application US 2012/0148664 and US 2014/0066491, which are incorporated herein in their entirety by reference.
- RNAi agent that inhibits SH2B3 as disclosed herein can comprise base modified oligonucleotides, e.g., as disclosed in International Applications WO 2012061810 and WO 2012061810, which are incorporated herein in their entirety by reference.
- a formulated oligonucleotide composition can assume a variety of states.
- the composition can be at least partially crystalline, uniformly crystalline, and/or anhydrous (e.g., less than 80, 50, 30, 20, or 10% water).
- the oligonucleotide is in an aqueous phase, e.g., in a solution that includes water.
- the aqueous phase or the crystalline compositions can, e.g., be incorporated into a delivery vehicle, e.g., a liposome (particularly for the aqueous phase) or a particle (e.g., a micro particle as can be appropriate for a crystalline composition).
- a delivery vehicle e.g., a liposome (particularly for the aqueous phase) or a particle (e.g., a micro particle as can be appropriate for a crystalline composition).
- the oligonucleotide composition is formulated in a manner that is compatible with the intended method of administration.
- the composition is prepared by at least one of the following methods: spray drying, lyophilization, vacuum drying, evaporation, fluid bed drying, or a combination of these techniques; or sonication with a lipid, freeze-drying, condensation and other self-assembly.
- An oligonucleotide preparation can be formulated in combination with another agent, e.g., another therapeutic agent or an agent that stabilizes the oligonucleotide, e.g., a protein that complex with oligonucleotide to form an oligonucleotide-protein complex.
- another agent e.g., another therapeutic agent or an agent that stabilizes the oligonucleotide, e.g., a protein that complex with oligonucleotide to form an oligonucleotide-protein complex.
- Still other agents include chelators, e.g., EDTA (e.g., to remove divalent cations such as Mg 2+ ), salts, DNAse inhibitors, R Ase inhibitors (e.g., a broad specificity RNAse inhibitor such as RNAsin) and so forth.
- the oligonucleotide preparation includes at least a second therapeutic agent (e.g., an agent other than RNA or DNA).
- a second therapeutic agent e.g., an agent other than RNA or DNA.
- Exemplary therapeutic agents that can formulated with an oligonucleotide preparation include, but are not limited to, those found in Harrison 's Principles of Internal Medicine, 17 th Edition, 2008, McGraw-Hill N.Y., NY; Physicians Desk Reference, 63 rd Edition, 2008, Thomson Reuters, N.Y., N.Y.; Goodman & Gilman's The Pharmacological Basis of Therapeutics, 1 1 th Edition, 2005, McGraw-Hill N.Y., NY; United States Pharmacopeia, The National Formulary, USP -32 NF- 27, 2008, U.S. Pharmacopeia, Rockville, MD, the complete contents of all of which are incorporated herein by reference.
- the second therapeutic agent is an anti-hypertension agent or antihypertensive.
- Liposomes The oligonucleotides of the invention (e.g., RNAi agent that inhibits SH2B3) can be formulated in liposomes.
- a liposome is a structure having lipid-containing membranes enclosing an aqueous interior. Liposomes can have one or more lipid membranes. In some embodiments, liposomes have an average diameter of less than about 100 nm. More preferred embodiments provide liposomes having an average diameter from about 30-70nm and most preferably about 40-60nm.
- Oligolamellar large vesicles and multilamellar vesicles have multiple, usually concentric, membrane layers and are typically larger than lOOnm. Liposomes with several nonconcentric membranes, i.e., several smaller vesicles contained within a larger vesicle, are termed multivesicular vesicles.
- Liposomes can further comprise one or more additional lipids and/or other components such as sterols, e.g., cholesterol. Additional lipids can be included in the liposome compositions for a variety of purposes, such as to prevent lipid oxidation, to stabilize the bilayer, to reduce aggregation during formation or to attach ligands onto the liposome surface. Any of a number of additional lipids and/or other components can be present, including amphipathic, neutral, cationic, anionic lipids, and programmable fusion lipids. Such lipids and/or components can be used alone or in combination. One or more components of the liposome can comprise a ligand, e.g., a targeting ligand.
- a ligand e.g., a targeting ligand.
- Liposome compositions can be prepared by a variety of methods that are known in the art. See e.g., U.S. Pat. Nos. 4,235,871 ; 4,737,323; 4,897,355 and 5,171,678; published International Applications WO 96/14057 and WO 96/37194; Feigner, P. L. et al, Proc. Natl. Acad. Sc , USA (1987) 8:7413-7417, Bangham, et al. M. Mol. Biol. (1965) 23:238, Olson, et al. Biochim. Biophys. Acta (1979) 557:9, Szoka, et al. Proc. Natl. Acad.
- the oligonucleotides e.g., a RNAi agent that inhibits SH2B3
- the oligonucleotides can be prepared and formulated as micelles.
- micelles are a particular type of molecular assembly in which amphipathic molecules are arranged in a spherical structure such that all hydrophobic portions on the molecules are directed inward, leaving the hydrophilic portions in contact with the surrounding aqueous phase. The converse arrangement exists if the environment is hydrophobic.
- the formulations comprises micelles formed from an oligonucleotide of the invention and at least one amphiphilic carrier, in which the micelles have an average diameter of less than about 100 nm, preferably. More preferred embodiments provide micelles having an average diameter less than about 50 nm, and even more preferred embodiments provide micelles having an average diameter less than about 30 nm, or even less than about 20 nm.
- Micelle formulations can be prepared by mixing an aqueous solution of the oligonucleotide composition, an alkali metal Cg to C22 alkyl sulphate, and an amphiphilic carrier.
- the amphiphilic carrier can be added at the same time or after addition of the alkali metal alkyl sulphate.
- Micelles will form with substantially any kind of mixing of the ingredients but vigorous mixing in order to provide smaller size micelles.
- Emulsions In some embodiments, the oligonucleotides (e.g., RNAi agent that inhibits SH2B3) as disclosed herein can be prepared and formulated as emulsions.
- emulsion is a heterogenous system of one liquid dispersed in another in the form of droplets. Emulsions are often biphasic systems comprising two immiscible liquid phases intimately mixed and dispersed with each other. Either of the phases of the emulsion can be a semisolid or a solid, as is the case of emulsion- style ointment bases and creams.
- the oligonucleotide can be present as a solution in either the aqueous phase, oily phase or itself as a separate phase.
- the compositions are formulated as microemulsions.
- microemulsion refers to a system of water, oil and amphiphile which is a single optically isotropic and thermodynamically stable liquid solution. Microemuslions also include thermodynamically stable, isotropically clear dispersions of two immiscible liquids that are stabilized by interfacial films of surface- active molecules.
- the oligonucleotides e.g., a RNAi agent that inhibits SH2B3
- the oligonucleotides can be prepared and formulated as lipid particles, e.g., formulated lipid particles (FLiPs) comprising (a) an oligonucleotide of the invention, where said oligonucleotide has been conjugated to a lipophile and (b) at least one lipid component, for example an emulsion, liposome, isolated lipoprotein, reconstituted lipoprotein or phospholipid, to which the conjugated oligonucleotide has been aggregated, admixed or associated.
- FLiPs formulated lipid particles
- the stoichiometry of oligonucleotide to the lipid component can be 1 : 1.
- the stoichiometry can be 1 many, many: 1 or many:many, where many is two or more.
- the FLiP can comprise triacylglycerols, phospholipids, glycerol and one or several lipid-binding proteins aggregated, admixed or associated via a lipophilic linker molecule with an oligonucleotide.
- the FLiPs show affinity to liver, gut, kidney, steroidogenic organs, heart, lung and/or muscle tissue. These FLiPs can therefore serve as carrier for oligonucleotides to these tissues.
- lipid-conjugated oligonucleotides e.g., cholesterol-conjugated oligonucleotides
- bind to HDL and LDL lipoprotein particles which mediate cellular uptake upon binding to their respective receptors thus directing oligonucleotide delivery into liver, gut, kidney and steroidogenic organs, see Wolfrum et al. Nature Biotech. (2007), 25: 1 145- 1 157.
- the FLiP can be a lipid particle comprising 15-25% triacylglycerol, about 0.5-2% phospholipids and 1-3 % glycerol, and one or several lipid-binding proteins.
- FLiPs can be a lipid particle having about 15- 25% triacylglycerol, about 1 -2% phospholipids, about 2-3 % glycerol, and one or several lipid-binding proteins.
- the lipid particle comprises about 20% triacylglycerol, about 1.2% phospholipids and about 2.25% glycerol, and one or several lipid-binding proteins.
- lipoproteins for example isolated lipoproteins or more preferably reconstituted lipoprotieins.
- exemplary lipoproteins include chylomicrons, VLDL (Very Low Density Lipoproteins), IDL (Intermediate Density Lipoproteins), LDL (Low Density Lipoproteins) and HDL (High Density Lipoproteins).
- VLDL Very Low Density Lipoproteins
- IDL Intermediate Density Lipoproteins
- LDL Low Density Lipoproteins
- HDL High Density Lipoproteins
- Intralipid is a brand name for the first safe fat emulsion for human use.
- Intralipid® 20% (a 20% intravenous fat emulsion) is made up of 20% soybean oil, 1.2% egg yolk phospholipids, 2.25% glycerin, and water for injection. It is further within the present invention that other suitable oils, such as saflower oil, can serve to produce the lipid component of the FLiP.
- FLiP can range in size from about 20-50 nm or about 30-50 nm, e.g., about 35 nm or about 40 nm. In some embodiments, the FLiP has a particle size of at least about 100 nm. FLiPs can alternatively be between about 100-150 nm, e.g., about 1 10 nm, about 120 nm, about 130nm, or about 140 nm, whether characterized as liposome- or emulsion-based. Multiple FLiPs can also be aggregated and delivered together, therefore the size can be larger than 100 nm.
- the process for making the lipid particles comprises the steps of: (a) mixing a lipid components with one or several lipophile (e.g. cholesterol) conjugated oligonucleotides that can be chemically modified; and (b) fractionating this mixture.
- the process comprises the additional step of selecting the fraction with particle size of 30-50nm, preferably of about 40 nm in size.
- yeast cell wall particles In some embodiments, the oligonucleotides (e.g., a RNAi agent that inhibits SH2B3) as disclosed herein are formulated in yeast cell wall particles ("YCWP").
- a yeast cell wall particle comprises an extracted yeast cell wall exterior and a core, the core comprising a payload (e.g., oligonucleotides). Exterior of the particle comprises yeast glucans (e.g. beta glucans, beta-l,3-glucans, beta- 1,6-glucans), yeast mannans, or combinations thereof.
- yeast cell wall particles are typically spherical particles about 1-4 ⁇ in diameter..
- yeast cell wall particles Preparation of yeast cell wall particles is known in the art, and is described, for example in U.S. Pat. Nos. 4,992,540; 5,082,936; 5,028,703; 5,032,401; 5,322,841 ; 5,401,727; 5,504,079; 5,607,677; 5,741,495; 5,830,463; 5,968,81 1 ; 6,444,448; and 6,476,003, U.S. Pat. App. Pub. Nos. 2003/0216346 and 2004/0014715, and Int. App. Pub. No. WO 2002/12348, contents of which are herein incorporated by reference in their entirety.
- Applications of yeast cell like particles for drug delivery are described, for example in U.S. Pat. No. 5,032,401 ; 5,607,677; 5,741,495; and 5,830,463, and U.S. Pat. Pub Nos. 2005/0281781 and
- SH2B3 protein has both an SH2 domain and PH domain, either of which or both can be a target for development of peptide and small molecule inhibitors. See D. Kraskouskaya, et al., Chem Soc Rev. 2013 Apr 21 ;42(8):3337-70.
- the antagonist of SH2B3 specifically binds to the SH2 domain of SH2B3 protein.
- the antagonist of SH2B3 specifically binds to the PH domain of SH2B3 protein.
- the antagonist of SH2B3 specifically binds to both the SH2 and PH domains of SH2B3 protein.
- the antagonist of SH2B3 is a small molecule.
- small molecule refers to a natural or synthetic molecule having a molecular mass of less than about 5 kD, organic or inorganic compounds having a molecular mass of less than about 5 kD, less than about 2 kD, or less than about 1 kD.
- the antagonist of SH2B3 can have an IC50 of less than 50 ⁇ , e.g., the antagonist of SH2B3 can have an IC50 of from about 50 ⁇ to about 5 nM, or less than 5 nM.
- an antagonist of SH2B3 has an IC50 of from about 50 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 1 ⁇ , from about 1 ⁇ to about 500 nM, from about 500 nM to about 400 tiM, from about 400 nM to about 300 nM, from about 300 nM to about 250 nM, from about 250 nM to about 200 nM, from about 200 nM to about 150 nM, from about 150 nM to about 100 nM, from about 100 nM to about 50 nM, from about 50 nM to about 30 nM, from about 30 nM to about 25 nM, from about 25 nM to about 20 nM, from about 20 nM to about 15 nM, from about 15 nM to about 10 nM, from about 10 nM to about 5 nM, or less than about 5 nM
- the antagonist of SH2B3 can be an anti-SH2B3 antibody molecule or an antigen-binding fragment thereof.
- Suitable antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, humanized, recombinant, single chain, F ab , F ab' , F sc , R v , and F (ab ')2 fragments.
- neutralizing antibodies can be used as anti-SH2B3 antibodies.
- Antibodies are readily raised in animals such as rabbits or mice by immunization with the antigen. Immunized mice are particularly useful for providing sources of B cells for the manufacture of hybridomas, which in turn are cultured to produce large quantities of monoclonal antibodies.
- an antibody molecule obtained from humans can be classified in one of the immunoglobulin classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGi, IgG 2 , and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
- Antibodies provide high binding avidity and unique specificity to a wide range of target antigens and haptens.
- Monoclonal antibodies useful in the practice of the methods disclosed herein include whole antibody and fragments thereof and are generated in accordance with conventional techniques, such as hybridoma synthesis, recombinant DNA techniques and protein synthesis.
- the SH2B3 polypeptide, or a portion or fragment thereof can serve as an antigen, and additionally can be used as an immunogen to generate antibodies that immunospecifically bind the antigen, using standard techniques for polyclonal and monoclonal antibody preparation.
- the antigenic peptide comprises at least 10 amino acid residues, or at least 15 amino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues.
- Useful monoclonal antibodies and fragments can be derived from any species (including humans) or can be formed as chimeric proteins which employ sequences from more than one species.
- Murine monoclonal antibodies or "humanized” murine antibody can also be used in accordance with the present invention.
- murine monoclonal antibody can be "humanized” by genetically recombining the nucleotide sequence encoding the murine Fv region (i.e., containing the antigen binding sites) or the complementarily determining regions thereof with the nucleotide sequence encoding a human constant domain region and an Fc region.
- Humanized targeting moieties are recognized to decrease the immunoreactivity of the antibody or polypeptide in the host recipient, permitting an increase in the half-life and a reduction in the possibility of adverse immune reactions in a manner similar to that disclosed in European Patent Application No. 0,41 1,893 A2.
- the murine monoclonal antibodies should preferably be employed in humanized form.
- Antigen binding activity is determined by the sequences and conformation of the amino acids of the six complementarity determining regions (CDRs) that are located (three each) on the light and heavy chains of the variable portion (Fv) of the antibody.
- CDRs complementarity determining regions
- ScFvs provide additional options for preparing and screening a large number of different antibody fragments to identify those that specifically bind.
- scFv molecules with a broad range orantigenic-specificities can be present in a single large pool of scFv-phage library.
- Chimeric antibodies are immunoglobin molecules characterized by two or more segments or portions derived from different animal species.
- the variable region of the chimeric antibody is derived from a non-human mammalian antibody, such as murine monoclonal antibody, and the
- immunoglobin constant region is derived from a human immunoglobin molecule. Preferably, both regions and the combination have low immunogenicity as routinely determined.
- Anti-SH2B3 antibodies are commercially available through vendors such as Thermo Scientific, Sigma Aldrich, Atlas Antibodies, and R&D Systems.
- stem cells and/or progenitor cells are well known in the art.
- cells as described herein can be cultured in culture medium that is available to and well-known in the art.
- Such media include, but are not limited to, Dulbecco's Modified Eagle's , F-12K®, Eagle's Minimum Essential Medium® (DMEM), DMEM F12 Medium® , and serum- free®, RPMI-1640 Medium®, Iscove's Modified Dulbecco's Medium® (IMDM).
- IMDM Iscove's Modified Dulbecco's Medium
- Many media for culture and expansion of stem cells and/or progenitor cells are also available as low-glucose formulations, with or without sodium pyruvate.
- Also contemplated herein is supplementation of cell culture medium with mammalian sera.
- Sera often contain cellular factors and components that are necessary for viability and expansion.
- examples of sera include fetal bovine serum (FBS), bovine serum (BS), calf serum (CS), fetal calf serum (FCS), newborn calf serum (NCS), goat serum (GS), horse serum (HS), human serum (e.g., human AB serum), chicken serum, porcine serum, sheep serum, rabbit serum, serum replacements and bovine embryonic fluid.
- FBS fetal bovine serum
- BS bovine serum
- CS calf serum
- FCS fetal calf serum
- NCS newborn calf serum
- GS goat serum
- HS horse serum
- human serum e.g., human AB serum
- chicken serum porcine serum
- sheep serum rabbit serum
- serum replacements bovine embryonic fluid
- Hematopoietic growth factors include, but are not limited to, any or all Interleukins (IL- 1 to IL- 16), interferons (IFN-alpha, beta and gamma), erythropoietin (EPO), stem cell factor (SCF), insulin like growth factors, fibroblast growth factors, platelet- derived growth factor, tumor growth factor beta, tumor necrosis factor alpha, granulocyte colony stimulating factor (G-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M-CSF), fins-like tyrosine kinase-3 ligand (Flt3-ligand), as well as EGF (epidermal growth factor), VEGF (vascular endothelial growth factor), LIF (leukemia inhibiting factor).
- IL- 1 to IL- 16 Interleukins
- IFN-alpha, beta and gamma interferons
- EPO erythro
- Thrombopoletin or MGDF (mast growth derived factor) may also be used. Many of these growth factors are commercially available. Most commonly used mixture of growth factors includes G-CSF, GM- CSF, SCF, IL-1, IL-3 and IL-6. Most of the growth factors used are produced by recombinant DNA techniques are purified to various degrees. Some growth factors are purified from culture media of tumor cell lines by standard biochemical techniques. A widely used growth factor is PIXY 321 which is produced by recombinant technology and exhibits both, GM-CSF and IL-3 activity.
- the amount of growth factors used in the cultures depends on the activity of the factor preparation and on the combination of growth factors used. Typically, concentrations range from 0.5 to 500 ng/mL. The optimum concentration of each growth factor has to be determined for individual culture conditions since some growth factors act synergistically with other growth factors.
- Additional supplements also can be used advantageously to supply the cells with the necessary trace elements for optimal growth and expansion.
- Such supplements include, for example, insulin, transferrin, heparin, sodium selenium and combinations thereof.
- These components can be included in a salt solution including, but not limited to, (HBSS), Earle's Salt®, Hanks' Balanced Salt Solution, antioxidant supplements, MCDB -201 ⁇ Solution saline (PBS), ascorbic acid and ascorbic acid-2-phosphate, as well as additional amino acids.
- HBSS Hanks' Balanced Salt Solution
- antioxidant supplements antioxidant supplements
- ascorbic acid and ascorbic acid-2-phosphate as well as additional amino acids.
- Many cell culture media already contain amino acids, however, some require supplementation prior to culturing cells.
- Such amino acids include, but are not limited to, L-alanine, L- arginine, L-aspartic acid, L- asparagine, L-cysteine, L-cystine, L-glutamic acid, L-glutamine, L-glycine, L- histidine, L- isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-serine, L- threonine, L-tryptophan, L-tyrosine, and L-valine. It is well within the skill of one in the art to determine the proper concentrations of these supplements.
- Hormones also can be advantageously used in the cell cultures described herein and include, but are not limited to, D-aldosterone, diethylstilbestrol (DES), dexamethasone, beta- estradiol, hydrocortisone, insulin, prolactin, progesterone, somatostatin/human growth hormone (HGH), thyrotropin, thyroxine and L- thyronine.
- DES diethylstilbestrol
- dexamethasone beta- estradiol
- hydrocortisone insulin
- prolactin prolactin
- progesterone progesterone
- HGH somatostatin/human growth hormone
- thyrotropin thyroxine
- L- thyronine L- thyronine
- Lipids and lipid carriers also can be used to supplement cell culture media, depending on the type of cell and the fate of the differentiated cell.
- Such lipids and carriers can include, but are not limited to, cholesterol, linoleic acid conjugated to albumin, cyclodextrin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, among others.
- feeder cell layers are also contemplated for the methods described herein. Feeder cells are used to support the growth of fastidious cultured cells, such as stem cells. Feeder cells are normal cells that have been ⁇ -irradiated to suppress cell division yet permit active metabolism.
- the feeder layer serves as a basal inactivated layer for other cells and supplies cellular factors without further growth or division of their own (Lim, J. W. and Bodnar, A., 2002).
- typical feeder layer cells include human diploid lung cells, mouse embryonic fibroblasts and Swiss mouse embryonic fibroblasts, but can be any post-mitotic cell that is capable of supplying cellular components and factors that are advantageous in allowing optimal growth, viability and expansion of stem cells and/or progenitor cells.
- feeder cell layers are not necessary to keep the stem cells and/or progenitor cells in an undifferentiated, proliferative state, as leukemia inhibitory factor (LIF) has anti- differentiation properties. Therefore, supplementation with LIF can be used to maintain cells in an undifferentiated state.
- LIF leukemia inhibitory factor
- Cells can be cultured in low-serum or serum-free culture medium.
- Serum- free medium used to culture cells is described in, for example, U.S. Pat. No. 7,015,037.
- Many cells have been grown in serum- free or low-serum medium.
- the medium can be supplemented with one or more growth factors.
- Commonly used growth factors include, but are not limited to, bone morphogenic protein, basic fibroblast growth factor, platelet-derived growth factor and epidermal growth factor, Stem cell factor, thrombopoietin, Flt3Ligand and ⁇ -3. See, for example, U.S. Pat. Nos. 7,169,610; 7,109,032; 7,037,721 ; 6,617, 161 ;
- Cells in culture can be maintained either in suspension or attached to a solid support, such as extracellular matrix components.
- Stem cells and/or progenitor cells often require additional factors that encourage their attachment to a solid support, such as type I and type II collagen, chondroitin sulfate, fibronectin, "superfibronectin” and fibronectin-like polymers, gelatin, poly-D and poly-L- lysine, thrombospondin and vitronectin.
- Stem cells and/or progenitor cells can also be cultured in low attachment flasks such as but not limited to Corning Low attachment plates.
- the stem cells and/or progenitor cells can be cultured in a multi-phase (e.g., three-phase) culture system, in which the composition of grown factors varies during the course of cell growth and differentiation.
- a multi-phase culture system in which the composition of grown factors varies during the course of cell growth and differentiation.
- IL-3, SCF, and EPO can be used at the early stage, SCF and EPO used at the intermediate stage, and EPO used at the last stage of cell growth and differentiation.
- the stem cells and/or progenitor cells are cultured in the presence of at least 1.0 unit/ml EPO, at least 1.2 units/ml EPO, at least 1.4 units/ml EPO, at least 1.6 units/ml EPO, at least 1.8 units/ml EPO, at least 2.0 units/ml EPO, at least 2.2 units/ml EPO, at least 2.4 units/ml EPO, at least 2.6 units/ml EPO, at least 2.8 units/ml EPO, at least 3.0 units/ml EPO, at least 3.2 units/ml EPO, at least 3.4 units/ml EPO, at least 3.6 units/ml EPO, at least 3.8 units/ml EPO, or at least 4.0 units/ml EPO.
- the stem cells and/or progenitor cells are cultured in the presence of at least 1 ng/ml IL-3, at least 2 ng/ml IL-3, at least 3 ng/ml IL-3, at least 4 ng/ml IL-3, at least 5 ng/ml IL-3, at least 6 ng/ml IL-3, at least 7 ng/ml IL-3, at least 8 ng/ml IL-3, at least 9 ng/ml IL-3, at least 10 ng/ml IL-3, at least 11 ng/ml IL-3, at least 12 ng/ml IL-3, at least 13 ng/ml IL-3, at least 14 ng/ml IL-3, at least 15 ng/ml IL-3, at least 16 ng/ml IL-3, at least 17 ng/ml IL-3, at least 18 ng/ml IL-3, at least 19 ng/ml IL-3
- the stem cells and/or progenitor cells are cultured in the presence of at least 1 ng/ml SCF, at least 2 ng/ml SCF, at least 3 ng/ml SCF, at least 4 ng/ml SCF, at least 5 ng/ml SCF, at least 6 ng/ml SCF, at least 7 ng/ml SCF, at least 8 ng/ml SCF, at least 9 ng/ml SCF, at least 10 ng/ml SCF, at least 15 ng/ml SCF, at least 20 ng/ml SCF, at least 25 ng/ml SCF, at least 30 ng/ml SCF, at least 35 ng/ml SCF, at least 40 ng/ml SCF, at least 45 ng/ml SCF, at least 50 ng/ml SCF, at least 55 ng/ml SCF, at least 60 ng/ml SCF, at least 65 ng/m
- HSCs are cultured in the presence of IL-3, SCF, EPO, human AB plasma, human AB serum, transferrin, heparin, and insulin.
- compositions comprising RBC
- the methods described herein can increase the amount of RBCs by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, or at least 500%, as compared to a method using the same population of stem cells and/or progenitor cells without any SH2B3 inhibition.
- the methods described herein can increase the quality of RBCs by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, or at least 500%, as compared to a method using the same population of stem cells and/or progenitor cells without any SH2B3 inhibition.
- the quality of RBCs is considered to be increased when the percentage of enucleated RBCs is increased, the frequency of RBCs having appropriate markers of maturation is increased, hemoglobinization is improved, or combinations thereof. Markers of maturation include surface expression of CD235a (glycophorin A), rhesus antigen, CD44, and a variety of other blood types expressed on mature red blood cells.
- the methods described herein can increase the rate of RBCs towards maturation by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, or at least 500%, as compared to a method using the same population of stem cells and/or progenitor cells without any SH2B3 inhibition.
- the method as disclosed herein comprises contacting the HSPCs with a SH2B3 antagonist for a pre-determined period of time. In some embodiments, the method as disclosed herein comprises contacting the HSPCs with a SH2B3 antagonist for the pre-determined times of at least about 2 hrs, or at least about 4 hours, or at least about 8 hours, or at least about 10 hours, or at least about 12 hours, or between 12-24 hours, or between 24-32 hours, or between 32-48 hours, or between 1-2 days, or between 3-4 days or longer than 4 days.
- the contacting occurs for a pre-selected period of time prior to, or during phase 1 (day 1-7) differentiation, i.e., in the presence of a culure media comprising heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL-3), and at least one SH2B3 antagonist.
- the contacting occurs prior to, or during phase 1 (day 1-7) differentiation, i.e., in the presence of a culure media comprising heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL- 3), and at least one SH2B3 antagonist.
- the SH2B3 antagonist contacts the HSPCs for a pre-selected period of time prior to, or during phase 2 (day 7-day 12) differentiation, i.e., in the presence of a culture media comprising heparin, holo-transferrin, erythropoietin (Epo), and stem cell factor (SCF)), and at least one SH2B3 .
- a culture media comprising heparin, holo-transferrin, erythropoietin (Epo), and stem cell factor (SCF)
- the SH2B3 antagonist contacts the HSPCs for a pre-selected period of time prior to, or during phase 3 (day 12 - day 18) differentiation, i.e., in the presence of a culure media comprising heparin, holo-transferrin and erythropoietin (Epo)), and at least one SH2B3 antagonist.
- the population of mature RBCs is produced in 7 to 21 days. In some embodiments, the population of mature RBCs is produced in 7 to 18 days. In some embodiments, the population of mature RBCs is produced in 7 to 16 days. In some embodiments, the population of mature RBCs is produced in 7 to 14 days. In some embodiments, the population of mature RBCs is produced in 7 to 12 days. In some embodiments, the population of mature RBCs is produced in less than 7 days.
- the methods and compositions as disclosed herein comprise RBC generated by the methods as disclosed herein.
- the present invention encompasses an admixture of RBC in combination with the pluripotent stem cells or progenitor cells (i.e., HSPCs) from which they were derived, and in some embodiments, the admixture comprises less than about 25%, or less than about 20%, or less than about 15%, or less than about 13%, or less than about 12%, or less than about 1 1%, or less than about 10%, or less than about 9%, or less than about 8%, or less than about 7%, or less than about 6%, or less than about 5%, or less than about 4%, or less than about 3%, or less than about 2%, or less than about 1% of stem cells and/or progenitor cells in the total cell population of the admixture.
- RBC are the majority cell type in the admixture population of cells.
- the methods produce a cell population described herein, or an admixture described herein comprises at least about 99%, or at least about 98%, or at least about 97%, or at least about 96%, or at least about 95%, or at least about 94%, or at least about 93%, or at least about 92%, or at least about 91%, or at least about 90%, or at least about 89%, or at least about 87%, or at least about 86%, or at least about 85%, or at least about 84%, or at least about 83%, or at least about 82%, or at least about 81%, or at least about 80%, or at least about 79%, or at least about 78%, or at least about 77%, or at least about 76%, or at least about 75%, or at least about 74%, or at least about 73%, or at least about 72%, or at least about 71%, or at least about 70%, or at least about
- RBCs produced using the methods and compositions as described herein can be stored in a blood bank.
- the RBC are present in a cryopreservation media or storage medium.
- the RBC are stored at +4°C or colder, e.g., -20°C in an appropriate storage media.
- the blood bank can provide a large pool of available RBCs, that can be utilized in a variety of therapeutic, as well as research, applications.
- the stored RBCs can serve, for example, as a source of RBCs for use in the future when health reasons require blood transfusion, e.g., when the subject is to undergo a surgery and/or is in need of a blood transfusion at a later date (e.g., undergoing a bone marrow transplant, etc.).
- the RBCs can be banked for sporting purposes, e.g., for blood transfusion prior to a sporting event.
- the stored RBCs can also serve as a source of cells for autologous use, for example, for future treatments of the donor.
- the stored RBCs can also serve as a source of cells for future treatments of a relative of the donor.
- the stored RBCs can also serve as a source of cells for clinical use by other individuals with matched blood type upon authorization from the donor. Blood type compatibility is shown in Table 1.
- the methods and compositions described herein can be used to produce RBCs for rare blood types, e.g., Duffy-negative blood.
- the methods and compositions described herein can be used to produce RBCs for a subject who changes blood type during his/her lifetime, e.g., a subject who is type A and receives type O bone marrow transplant.
- Storage conditions for RBCs are well known in the art.
- Routine blood storage is 42 days or 6 weeks for stored packed RBCs. Methods for prolonged storage of RBC are well known in the art, and are described in US patents 4,585,735, 4,675,185, 4,943,287, 5,789,151, 6,150,085, 8,071,282, 8,968,992, US patent Applications 2012/0329036, 2001/0049089, 2014/0091047, 2015/0190309, 2014/0086892, which are incorporated herein in their entireties by reference.
- a cell cuture media comprising RBCs produced using the methods as disclosed herein and at least one SH2B3 inhibitor as disclosed herein.
- a cell cuture media comprising RBCs and at least one SH2B3 antagonist.
- the SH2B3 is a siRNA agent.
- the composition comprises a culture media comprising media for phase 1 (day 1-7) differentitaion (comprising heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL-3), and at least one SH2B3 antagonist.
- the composition comprises a culture media comprising media for phase 2 (day 7-day 12) differentiation (comprising heparin, holo-transferrin, erythropoietin (Epo), and stem cell factor (SCF)), and at least one SH2B3 .
- the composition comprises a culture media comprising media for phase 3 (day 12 - day 18) differentiation (comprising heparin, holo-transferrin and erythropoietin (Epo)), and at least one SH2B3 antagonist.
- RBCs can be isolated using known methods in the art. For example, RBCs can be isolated by leukocyte filtration or flow cytometric sorting. In some embodiments, the RBCs can be collected based on positive selection for the CD235a marker and negative selection for the CD71 marker.
- RBCs are isolated using leukocyte filtration.
- leukocyte filtration almost all nucleated cells are removed by the use of a filter, so a substantially pure population of RBCs can be obtained.
- Leukocyte filtration is a useful method for large scale RBC isolation.
- RBCs produced according to any of the methods described herein can be used in a variety of therapeutic applications.
- the use of RBC transfusions for patients in need of such treatment for a variety of reasons and disorders is well known in the art, and approaches are standard medical practice.
- the RBCs described herein and/or produced according to the methods of the present disclosure can be used to treat patients using the same approaches and conditions currently used for blood transfusions.
- the present disclosure relates to methods of treatment, prevention, or diagnosis of a disease or disorder characterized by a deficiency of red blood cells by administering a population of red blood cells of the present disclosure, or prepared according to any of the methods of the present disclosure, to a subject having a disorder characterized by a deficiency of red blood cells.
- a "deficiency of red blood cells” refers to a subject that has an amount of red blood cells that is from about 20% to about 900% lower than the amount of red blood cells in a subject having a normal amount of red blood cells; or has an amount of red blood cells that is from about 10 times to about 1,000 times lower than the amount of red blood cells in a subject having a normal amount of red blood cells.
- disorders characterized by a deficiency of red blood cells may include, without limitation, anemia (e.g., congenital anemia, aplastic anemia, pernicious anemia, iron deficiency anemia, sickle cell anemia, spherocytosis, hemolytic anemia, Aceruloplasminemia, Adenosine deaminase increased activity, Adenylate kinase deficiency, Aldolase deficiency, Alpha-thalassaemia— trait or carrier, Atransferrinemia, Autosomal dominant sideroblastic anemia, Autosomal recessive sideroblastic anemia, Beta-thalassaemia— trait or carrier, Beta-thalassaemia major (and intermedia), CDA with thrombocytopenia (GATA I mutation), Compound heterozygous sickling disorders, Congenital acanthocytosis, Congenital dyserythropoietic anaemia type I, Congenital dyserythropoietic
- Phosphofructokinase deficiency Phosphoglycerate kinase deficiency, Pyrimidine 5 nucleotidase deficiency, Pyruvate kinase deficiency, Sickle cell anemia, Sickle cell trait, Sideroblastic anemia associated with ataxia, SLC25A38-related Sideroblastic anemia, Thiamine-responsive megaloblastic anemia, Triose phosphate isomerase deficiency, Unstable haemoglobin, Wolfram Syndrome, and X-linked sideroblastic anemia), Gaucher's disease, hemolysis, neutropenia, thrombocytopenia, granulocytopenia, hemophilia, Hodgkin's lymphoma, Non-Hodgkin's lymphoma, B cell chronic lymphoma, Burkitt's lymphoma, Follicular-like lymphoma, diffused large B-cell lymphoma, multiple myeloma
- the disorder characterized by a deficiency of red blood cells results from (partially or fully) one or more of chemotherapy, chemical exposure, radiation therapy, and/or radiation exposure.
- a population of red blood cells produced by any method of the present disclosure is co-administered with chemotherapy and/or radiation therapy or one or more protein of interest.
- a population of red blood cells of the present disclosure, and/or produced according to any method of the present disclosure is administered to or transfused into a subject in need thereof, e.g., suffering from a loss of blood.
- a loss of blood may be the result of for example, internal or external bleeding, hemorrhage, accident, trauma, or surgery, among others.
- Treatment with one or more of the population of red blood cells of the present disclosure may also be useful for some infectious diseases associated with hemorrhage, such as but not limited to, families of R A viruses (Arenaviridae, Bunyaviridae, Filoviridae, and Flaviviridae) that are linked to viral hemorrhagic fever.
- families of R A viruses Alignaviridae, Bunyaviridae, Filoviridae, and Flaviviridae
- viral hemorrhagic fevers including but are not limited to, Lassa fever, Ebola, Marburg, Rift Valley fever, dengue, and yellow fever.
- red blood cells described herein and/or prepared according to any method of the present disclosure are administered to an individual.
- sustained transfusion of the produced population of red blood cells is administered to the individual.
- red blood cells adapted to be a delivery system for one or more proteins of interest of the present disclosure. Any methods of adapting red blood cells to be a delivery system for proteins known in the art and disclosed herein may be used.
- Any disease disorder and/or condition known in the art and disclosed herein that would benefit from treatment with a disclosed protein of interest may be treated with the methods of the present disclosure, including, without limitation, subjects in need of hematopoietic growth factors, acute inflammatory conditions, cytokine storm conditions, clinical signs associate with cytokine storms, cancer, vascular dysregulation (e.g., frost bite, cancer-related vasoconstriction, or rheumatic joints, etc), acute cardiac infarctions, obstetrical uses during child delivery, acute and/or persistent migraine headaches, subjects in need of an immunity booster, subjects at high risk of having clots, subjects at elevated risk for pulmonary embolisms, cardiovascular diseases, immune diseases and/or disorder, and autoimmune diseases and/or disorders.
- hematopoietic growth factors e.g., acute inflammatory conditions, cytokine storm conditions, clinical signs associate with cytokine storms, cancer, vascular dysregulation (e.g., frost bite, cancer-related vaso
- Exemplary modes of administration of RBCs to a subject for use in the methods described herein include, but are not limited to, injection.
- injection includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrasternal injection and infusion.
- parenteral administration refers to modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrasternal injection and infusion.
- Kits for generating a population of RBC from stem cells and/or progenitor cells using inhibitors of SH2B3 are also provided herein.
- the kit comprises: (a) a first container comprising a SH2B3 antagonist; (b) a second container comprising necessary growth factors for phase 1 (day 1-day 7) maturation of RBC from stem cells or progenitor cells, comprising: heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL-3; (c) a third second container comprising necessary growth factors for phase 2 (day 7-day 12) maturation of RBC from stem cells, comprising: heparin, holo-transferrin, erythropoietin (Epo), and stem cell factor (SCF); (d) a fourth container comprising necessary growth factors for phase 3 (day 12-day 18) maturation of RBC from stem cells or progenitor cells comprising;
- individual components in the first, second or third or fourth container can be in a form of powder, e.g., lyophilized powder.
- the powder can be reconstituted upon use.
- individual components in the first, second or third container can be in a form of liquid.
- the kit can further comprise one or more containers of basal cell culture medium (e.g., in a form of powder or in liquid).
- the powder can be reconstituted in an aqueous solution (e.g., water) upon use.
- cell culture basal media examples include, but are not limited to, IMDM, Minimum Essential Medium (MEM), Eagle's Medium, Dulbecco's Modified Eagle Medium (DMEM), Dulbecco's Modified Eagle Medium: Nutrient Mixture F-12 (DMEM F12), F- 10 Nutrient Mixture, Ham's F- 10 Nutrient Mix, Ham's F12 Nutrient Mixture, Medium 199, RPMI, RPMI 1640, reduced serum medium, basal medium (BME), DMEM/F12 (1 : 1), and the like, and combinations thereof.
- the kit further comprises serum, e.g., human AB plasma, human AB serum.
- the kit comprises antiobiotics, e.g., penicillin and/or streptomycin.
- the kit can further comprise one or more vials of pluripotent stem cells or other stem cells, e.g., hematopoietic cells including CD34+ cells.
- the kit can further comprise a cell culture device.
- a cell culture device include, but are not limited to, a transwell, a microwell, a microfluidic device, a bioreactor, a culture plate, or any combinations thereof.
- the kit can further comprise a microfluidic device.
- the microfluidic device can be an organ-on-a-chip device.
- the organ-on-a-chip device can be a device as described in the International Pat. App. No. WO 2015/138034, and WO2015/138032 and/or in U.S. Patent No. US 8,647,861, the contents of each of which are incorporated herein by reference in their entirety.
- the first channel and the second channel can be of substantially equal (e.g., within 10% or within 5% or less) heights or of different heights.
- the height ratio of the first channel to the second channel can range from about 2: 1 to about 10: 1. In some embodiments, the height ratio of the first channel to the second channel can be about 5: 1.
- the kit can further comprise one or more containers each containing a detectable label that specifically binds to a pluripotency marker, or a rbc marker.
- the kit can further comprise instructions for using the kit to perform generation of rbc from pluripotent stem cells or progenitor cells according to the methods as disclosed herein.
- a method of producing red blood cells (RBCs) ex vivo from a population of stem cells and/or progenitor cells comprising:
- the genome-editing agent is selected from the group consisting of a Zinc-Finger Nuclease (ZFN), a Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR associated (Cas) system, and a Transcription Activator-Like Effector Nuclease (TALEN).
- ZFN Zinc-Finger Nuclease
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- Cas CRISPR associated
- TALEN Transcription Activator-Like Effector Nuclease
- the antagonist of SH2B3 is selected from the group consisting of an inorganic molecule, an organic molecule, a nucleic acid, a nucleic acid analog or derivative, a peptide, a peptidomimetic, a protein, an antibody or an antigen-binding fragment thereof, and combinations thereof.
- RNAi agent is a siRNA, shRNA, dsRNA that hybridizes to SH2B3 mRNA.
- the population of stem cells and/or progenitor cells is selected from the group consisting of hematopoietic stem cells, hematopoietic progenitor cells, pluripotent stem cells, induced pluripotent stem cells (iPSCs), embryonic stem cells, and combinations thereof.
- the population of stem cells and/or progenitor cells is derived from peripheral blood mononuclear cells, cord blood, bone marrow, cord tissue, or G-CSF mobilize peripheral blood of the donor subject.
- An admixture comprising a population of RBCs and a population of stem cells and/or progenitor cells, wherein the RBCs are produced according to the method of any of paragraphs 1-19.
- a blood bank comprising a population of RBCs according to paragraph 21.
- a cell culture media comprising a population of stem cells and/or progenitor cells, at least one RBC differentiated from at least one stem cell or progenitor cell, and an antagonist of SH2B3.
- a method of administering a population of RBCs to a subject comprising administering an effective amount of RBCs to the subject, wherein the RBCs have been contacted ex vivo or in vitro with an effective amount of an antagonist of SH2B3, wherein the antagonist of SH2B3 decreases the activity of the SH2B3 protein or decreases SH2B3 mRNA or protein levels.
- a method of administering a population of RBCs to a subject comprising administering an effective amount of RBCs to the subject, wherein the RBCs are produced from a population of stem cells and/or progenitor cells having been contacted ex vivo or in vitro with an effective amount of a genome-editing agent, wherein the genome-editing agent excises the SH2B3 gene from at least one stem cell or progenitor cell.
- a cell culture media comprising: a population of stem cells and/or progenitor cells, and at least one antagonist of SH2B3, wherein the cell culture media is selected from;
- phase 1 differentation media comprising heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL-3); or
- phase 2 (day 7-day 12) differentiation media comprising comprising heparin, holo- transferrin, erythropoietin (Epo), and stem cell factor (SCF); or
- phase 3 (day 12 - day 18) differentiation media comprising heparin, holo-transferrin and erythropoietin (Epo).
- a cell culture media comprising: at least one RBC and at least one antagonist of SH2B3, wherein the cell culture media is selected from;
- phase 1 differentation media comprising heparin, holo-transferrin, erythropoietin (Epo), stem cell factor (SCF) and IL-3); or
- phase 2 (day 7-day 12) differentiation media comprising comprising heparin, holo- transferrin, erythropoietin (Epo), and stem cell factor (SCF); or
- phase 3 (day 12 - day 18) differentiation media comprising heparin, holo-transferrin and erythropoietin (Epo).
- 293T cells were kept in DMEM supplemented with 10% FBS and 1% penicillin/streptomycin at 30% - 90% confluency.
- 293T cells were transfected with the constructs described below along with the VSV-G envelope and pdA8.9 packaging vector using the Fugene 6 reagent (Roche) according to the manufacturer's protocol.
- Medium was changed to phase 1 primary cell culture medium (without EPO, IL-3 and SCF) the following day and viral supernatant collected and filtered at 45 microns at 48 h post transfection.
- TF-1 human erythroid cells were cultured in RPMI media supplemented with 10% FBS and 2 ng/ml GM-CSF for maintenance and 1% penicillin/streptomycin. For cytokine starvation, all cytokines were removed and cells were maintained in FBS only overnight. EPO and SCF were added at time 0 and then subsequent time points were collected for analysis.
- CD34+ cells from G-CSF mobilized peripheral blood, bone marrow, or cord blood was purified by positive magnetic selection using an Ultrapure Microbead Kit (Miltenyi Biotech) according to the manufacturer's protocol following mononuclear cell purification on a Ficoll Density Gradient. At least 95% purity was reached as assessed by post-purification flow cytometry with a PE conjugated anti-human CD34 antibody (8012-0349, eBioscience) as described below.
- phase 1 (day 0 - 7) cells were cultured at a density of 10 5 - 10 6 cells per milliliter (mL) in IMDM supplemented with 2% human AB plasma, 3% human AB serum, 1% penicillin/streptomycin, 3 IU/mL heparin, 10 ug/mL insulin, 200 ug/mL holo-transferrin, 1 IU erythropoietin (Epo), 10 ng/mL stem cell factor (SCF) and 1 ng/mL IL-3.
- phase 2 (day 7 - 12), IL-3 was omitted from the medium.
- phase 3 (day 12 - 18), cells were cultured at a density of 10 6 cells per milliliter, with both IL-3 and SCF omitted from the medium and the holo-transferrin concentration was increased to 1 mg/mL. Cells were cultured at 37°C and 5% C0 2 .
- medium was changed on day 1 to viral supernatant along with 8 ug/mL polybrene and EPO, IL-3, and SCF and spun at 2000 rpm for 90 min at room temperature. After 12 hours of infection, cells were placed in 1 ug/mL puromycin for 36-48 hours.
- the inventors also developed an adaptation of the erythroid culture method described above by adding an expansion phase lasting a total of 5 days prior to initiation of erythroid differentiation and starting phase 1 of the culture. Recent work has shown that such an approach can result in significant expansion of erythroid cells and can improve mature RBC production (Lee et al., 2015). Similar to those reported findings, the inventors discovered that this allows for increased expansion and comparable differentiation as our standard 3-phase culture method. During the expansion phase >85% of cells remain CD34+.
- the expansion medium was composed of StemSpan II serum free expansion medium (Stem Cell Technologies) and IX CCIOO cytokine mix composed of FLT3L, IL-3, IL-6, and SCF (Stem Cell
- l- 2 x l0 6 cells were harvested on day 9 of culture, washed twice in PBS, and resuspended in RIPA buffer (50mM Tris-HCl, 150 mM NaCl, 0.1 % SDS, 1 % NP-40, 0.25% sodium deoxycholate) and lysed in the presence of sodium orthovanadate, protease inhibitor cocktail, and PMSF for 30 min on ice with intermittent mixing. After removal of cell debris by centrifugation, the supernatant was transferred to a new tube and the protein concentration was determined mixed with Loading Dye and incubated at 95°C for 5 min.
- RIPA buffer 50mM Tris-HCl, 150 mM NaCl, 0.1 % SDS, 1 % NP-40, 0.25% sodium deoxycholate
- HRP- coupled antibodies served as secondary reagents.
- shRNA constructs targeting SH2B3 were used with the following sequences: sh83
- MFI Mean fluorescent intensities
- pellets were resuspended in FACS- Buffer and samples were analysed on a Canto 2 (BD Bioscience) flow cytometer, the emission for EMA was detected in the PE channel at 564 -606 nm.
- Microarrays (GeneChip Human Gene 2.0 ST Arrays, Affymetrix) were performed on erythroblasts (day 7 of differentiation) for SH2B3 KD (sh83 and sh84) and control samples (shLuc).
- Raw files were processed and normalized using the RMA algorithm from the oligo package in R 3.2 (Carvalho and Irizarry, 2010).
- Differential expression analyses were conducted using limma (Ritchie et al., 2015).
- a heatmap is displayed for normalized expression values (Z-score) of genes that were significantly up- regulated in SH2B3 KD at a log2 fold change greater than 0.5 and a p-value threshold of 0.001.
- GSEA Gene set enrichment analysis
- gRNA was used: 5'- GTGTGCACCACCGGACCTCCTGG -3 ' (SEQ ID NO: 3)
- hESCs were initially cultured in mTeSRl supplemented with penicillin/streptomycin on Geltrex matrix coated tissue culture plates. Cells were dissociated using Accutase at the presence of ROCKi and subsequently 10 million single cells were electroporated with 25 ug of each plasmid in a single cuvette. Cells were replated and after 48-72 hours treated with accutase, collected, and resuspended in PBS. EGFP expressing cells were sorted by FACS (FACSAria II, BD Bioscience) and plated at 15,000 cells/plate in growth medium and allowed to recover for 7- 10 days.
- FACS FACS
- hESCs were maintained in six-well tissue culture plates containing 0.75-1.0 X 10 6 mouse embryonic fibroblasts (MEFs) in daily exchanged HES medium containing DMEM supplemented with 20% KSR, 100 uL nonessential amino acids solution, 50 U/mL penicillin, 50 g/mL streptomycin, 2 mM glutamine, 1 mM sodium pyruvate, 0.075 sodium bicarbonate, and 0.1 mM beta-mercaptophenol at a maximum confluency of 90% at 37°C and 5% CO 2 .
- MEFs mouse embryonic fibroblasts
- hESCs were harvested as described above and replated onto Matrigel coated dishes at a density of 1-1.5 X 10 5 per milliliter in HES medium containing 5 ng/mL bFGF and 10 uM ROCKi at 37°C, 5% C0 2 , 5% 0 2 and 90 % N 2 . Every 24 h cells were fed by replacing with fresh medium excluding ROCKi.
- HPCs hematopoietic progenitor cells
- HPCs were spun at 335 X g, resuspended in erythroid expansion medium (EEM) containing SFD supplemented with 50 ug/ml Ascorbic Acid, 0.45 mM MTG, 50 ng/ml SCF and 2 units/ml EPO. Media was exchanged every 1-2 days. Cells were carefully counted with a hematocytometer and analyzed by flow cytometry at indicated time points.
- EEM erythroid expansion medium
- Multipotent and pluripotent stem cells are potential sources for cell and tissue replacement therapies.
- stem cell-derived red blood cells RBCs
- RBCs red blood cells
- the inventors demonstrate that application of insight from human population genetic studies can enhance RBC production from stem cells.
- the inventors have discovered that the SH2B3 gene encodes a negative regulator of cytokine signaling and naturally occurring loss-of-function variants in this gene increase RBC counts in vivo.
- Targeted suppression of SH2B3 in primary human hematopoietic stem and progenitor cells enhanced the maturation and overall yield of in- vzYro-derived RBCs.
- the inventors demonstrate that inactivation of SH2B3 by CRISPR/Cas9 genome editing in human pluripotent stem cells allowed enhanced erythroid cell expansion with preserved differentiation.
- genome editing approaches can be used to improve cell and tissue production for regenerative medicine.
- SH2B3 is an SH2-and PH-domain-containing protein that negatively regulates hematopoietic cytokine signaling. Mice with null mutations in SH2B3 have normal hemoglobin and RBC counts, suggesting human-specific functions in RBC production (erythropoiesis) (Bersenev et al., 2008; Velazquez et al., 2002).
- the rs3184504 variant associated with increased RBC counts and hemoglobin levels is thought to be a hypomorphic allele (McMullin et al., 201 1 ; van der Harst et al.,
- the inventors also utilized an adaptation of a recently described culture approach incorporating a progenitor expansion step with adult CD34+ HSPCs (Lee et al., 2015; Ludwig et al., 2014; Sankaran et al., 2011). In this case, the inventors discovered an even greater increase in expansion and overall yield of RBCs of 5- to 7-fold (FIG. 14B), demonstrating the generalizability of SH2B3 suppression to augment RBC production from HSPCs.
- the inventors next assessed the mechanisms through which suppression of SH2B3 is able to augment erythroid differentiation and expansion.
- SH2B3 negatively regulates signaling downstream of multiple cell surface signaling receptors implicated in erythro-poiesis, including EPO, KIT, and integrin receptors (Gery and Koeffler, 2013; McMullin et al., 201 1). Accordingly, phosphorylation of STAT5 and KIT receptor and the expression of early EPO responsive genes were enhanced by SH2B3 suppression (FIG. 15C and FIG. 15D) (Moraga et al., 2015). The inventors verified the importance of both the EPO and KIT/SCF pathways for the observed augmentation upon SH2B3 suppression by limiting the concentration of both cytokines in the HSPC differentiation cultures (FIG. 15E).
- SH2B3 suppression allowed erythroid expansion similar to the baseline control, with reduced levels of either EPO or SCF, highlighting the role of SH2B3 in both pathways in primary erythroid cells.
- SH2B3 knock-out or inhibition appears to facilitate erythroid expansion and maturation by augmenting both the EPO and KIT signaling pathways.
- RBC membrane disorders of the RBC membrane, such as hereditary spherocytosis, are clinically diagnosed by variation in binding of the dye eosin-5- maleimide (EMA) (Perrotta et al., 2008).
- EMA dye eosin-5- maleimide
- the inventors discovered that EMA staining was comparable between the SH2B3 LoF RBCs and controls, suggesting normal formation of the RBC cytoskeleton (FIG. 9).
- surface expression of RBC antigens, including the Rh blood group (FIG. 16A) and CD44, and activity of the cytoplasmic pyruvate kinase enzyme were similar between the SH2B3 LoF RBCs and controls (FIG. 16B).
- RBC ghosts from the SH2B3 knock-out and control cells showed identical protein patterns, providing an independent metric for normal RBC maturation (FIG. 16C).
- the inventors also discovered normal hemoglobin subunits present in the RBCs with a small increase in fetal hemoglobin (HbF) production with SH2B3 shRNA knock-out, consistent with the known increase in HbF observed with acceleration at the early stages of erythropoiesis (FIG. 16D) (Sankaran and Orkin, 2013).
- HbF fetal hemoglobin
- PSCs can be readily differentiated toward the erythroid lineage with well-established protocols (Huang et al., 2015; Kobari et al., 2012; Mills et al., 2014; Slukvin, 2013; Sturgeon et al., 2014) (FIG. 16E).
- the inventors have also used CRISPR/Cas9-mediated genome editing to engineer isogenic hESC lines with either homozygous frame-shift deletions in SH2B3 or intact WT alleles (FIG. 16E and 16F) (Ding et al., 2013a, 2013b; Gupta and Musunuru, 2014; Veres et al., 2014).
- the hESCs were differentiated in vitro to generate multipotent hematopoietic progenitor cells (HPCs) with erythroid, megakaryocyte, and myeloid potential (Kennedyet al., 2012; Mills et al., 2014; Sturgeon et al., 2013) (FIG.
- the inventors demonstrate that by perturbing the SH2B3 gene, e.g., inhibiting SH2B3 function can be used to improve the ability of stem-cell-derived hematopoietic progenitors to expand and differentiate into the erythroid lineage.
- the inventors demonstrate herein that the improvement of both expansion and differentiation by inhibiting SH3B3 surpasses the maximal expansion that could normally be achieved by simply optimizing cytokine concentrations in such cultures, which illustrates the complementary benefit of targeting intrinsic regulatory pathways.
- the increase in yields resulting from SH2B3 suppression allows RBCs to be produced from HSPCs at an estimated cost that is less than one-fifth of current approaches and with fewer starting stem cells.
- Diamond-blackfan anemia in vitro response of erythroid progenitors to the ligand for c-kit. Blood 78, 2198-2202.
- Adzhubei I.A., Schmidt, S., Peshkin, L., Ramensky, V.E., Gerasimova, A., Bork, P., Kondrashov, A.S., and Sunyaev, S.R. (2010). A method and server for predicting damaging missense mutations. Nat Methods 7, 248-249.
- Genome Analysis Toolkit a MapReduce framework for analyzing next-generation DNA sequencing data. Genome Res 20, 1297-1303.
- Cyclin D3 coordinates the cell cycle during differentiation to regulate erythrocyte size and number. Genes Dev. 26, 2075-2087. Sankaran, V.G., Menne, T.F., Scepanovic, D., Vergilio, J.A., Ji, P., Kim, J., Thiru, P., Orkin, S.H., Lander,
- MicroR A-15a and -16-1 act via MYB to elevate fetal hemoglobin expression in human trisomy 13. Proc. Natl. Acad. Sci. USA 108, 1519-1524.
- Velazquez L., Cheng, A.M., Fleming, H.E., Furlonger, C, Vesely, S., Bernstein, A., Paige, C.J., and
Landscapes
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Epidemiology (AREA)
- Developmental Biology & Embryology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Diabetes (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2017527898A JP2017536826A (ja) | 2014-11-24 | 2015-11-24 | 幹細胞および/または前駆細胞からの赤血球産生を改善するためのsh2b3の調節 |
| CN201580074325.7A CN107429231A (zh) | 2014-11-24 | 2015-11-24 | 调节sh2b3以改善来自干细胞和/或祖细胞的红细胞的产生 |
| US15/529,220 US20170355958A1 (en) | 2014-11-24 | 2015-11-24 | Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells |
| EP15863890.8A EP3224350A4 (en) | 2014-11-24 | 2015-11-24 | Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462083439P | 2014-11-24 | 2014-11-24 | |
| US62/083,439 | 2014-11-24 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016085934A1 true WO2016085934A1 (en) | 2016-06-02 |
Family
ID=56074950
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/062333 Ceased WO2016085934A1 (en) | 2014-11-24 | 2015-11-24 | Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20170355958A1 (https=) |
| EP (1) | EP3224350A4 (https=) |
| JP (1) | JP2017536826A (https=) |
| CN (1) | CN107429231A (https=) |
| WO (1) | WO2016085934A1 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107663515A (zh) * | 2016-07-28 | 2018-02-06 | 苏州方舟基因药业有限公司 | 一种定向制备人红细胞的方法及制剂 |
| JP2020516301A (ja) * | 2017-04-10 | 2020-06-11 | ウニベルジテート ロストック ツェントラーレ ウニベルジテーツフェアヴァルトゥング リフェラート 1.1 レヒト | 骨髄応答および免疫応答の予測のためのsh2bアダプタータンパク質3 |
| EP3930731A4 (en) * | 2019-02-26 | 2022-11-23 | Rambam Med-Tech Ltd. | CELLS AND METHODS FOR IMPROVED IMMUNOTHERAPY |
| US11708559B2 (en) | 2017-10-27 | 2023-07-25 | The Children's Hospital Of Philadelphia | Engineered red blood cells having rare antigen phenotypes |
| CN119535779A (zh) * | 2025-01-23 | 2025-02-28 | 浙江农林大学 | 空间频域成像中结构光漫反射图案仿真模型的构建方法 |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| DE102018125324A1 (de) * | 2018-10-12 | 2020-04-16 | Universität Rostock | Verfahren zur Vorhersage einer Antwort auf die Therapie von Krankheiten |
| WO2021257802A1 (en) * | 2020-06-19 | 2021-12-23 | The Children's Medical Center Corporation | Compositions and methods for red blood cell differentiation |
| CN112143697B (zh) * | 2020-10-08 | 2021-08-06 | 宁波希诺赛生物科技有限公司 | 一种促进胚胎干细胞增殖和分化的方法 |
| CN113025579A (zh) * | 2021-04-22 | 2021-06-25 | 河南农业大学 | 一种稳定敲低猪abhd16a基因的ST-KDABHD16A细胞系及其构建方法 |
| CN116640728B (zh) * | 2023-07-24 | 2023-10-20 | 呈诺再生医学科技(北京)有限公司 | RO8191和AS2863619在诱导产生表达成人型β珠蛋白的脱核红细胞中的应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140093913A1 (en) * | 2012-08-29 | 2014-04-03 | Sangamo Biosciences, Inc. | Methods and compositions for treatment of a genetic condition |
| US20140328811A1 (en) * | 2011-08-01 | 2014-11-06 | Alnylam Pharmaceuticals, Inc. | Method for improving the success rate of hematopoietic stem cell transplants |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011071085A1 (ja) * | 2009-12-08 | 2011-06-16 | 国立大学法人東京大学 | 多能性幹細胞から分化誘導された細胞の生産方法 |
-
2015
- 2015-11-24 JP JP2017527898A patent/JP2017536826A/ja active Pending
- 2015-11-24 EP EP15863890.8A patent/EP3224350A4/en not_active Withdrawn
- 2015-11-24 US US15/529,220 patent/US20170355958A1/en not_active Abandoned
- 2015-11-24 CN CN201580074325.7A patent/CN107429231A/zh not_active Withdrawn
- 2015-11-24 WO PCT/US2015/062333 patent/WO2016085934A1/en not_active Ceased
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140328811A1 (en) * | 2011-08-01 | 2014-11-06 | Alnylam Pharmaceuticals, Inc. | Method for improving the success rate of hematopoietic stem cell transplants |
| US20140093913A1 (en) * | 2012-08-29 | 2014-04-03 | Sangamo Biosciences, Inc. | Methods and compositions for treatment of a genetic condition |
Non-Patent Citations (2)
| Title |
|---|
| KAWAKAMI ET AL.: "A small interfering RNA targeting Lnk accelerates bone fracture healing with early neovascularization.", LAB INVEST., vol. 93, no. 9, September 2013 (2013-09-01), pages 1036 - 1053, XP055448010 * |
| TONG ET AL.: "Lnk inhibits erythropoiesis and Epo -dependent JAK2 activation and downstream signaling pathways.", BLOOD, vol. 105, no. 12, 15 June 2005 (2005-06-15), pages 4604 - 4612, XP002616844 * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107663515A (zh) * | 2016-07-28 | 2018-02-06 | 苏州方舟基因药业有限公司 | 一种定向制备人红细胞的方法及制剂 |
| JP2020516301A (ja) * | 2017-04-10 | 2020-06-11 | ウニベルジテート ロストック ツェントラーレ ウニベルジテーツフェアヴァルトゥング リフェラート 1.1 レヒト | 骨髄応答および免疫応答の予測のためのsh2bアダプタータンパク質3 |
| US12286668B2 (en) | 2017-04-10 | 2025-04-29 | Universität Rostock | SH2B adapter protein 3 for the prediction of bone marrow response and immune response |
| US11708559B2 (en) | 2017-10-27 | 2023-07-25 | The Children's Hospital Of Philadelphia | Engineered red blood cells having rare antigen phenotypes |
| US12123020B2 (en) | 2017-10-27 | 2024-10-22 | The Children's Hospital Of Philadelphia | Engineered red blood cells having rare antigen phenotypes |
| EP3930731A4 (en) * | 2019-02-26 | 2022-11-23 | Rambam Med-Tech Ltd. | CELLS AND METHODS FOR IMPROVED IMMUNOTHERAPY |
| US12551559B2 (en) | 2019-02-26 | 2026-02-17 | Rambam Med-Tech Ltd. | Cells and methods for improved immunotherapy |
| CN119535779A (zh) * | 2025-01-23 | 2025-02-28 | 浙江农林大学 | 空间频域成像中结构光漫反射图案仿真模型的构建方法 |
| CN119535779B (zh) * | 2025-01-23 | 2025-05-06 | 浙江农林大学 | 空间频域成像中结构光漫反射图案仿真模型的构建方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3224350A4 (en) | 2018-06-20 |
| EP3224350A1 (en) | 2017-10-04 |
| JP2017536826A (ja) | 2017-12-14 |
| CN107429231A (zh) | 2017-12-01 |
| US20170355958A1 (en) | 2017-12-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20170355958A1 (en) | Modulation of sh2b3 to improve red blood cell production from stem cells and/or progenitor cells | |
| US20230285538A1 (en) | Efficacious mrna vaccines | |
| JP7542441B2 (ja) | 癌を治療するための方法及び組成物 | |
| JP7356354B2 (ja) | 細胞の操作のための材料及び方法並びに免疫腫瘍学におけるその使用 | |
| JP6974349B2 (ja) | ヘモグロビン異常症の処置のための材料及び方法 | |
| EP3416689B1 (en) | Materials and methods for treatment of severe combined immunodeficiency (scid) or omenn syndrome | |
| JP2021503885A (ja) | 末梢血からの末梢血リンパ球(pbl)の拡大培養 | |
| JP2016522679A (ja) | CRISPR/Cas系を用いたゲノム編集の治療的使用 | |
| KR20210143952A (ko) | 히스톤 h3-리신 트리메틸레이션 제거에 의한 인간 체세포 핵 이식 (scnt) 효율을 증가시키는 방법 및 조성물, 및 인간 nt-esc의 유도 | |
| WO2018020323A2 (en) | Materials and methods for treatment of fatty acid disorders | |
| JP2014526887A (ja) | 造血幹細胞移植の成功率を改善する方法 | |
| WO2013036282A2 (en) | Downregulation of inflammatory micrornas by ilt3 | |
| JP2024519029A (ja) | Pd-1遺伝子編集された腫瘍浸潤リンパ球及び免疫療法におけるその使用 | |
| JP2025512401A (ja) | 特定のサイトカインの組み合わせ及び/またはAKTi処理を使用したTIL拡張プロセス | |
| TW202346573A (zh) | 細胞介素相關之腫瘤浸潤性淋巴球組合物及方法 | |
| WO2019150196A1 (en) | Materials and methods for treatment of hemoglobinopathies | |
| JP2013541520A (ja) | 幹細胞および/または前駆細胞を動員するための方法 | |
| JP2024509184A (ja) | 腫瘍保存及び細胞培養組成物 | |
| TW202535433A (zh) | 活化素A受體1C型(ACVR1C)iRNA組成物及其使用方法 | |
| WO2023233342A2 (en) | Gene-edited natural killer cells | |
| EP2270137A1 (en) | Method for producing cells having characteristic of hematopoietic stem cells/progenitor cells | |
| JP2025503987A (ja) | ペイロードを発現するように操作された腫瘍浸潤リンパ球 | |
| JP2024512029A (ja) | T細胞共培養効力アッセイのための方法及び組成物、ならびに細胞療法製品との使用 | |
| US20250241954A1 (en) | Gene-edited natural killer cells | |
| JP2025537155A (ja) | Cd39/cd103選択に関連した腫瘍浸潤リンパ球(til)拡張のための方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15863890 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2017527898 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015863890 Country of ref document: EP |