WO2016079597A1 - Humanized tau antibodies in alzheimer's disease - Google Patents
Humanized tau antibodies in alzheimer's disease Download PDFInfo
- Publication number
- WO2016079597A1 WO2016079597A1 PCT/IB2015/002610 IB2015002610W WO2016079597A1 WO 2016079597 A1 WO2016079597 A1 WO 2016079597A1 IB 2015002610 W IB2015002610 W IB 2015002610W WO 2016079597 A1 WO2016079597 A1 WO 2016079597A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- binding fragment
- chain variable
- variable region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2814—Dementia; Cognitive disorders
- G01N2800/2821—Alzheimer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/50—Determining the risk of developing a disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/70—Mechanisms involved in disease identification
- G01N2800/7047—Fibrils-Filaments-Plaque formation
Definitions
- the present invention is in the fields of biochemistry, molecular biology, and
- Alzheimer's disease diagnosis, prevention, and treatment Provided herein are humanized antibodies against human tau that are capable of discriminating between normal (healthy) and pathological (disease-associated) tau.
- AD Alzheimer's disease
- the disease leads to deficits in cognitive function and declines in memory, learning, language, and in the ability to perform intentional and purposeful movements.
- AD Alzheimer-related disease
- Plaques are composed mainly of ⁇ amyloid ( ⁇ ), whereas tangles comprise pathological forms of tau, such as pathological tau conformers and their aggregates.
- ⁇ amyloid
- tau pathological tau
- a recognized role for tau in AD pathology has been demonstrated in numerous studies. For example, Braak showed that the closest correlate for AD neurodegeneration was the presence of tau tangles, and not of amyloid plaques (Braak, H., et a!. Neuropathological stageing of Alzheimer-related changes. Acta Neuropathol 82:239 - 259 (1991)).
- Tau belongs to a family of intrinsically disordered proteins, characterized by the absence of a rigid three-dimensional structure in their physiological environment (Skrabana et a!., 2006).
- tau truncation and hyperphosphorylation can cause pathological transformations from an intrinsically disordered state to multiple soluble and insoluble misdisordered structures, including paired helical filaments (PHFs) and other aggregates (Wischik, CM., Novak, M., Edwards, P.C., Klug, A., Tichelaar, W., Crowther, R.A. (1988).
- Neurodegener Dis 7: 24-27 These structural changes lead to a toxic gain of function, to a loss of physiological function of the native protein, or both (Zilka et al., 2008; Kovacech B, Novak M. (2010). Tau truncation is a productive posttranslational modification of neurofibrillary degeneration in Alzheimer's disease. Curr Alzheimer Res Dec;7(8):708-16); Kovacech B, Skrabana R, Novak M. (2010). Transition of tau protein from disordered to misordered in Alzheimer's disease. Neurodegener Dis 7; 24-27). ).
- Tau's physiological function is in mediating the assembly of tubulin monomers into microtubules that constitute the neuronal microtubules network (Buee, L, Bussiere, T., Buee-Scherrer, V., Delacourte, A., Hof, P.R. (2000). Tau protein isoforms, phosphorylation and role in neurodegenerative disorders. Brain Research. Brain Research Reviews. 33, 95-130). Tau binds to microtubules through repetitive regions located in the C-terminal portion of the protein. Butner KA, Kirschner MW. 1991. Tau protein binds to microtubules through a flexible array of distributed weak sites.
- tau's pathological and physiological functions appear to be influenced by the specific structural conformation, and the intrinsically disordered structure, adopted by the full length protein isoforms and their fragments.
- Kontsekova et al. described a conformational region (encompassing residues 297- IKHVPGGGSVQIVYKPVDLSKVTSKCGSL-325 (SEQ ID NO: 145 ) within certain truncated tau molecules which had a significant relationship to the function of those truncated tau molecules on microtubule assembly (WO 2004/007547).
- tau repeats are believed to participate in the formation of pathological tau aggregates and other structures.
- PHFs pathological paired helical filaments
- the pronase resistant core of pathological paired helical filaments consists of the microtubule binding regions of 3- and 4-repeat tau isoforms (Jakes, R., Novak, M., Davison, M., Wischik, CM. (1991 ). Identification of 3- and 4-repeat tau isoforms within the PHF in Alzheimer's disease. EMBO J 10, 2725-2729; Wischik, et al.
- a minimal-tau peptide/interaction motif (306-VQIVYK-311 ; SEQ ID NO: 146), as well as a second site on tau (275-VQIINK-280) (SEQ ID NO: 147), which form beta-sheets and are described as potentially responsible for initiating the formation of PHFs, a pathological tau aggregate (von Bergen M, Friedhoff P, Biernat J, Heberle J, Mandelkow EM, Mandelkow E. 2000. Assembly of tau protein into Alzheimer paired helical filaments depends on a local sequence motif ((306)VQIVYK(31 1 )) forming beta structure. Proc Natl Acad Sci U S A 97: 5129- 5134); EP 1214598; WO 2001/18546). See Fig. 2 for a functional map of tau.
- tau is considered an intracellular cytoplasmic protein
- intracellular tau can be released into the extracellular space and contribute to neurodegeneration (Gomez-Ramos, A., Diaz-Hernandez, M., Cuadros, R., Hernandez, F., and Avila, J. (2006). Extracellular tau is toxic to neuronal cells. FEBS Lett 580(20), 4842-50). Indeed, neuronal loss has been linked to the topographic distribution of neurofibrillary tangles (made up of tau protein) in AD brains (West, M.J., Coleman, P.D., Flood, D.G., Troncoso, J.C. (1994).
- extracellular tau has been described as "ghost tangles" in the brain (Frost, B., Diamond, M.I. (2009). The expanding realm of prion phenomena in neurodegenerative disease. Prion 3(2):74- 7), indicating that intracellular tau is released into extracellular space.
- extracellular tau aggregates can enter cells and stimulate fibri!lization of intracellular tau, further seeding tau monomer for production of pathological tau aggregates (Frost et a!., 2009).
- First-in-man tau vaccine targeting structural determinants essential for pathological tau-tau interaction reduces tau oligomerisation and neurofibrillary degeneration in an Alzheimer's disease model.
- An increased understanding of the molecular mechanisms underlying the pathological transformations of tau has opened up the possibility of specifically targeting pathological modifications of tau for therapeutic purposes.
- Humanized antibodies are designed, primarily, to retain the specificity and affinity of the parent antibody while having human constant regions, which ideally would present less of an immunogenic target to the patient.
- the typical humanized antibody carries the complementarity determining regions (CDRs) of a parent antibody of mouse or rat origin, and framework (FR) and constant regions that are mostly of human origin but have often been mutated to retain the parent antibody's binding properties.
- CDRs complementarity determining regions
- FR framework
- antigen-binding affinity and specificity are not the only factors affecting the biological activity and clinical success of an antibody. Improving an antibody's activation of the patient's immune system is key to the value of some humanized antibodies, whereas for others reduction of cellular-mediated toxicity is a goal.
- an increased understanding of antibody structure and activity allows researchers to engineer, often through mutations, more advanced humanized antibodies that are more homogeneous with better antigen binding properties (binding affinity, target specificity), effector functions, stability, expression level, purification properties, pharmacokinetics, and pharmacodynamics. Many of these improvements are important for the commercial viability of a given antibody.
- a humanized anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs. 1 , 2, 3, respectively, and a framework from human immunoglobulin M65092 (SEQ ID NO. 71 ; a light chain variable region comprising CDR-L1 , CDR-L2, and CDR-L3 of SEQ ID NOs. 4,5, 6, respectively, and a framework from human immunoglobulin X72449 (SEQ ID NO. 65; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- Such antibody and binding fragment is also contemplated in a form, wherein heavy chain position 9 is occupied by P, position 21 is occupied by P, position 27 is occupied by Y, position 28 is occupied by I, position 30 is occupied by T, position 38 is occupied by K, position 48 is occupied by I, position 67 is occupied by K, position 68 is occupied by A, position 70 is occupied by L, and/or position 95 is occupied by F.
- the light chain position 5 is occupied by S. In some embodiments, only two of these 1 1 positions are occupied as such. In some embodiments, only three of these 1 1 positions are occupied as such. In some embodiments, only four of these 11 positions are occupied as such.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is selected from that of RHA through RHM, SEQ ID NOs. 13-25, respectively; and the sequence of the light chain variable region is SEQ ID NO. 26 (RKA).
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is selected from that of RHA through RHM SEQ ID NOs. 13-25, respectively; and the sequence of the light chain variable region is SEQ ID NO. 27 (RKB).
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 13, RHA, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA. In some embodiments, the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 15, RHC, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 18, RHF.and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 19, RHG, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 20, RHH, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 21 , RHI, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 22, RHJ, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 23, RHK, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA. In some embodiments, the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 24, RHL, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 13, RHA, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 15, RHC, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 18, RHF, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 19, RHG, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB. In some embodiments, the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 20, RHH, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 21 , RHI, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 22, RHJ, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 23, RHK, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 24, RHL, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM, and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 26, RKA, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 26, RKA, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 26, RKA, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM, the sequence of the light chain variable region is SEQ ID NO. 26, RKA, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- a humanized anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises:
- a light chain variable region comprising CDR-L1 , CDR-L2, and CDR-L3 of SEQ ID NOs. 4, 5, 6, respectively, and a framework from human immunoglobulin X72449 (SEQ ID NO. 65); and heavy chain and light chain constant regions from a human immunoglobulin, preferably lgG1 or lgG4.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of any one of SEQ ID NO. 28-40; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of any one of SEQ ID NO. 43-55; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of any one of SEQ ID NO. 43-55; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 31 ; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 32; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 31 ; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). in some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 32; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 46; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150), In some embodiments, the antibody binds ail three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 47; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 46; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an anti-tau antibody or a tau-binding fragment thereof, wherein said antibody or binding fragment comprises the following complete chains: a heavy chain having the amino acid sequence of SEQ ID NO. 47; and
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs 1 , 2, 3, and being at least 85% identical to any one of SEQ ID NO. RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, i.e., SEQ ID NOs. 13-25;
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds one or two epitopes chosen from
- the antibody binds all three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs 1 , 2, 3, and being at least 90% identical to any one of SEQ ID NO:RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, I.e., SEQ ID NOs. 13-25;
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds one or two epitopes chosen from
- the antibody binds all three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs 1 , 2, 3, and being at least 95% identical to any one of SEQ ID NO:RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, i.e., SEQ ID NOs. 13-25;
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds one or two epitopes chosen from
- the antibody binds all three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized.
- Such antibody and binding fragment is also contemplated in a form, wherein heavy chain position 9 is occupied by P, position 21 is occupied by P, position 27 is occupied by Y, position 28 is occupied by I, position 30 is occupied by T, position 38 is occupied by K, position 48 is occupied by I, position 67 is occupied by K, position 68 is occupied by A, position 70 is occupied by L, and/or position 95 is occupied by F.
- the light chain position 5 is occupied by S. In some embodiments, only two of these 11 positions are occupied as such. In some embodiments, only three of these 11 positions are occupied as such. In some embodiments, only four of these 1 1 positions are occupied as such.
- only five of these 11 positions are occupied as such. In some embodiments, only six of these 11 positions are occupied as such. In some embodiments, only seven of these 1 1 positions are occupied as such. In some embodiments, only eight of these 11 positions are occupied as such. In some embodiments, only nine of these 11 positions are occupied as such. In some embodiments, only ten of these 11 positions are occupied as such. In some embodiments, all 11 of these 11 positions are occupied as such.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150), In some embodiments, the antibody binds all three epitopes.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs. 1 , 2, 3, and being at least 85% identical to any one of SEQ ID NO:RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, i.e., SEQ ID NOs. 13-25;
- the antibody antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds ail three epitopes.
- the antibody is chimeric.
- the antibody is humanized.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs. 1 , 2, 3, and being at least 90% identical to any one of SEQ ID NO:RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, i.e., SEQ ID NOs. 13-25;
- the antibody antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150),
- the antibody binds all three epitopes.
- the antibody is chimeric.
- the antibody is humanized.
- an antibody comprising:
- a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs. 1 , 2, 3, and being at least 95% identical to any one of SEQ ID NO:RHA, SEQ ID RHB, SEQ ID RHC, SEQ ID RHD, SEQ ID RHE, SEQ ID RHF, SEQ ID RHG, SEQ ID RHH, SEQ ID RHI, SEQ ID RHJ, SEQ ID RHL, SEQ ID RHM, i.e., SEQ ID NOs. 13-25;
- the antibody antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds ail three epitopes.
- the antibody is chimeric.
- the antibody is humanized.
- Such antibody and binding fragment is also contemplated in a form, wherein heavy chain position 9 is occupied by P, position 21 is occupied by P, position 27 is occupied by Y, position 28 is occupied by I, position 30 is occupied by T, position 38 is occupied by K, position 48 is occupied by I, position 67 is occupied by K, position 68 is occupied by A, position 70 is occupied by L, and/or position 95 is occupied by F.
- the light chain position 5 is occupied by S. In some embodiments, only two of these 1 1 positions are occupied as such. In some embodiments, only three of these 11 positions are occupied as such. In some embodiments, only four of these 11 positions are occupied as such.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- an antibody in all the previous paragraphs of this section (Summary of the Description), wherein said antibody or binding fragment is a Fab, Fab', F(ab')2, Fd, scFv, (scFv) 2 , or scFv-Fc.
- said antibody or binding fragment is a Fab, Fab', F(ab')2, Fd, scFv, (scFv) 2 , or scFv-Fc.
- such an antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds all three epitopes.
- the present disclosure also provides or contemplates an antibody in the previous paragraphs of this section, wherein said antibody or binding fragment is an lgG1 , lgG2, lgG3, or igG4 antibody.
- said antibody or binding fragment is an lgG1 , lgG2, lgG3, or igG4 antibody.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the present disclosure also provides or contemplates an antibody in the previous paragraphs of this section, wherein said antibody or binding fragment is an lgG1 antibody.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the present disclosure also provides or contemplates an antibody in the previous paragraphs of this section, wherein said antibody or binding fragment binds to Tau 151 -391 /4R with an affinity (K D ) of at least 5x10 "7 .
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds ail three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized. In some embodiments, the binding affinity is measured by SPR. In some embodiments, the binding affinity is measured by ELISA.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody or binding fragment binds to tau with at least 80% of the same binding affinity, substantially the same binding affinity, or better binding affinity, than the DC8E8 antibody secreted by hybridoma PTA- 11994, deposited at the American Type Culture Collection.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds all three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized. In some embodiments, the binding affinity is measured by SPR. In some embodiments, the binding affinity is measured by ELISA.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody competes for binding to tau, at at least one of the same epitope(s), with the DC8E8 antibody secreted by hybridoma PTA-11994, deposited at the American Type Culture Collection.
- said antibody competes for binding to tau, at at least one of the same epitope(s), with the DC8E8 antibody secreted by hybridoma PTA-11994, deposited at the American Type Culture Collection.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes. In some embodiments, the antibody is chimeric. In some embodiments, the antibody is humanized.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody is recombinantly produced.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150).
- the antibody binds all three epitopes.
- the antibody is chimeric.
- the antibody is humanized.
- the antibody and binding fragment of the previous four paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment of the first four of the previous five paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment of the first four of the previous six paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment of the first four of the previous seven paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment of the first four of the previous eight paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region Is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment of the first four of the previous nine paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment of the first four of the previous ten paragraphs are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment of the first four of the previous eleven paragraphs are also such that the sequence of the heavy chain variable region Is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody is recomblnantly produced in a Chinese Hamster Ovary (CHO) cell line.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody or binding fragment contains an Fc region that has been modified to alter effector function, half-life, proteolysis, and/or glycosylation.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA,
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the present disclosure also provides or contemplates an antibody in the previous paragraphs of this section, wherein said antibody or binding fragment is modified to modulate a functional characteristic selected from the group consisting of antibody- dependent cellular cytotoxicity, complement-dependent cytotoxicity, serum half-life, biodistribution, and binding to Fc receptors.
- the antibody binds one or two epitopes chosen from HQPGGG (SEQ ID NO: 148), HVPGGG (SEQ ID NO: 149), and HKPGGG (SEQ ID NO: 150). In some embodiments, the antibody binds all three epitopes.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region Is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the present disclosure also provides or contemplates an antibody as in the previous paragraphs of this section, wherein said antibody has a thermostability temperature equal to or greater than 69°C.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- composition comprising one of the antibodies and/or binding fragments of the present disclosure and another component.
- composition comprising the antibody or binding fragment as described in this section and a pharmaceutically acceptable carrier, diluent, excipient, or stabilizer.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- composition comprises a lyophilized powder of the antibody or binding fragment.
- compositions wherein the composition is formulated for infusion or subcutaneous administration.
- compositions further comprising a second therapeutic agent (also called combinations).
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the !gG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the therapeutic agent and the antibody or binding fragment are chemically conjugated.
- the second therapeutic agent is useful in the prophylaxis and/or treatment of AD.
- the second therapeutic agent be selected from, for example, beta-amyloid peptides (e.g., N-terminal amyloid beta peptides), which might or might not be conjugated to other compounds, such as mutated diphtheria toxin; other anti-tau antibodies, antibodies against beta-amyloid, such as bapineuzumab, solaneuzumab, gantenerumab, crenezumab, and IVIG
- beta-amyloid peptides e.g., N-terminal amyloid beta peptides
- other anti-tau antibodies antibodies against beta-amyloid, such as bapineuzumab, solaneuzumab, gantenerumab, crenezumab, and IVIG
- immunoglobulin other immunization therapies targeting Abeta oligomers, compounds preventing the hyperphosphorylation of tau, compounds preventing tau oligomerization and aggregation or depolymerize tau oligomers (e.g.
- methylthioninium, rember or LMTX methylthioninium, rember or LMTX
- other active and passive immunization therapies targeting tau aggregates and any pharmaceutically acceptable salts thereof.
- the second therapeutic agent be selected from amyloid- beta aggregation inhibitors (e.g., Tramiprosate), gamma-secretase inhibitors (e.g., semagacestat), and gamma-secretase modulators (tarenflurbil); and any pharmaceutically acceptable salts thereof.
- amyloid- beta aggregation inhibitors e.g., Tramiprosate
- gamma-secretase inhibitors e.g., semagacestat
- gamma-secretase modulators e.g., gamma-secretase modulators
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the igG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype. In some embodiments, the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the second therapeutic agent is selected from
- acetylcholinesterase inhibitors ⁇ e.g., donepezii, rivastigmine, galantamine, tacrine, nutritive supplements), N-Methyl-D-aspartate (NMDA) receptor antagonists (e.g., memantine), inhibitors of DNA repair (e.g., pirenzepine or a metabolite thereof), transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of anti- mitochondrial dysfunction drugs, neurotrophins, inhibitors of heat shock proteins, inhibitors of Lipoprotein-associated phospholipase A 2 , memantine, an anti-apoptotic compound, a metal chelator, an inhibitor of DNA repair, 3-amino-1 -propanesulfonic acid (3APS), 1 ,3-propanedisulfon
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ iD NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lg ⁇ 34 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- compositions wherein the second therapeutic agent is selected from compounds described in WO 2004/058258 (see especially pages 16 and 17) including therapeutic drug targets (page 36-39), alkanesulfonic acids and alkanolsulfuric acids (pages 39-51), cholinesterase inhibitors (pages 51-56), NMDA receptor antagonists (pages 56-58), estrogens (pages 58-59), non-steroidal antiinflammatory drugs (pages 60-61), antioxidants (pages 61-62), peroxisome proliferators-activated receptor (PPAR) agonists (pages 63-67), cholesterol-lowering agents (pages 68-75); amyloid inhibitors (pages 75-77), amyloid formation inhibitors (pages 77-78), metal chelators (pages 78-79), anti-psychotics and anti-depressants (pages 80-82), nutritional supplements (pages 83-89) and compounds increasing the availability of biologically active substances in the brain (see pages 89-93) and
- compositions wherein the second therapeutic agent is selected from compounds preventing tau oligomerization and aggregation and compounds that depolymerize tau oligomers (e.g. methylthioninium, rember or LMTX).
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 Isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the disclosure provides a diagnostic reagent comprising the antibody or binding fragment according to any one of claims 1-51 and a carrier, diluent, excipient, or stabilizer.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. RHB and the sequence of the light chain variable region is SEQ ID NO. RKA
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO, 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the disclosure provides an immunoconjugate having the formula (A)-(L)-(C), wherein: (A) is an antibody or binding fragment thereof of any one of claims 1-51 ; (L) is a linker; and (C) is an agent; and wherein said linker (L) links (A) to (C).
- (C) is a therapeutic agent, an imaging agent, a detectable agent, or a diagnostic agent. In some cases, (C) is a therapeutic agent
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 26, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the igG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14 RHB and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16 RHD and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17 RHE and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25 RHM and the sequence of the light chain variable region is SEQ ID NO. 26 RKA.
- the antibody and binding fragment are of the lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG1 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, the sequence of the light chain variable region is SEQ ID NO. 27, RKB, and the constant region is of the lgG4 isotype.
- nucleic acid molecules RNA or DNA
- nucleic acid molecules comprise one or more of nucleic acid sequences chosen from SEQ ID NOs. 96-124, 141-142, and 127-140
- nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 85% identical to any one of SEQ ID NOs. 96-124, 141- 142, and 127-140.
- nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 90% identical to any one of SEQ ID NOs.
- nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 95% identical to any one of SEQ ID NOs. 96-124, 141-142, and 127-140. In other embodiments, such nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 96% identical to any one of SEQ ID NOs. 96-124, 141-142, and 127- 140. In other embodiments, such nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 97% identical to any one of SEQ ID NOs.
- nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 98% identical to any one of SEQ ID NOs. 96-124, 141- 142, and 127-140. In other embodiments, such nucleic acid molecules comprise one or more of nucleic acid sequences chosen from sequences that are at least 99% identical to any one of SEQ ID NOs. 96-124, 141-142, and 127-140.
- the disclosure contemplates a nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau- binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of anyone of SEQ ID NO: RHA through SEQ ID NO. RHM, i.e., SEQ ID NOs. 13-25.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- the antibody or fragment thereof comprises a heavy chain further comprising an igG4 constant region.
- a nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 26, RKA, or SEQ ID NO. 27, RKB.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- the disclosure contemplates a nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau- binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of anyone of SEQ ID NO: RHA through SEQ ID NO. RHM, i.e., SEQ ID NOs. 13-25.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG4 constant region.
- a nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 26, RKA, or SEQ ID NO. 27, RKB.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 14, RHB.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 16, RHD.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucieic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 17, RHE.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 25, RHM.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 14, RHB.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 16, RHD.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- Hi an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 17, RHE.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 25, RHM.
- the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- any of the nucleic acid molecules just described in this section is such that the antibody or fragment thereof comprises a heavy chain further comprising an lgG1 constant region.
- a nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 26, RKA.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: RKB.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: 26, RKA.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is identical to the amino acid sequence of SEQ ID NO: RKB.
- the antibody or fragment thereof comprises a heavy chain further comprising a kappa constant region.
- the nucleic acid sequence encodes the HCVR of any one of SEQ ID NO. 13-25 (RHA through RHM).
- the nucleic acid sequence encodes the HCVR of SEQ ID NO. 14, RHB.
- the nucleic acid sequence encodes the HCVR of SEQ ID NO. 16, RHD
- the nucleic acid sequence encodes the HCVR of SEQ ID NO. 17, RHE.
- the nucleic acid sequence encodes the HCVR of SEQ ID NO. 25, RHM.
- the nucleic acid sequence encodes the LCVR of any one of SEQ ID NO. 26, RKA, and 27, RKB.
- nucleic acid sequence comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (Hi) an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and (iv) an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and wherein said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of anyone of SEQ ID NO: RHA through SEQ ID NO.
- the nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of any one of SEQ ID NO: RHA through SEQ ID NO. RHM (i.e, 96-108), wherein the stringent hybridization conditions comprise hybridization in 5xSSPE, 1% SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid sequence comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (iii) an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO; 2, and (iv) an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and wherein said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO.
- HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (iii)
- the nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO. 97, RHB, wherein the stringent hybridization conditions comprise hybridization in 5xSSPE, 1% SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid sequence comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (iii) an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and (iv) an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and wherein said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO, 16, RHD, and further such that the nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO.
- the stringent hybridization conditions comprise hybridization in 5xSSPE, 1% SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1% SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid sequence comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (iii) an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and (iv) an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and wherein said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO.
- nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO. 100, RHE, wherein the stringent hybridization conditions comprise hybridization in SxSSPE, 1 % SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1% SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid sequence comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.), (ii) an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , (iii) an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and (iv) an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and wherein said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO.
- nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO. 108, RHM, wherein the stringent hybridization conditions comprise hybridization in 5xSSPE, 1 % SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 26, RKA; and further such that the nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO: 109, RKA, wherein the stringent hybridization conditions comprise hybridization in 5xSSPE, 1 % SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- nucleic acid sequence comprises a nucleotide sequence that hybridizes under stringent conditions to a complementary strand of SEQ ID NO: 110, RKB, wherein the stringent hybridization conditions comprise hybridization in 5xSSPE, 1 % SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- stringent hybridization conditions comprise hybridization in 5xSSPE, 1 % SDS, IxDenhardts solution at 65°C and washing in 2xSSC, 1 % SDS and subsequently with 0.2xSSC at 65°C.
- a population of nucleic acid molecules comprising a first nucleic acid molecule and a second nucleic acid
- the first nucleic acid molecule is a nucleic acid molecule comprising a nucleotide sequence encoding a heavy chain variable region (HCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3
- said HCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of anyone of SEQ ID NO: RHA through SEQ ID NO. RHM (i.e., SEQ ID NO.
- the second nucleic acid molecule comprises a nucleotide sequence encoding an LCVR or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO. 65) , (ii) an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4, (iii) an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and (iv) an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
- nucleic acid molecules comprising a first nucleic acid molecule and a second nucleic acid molecule, wherein:
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 26, RKA; and wherein the second nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3.
- nucleic acid molecules comprising a first nucleic acid molecule and a second nucleic acid molecule, wherein:
- nucleic acid molecule comprising a nucleotide sequence encoding a light chain variable region (LCVR) or a tau-binding fragment thereof of an anti-tau antibody, wherein said LCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin X72449 (SEQ ID NO.
- an LCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 4
- an LCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 5
- an LCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 6, and wherein said LCVR or fragment thereof comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 27, RKB; and wherein the second nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody, wherein said HCVR or fragment thereof comprises: (i) a framework derived from human immunoglobulin M65092 (SEQ ID NO.
- an HCVR CDR1 comprising the amino acid sequence of SEQ ID NO: 1
- an HCVR CDR2 comprising the amino acid sequence of SEQ ID NO: 2
- an HCVR CDR3 comprising the amino acid sequence of SEQ ID NO: 3.
- nucleic acid molecules encoding any of heavy chain variable regions RHA-RHM (SEQ ID NOs 13-25), wherein those nucleic acid sequences are selected from any of SEQ ID NOs. 28-40, respectively, or 43-55, respectively. Any of these nucleic acid molecules can be combined with the nucleic acid molecules of the following paragraph.
- nucleic acid molecules encoding any of light chains RKA or RKB, wherein the nucleic acid molecules is selected from SEQ ID NOs. 57 and 58, respectively. All possible combinations of the nucleic acids disclosed above, that encode an amino acid or tau-binding fragment thereof, a light chain variable, a complete light chain, a heavy chain variable, a complete heavy chain, as disclosed herein, are contemplated.
- nucleic acid populations they comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 14, RHB, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 26, RKA.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 16, RHD, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 26, RKA.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 17, RHE, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 26, RKA.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 25, RHM, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 26, RKA.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ !D NO. 16, RHD, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 27, RKB.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 17, RHE, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 27, RKB.
- these populations comprise a first nucleic acid molecule and a second nucleic acid molecule, wherein the first nucleic acid molecule comprises a nucleotide sequence encoding an HCVR or a tau-binding fragment thereof of an anti-tau antibody of SEQ ID NO. 14, RKB, and the second nucleic acid molecule comprises a nucleotide sequence encoding a LCVR or a tau-binding fragment thereof of SEQ ID NO. 27, RKB.
- Host cells comprising any of these vectors are also contemplated.
- the host cell is prokaryotic.
- the host cell is eukaryotic.
- a host cell comprising any of the population of nucleic acid molecules described above are also contemplated.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or IgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or igG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region Is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB,
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or IgG4 isotype.
- nucleic acids Any of the above contemplated nucleic acids, antibodies, vectors, and host cells, and their respective compositions is contemplated for use as a drug for:
- Alzheimer's Disease or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy;
- AD or another tauopathy slowing progression of AD or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy;
- AD or a related in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy ameliorating the symptoms of AD or a related in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy; and reducing the risk or delaying the onset of AD or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy.
- Another aspect of the present disclosure is a method of producing an antibody or tau-binding fragment thereof that binds to human tau comprising culturing any of the host cells just described so that the nucleic acid is expressed and the antibody or tau-binding fragment thereof produced.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Another aspect contemplates a method of treating Alzheimer's Disease or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy, comprising administering to the subject therapeutically effective amount of a composition comprising any of the antibodies binding fragments described in this section.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Another aspect contemplates a method of promoting clearance of tau aggregates from the brain of a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy, comprising administering to the subject therapeutically effective amount of a composition comprising any of the antibodies binding fragments described in this section.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region Is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Another aspect contemplates a method of slowing progression of AD or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy, comprising administering to the subject therapeutically effective amount of a composition comprising any of the antibodies binding fragments described in this section.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Another aspect contemplates a method of ameliorating the symptoms of AD or a related in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy, comprising administering to the subject a
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26. RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype. Another aspect contemplates a method of treating, preventing, or reversing cognitive in a subject having, suspected of having, or being prone to have Alzheimer's
- composition comprising any of the antibodies or binding fragments described in this section.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Another aspect contemplates a method of reducing the risk or delaying the onset of AD or another tauopathy in a subject having, suspected of having, or being prone to have Alzheimer's Disease or another tauopathy, comprising administering to the subject a therapeutically effective amount of a composition comprising any of the antibodies or binding fragments described in this section.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of these compositions, antibodies, and/or binding fragments is administered via injection. In other embodiments, any of these compositions, antibodies, and/or binding fragments is administered via intravenous infusion.
- any of these compositions, antibodies, and/or binding fragments is administered to said subject at a dose of antibody or binding fragment of 0.1 mg /kg of body weight to 20 mg/kg of body weight and a frequency of between weekly and monthly, thereby treating the subject.
- the antibody or binding fragment is administered at a dose of 0.1 mg /kg of body weight to 10 mg/kg of body weight.
- the antibody or binding fragment is administered over a period of at least three months, preferably at least six months, likely at least twelve months, possibly for twenty four months, at any of these previous doses.
- any of these compositions, antibodies, and/or binding fragments is administered to said subject at a dose of antibody or binding fragment of 0.1 mg /kg of body weight to 10 mg/kg of body weight and a frequency of between weekly and monthly, preferably every two weeks, thereby treating the subject.
- any of these compositions, antibodies, and/or binding fragments is administered to said subject at a dose of antibody or binding fragment of 0.01 mg /kg of body weight to 100 mg/kg of body weight and a frequency of between weekly and monthly, thereby treating the subject
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM, and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 Isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods just described in this section further comprise monitoring the subject for treatment progression by at least one type of assessment selected from the group consisting of Mini-Mental State Exam (MMSE), Alzheimer's Disease Assessment Scale-cognitive (ADAS-COG), Clinician Interview-Based Impression (CIBI), Neurological Test Battery (NTB), Disability Assessment for Dementia (DAD), Clinical Dementia Rating-sum of boxes (CDR- SOB), Neuropsychiatric Inventory (NPI), Positron Emission Tomography (PET Imaging) scan, and Magnetic Resonance Imaging (MRI) scan.
- the type of assessment is a Neurological Test Battery (NTB).
- NTB Neurological Test Battery
- the type of assessment is a Mini-Mental State Exam (MMSE)
- MMSE Mini-Mental State Exam
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the practice of any of these methods further comprises administering to said subject, concurrently or sequentially, an effective amount of at least one additional therapeutic agent.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO, 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the additional therapeutic agent is selected from the group consisting of an anti-apoptotic compound, a metal chelator, an inhibitor of DNA repair, 3-amino-1 -propanesulfonic acid (3 APS), 1 ,3- propanedtsulfonate (1.3PDS), a secretase activator, a beta-secretase inhibitor, a gamma-secretase inhibitor, a beta-amyloid peptide, an anti-beta-amyloid antibody, a neurotransmitter, a beta-sheet breaker, an anti-inflammatory molecule, and a choiinesterase inhibitor; and any pharmaceutically acceptable salts thereof.
- an anti-apoptotic compound e.g., a metal chelator, an inhibitor of DNA repair, 3-amino-1 -propanesulfonic acid (3 APS), 1 ,3- propanedtsulfonate (1.3PDS), a secretase activator, a beta-secretase inhibitor, a
- the choiinesterase inhibitor is tacrine, rivastigmine, donepezil, galantamine, or a nutritive supplement; and any
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the IgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or igG4 isotype.
- the additional therapeutic agent is selected from beta-amyloid peptides (e.g., N-terminal amyloid beta peptides), which might or might not be conjugated to other compounds, such as mutated diphtheria toxin; antibodies against beta-amyloid, such as bapineuzumab, solaneuzumab, gantenerumab, crenezumab, ponezumab, and IVIG immunoglobulin, other immunization therapies targeting Abeta oligomers, compounds preventing the hyperphosphorylation of tau, a compound preventing tau oligomerization and aggregation or promoting depolymerization of tau oligomers (e.g. methylthioninium, rember or LMTX) and other active and passive immunization therapies targeting pathological forms of tau (e.g. aggregates); and any pharmaceutically acceptable salts thereof.
- beta-amyloid peptides e.g., N-terminal amyloid beta peptides
- the additional therapeutic agent is selected from amyloid-beta aggregation inhibitors (e.g., Tramiprosate), gamma-secretase inhibitors (e.g., semagacestat), and gamma-secretase modulators (tarenfiurbil); and any pharmaceutically acceptable salts thereof.
- amyloid-beta aggregation inhibitors e.g., Tramiprosate
- gamma-secretase inhibitors e.g., semagacestat
- gamma-secretase modulators e.g., gamma-secretase modulators
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the additional therapeutic agent is selected from acetylcholinesterase inhibitors (e.g., donepezil, rivastigmine, ga!antamine, tacrine, nutritive supplements), N-Methyl-D-aspartate (NMDA) receptor antagonists (e.g., memantine), inhibitors of DNA repair (e.g., pirenzepine or a metabolite thereof), transition metal chelators, growth factors, hormones, non-steroidal anti-inflammatory drugs (NSAID), antioxidants, lipid lowering agents, selective phosphodiesterase inhibitors, inhibitors of tau aggregation, inhibitors of protein kinases, inhibitors of anti- mitochondria!
- acetylcholinesterase inhibitors e.g., donepezil, rivastigmine, ga!antamine, tacrine, nutritive supplements
- NMDA N-Methyl-D-aspartate
- inhibitors of DNA repair e.g., pirenzepine or
- a dysfunction drugs neurotrophics, inhibitors of heat shock proteins, inhibitors of Lipoprotein-associated phosphoiipase A 2 , memantine, an anti-apoptotic compound, a metal chelator, an inhibitor of DNA repair, 3-amino-1-propanesulfonic acid (3APS), 1 ,3-propanedisulfonate (1.3PDS), a secretase activator, a beta- secretase inhibitor, a gamma-secretase inhibitor, a beta-amyloid peptide, a beta- amyloid antibody, a neurotransmitter, a beta-sheet breaker, an anti-inflammatory molecule; and any pharmaceutically acceptable salts thereof.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 Isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB,
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the additional therapeutic agent is selected from BACE inhibitors; muscarinic antagonists; cholinesterase inhibitors; gamma secretase inhibitors; gamma secretase modulators; HMG-CoA reductase inhibitors; nonsteroidal anti-inflammatory agents; N-methyl-D-aspartate receptor antagonists; anti- amyloid antibodies; vitamin E; nicotinic acetylcholine receptor agonists; CB1 receptor inverse agonists or CB1 receptor antagonists; an antibiotic; growth hormone secretagogues; histamine H3 antagonists; AMPA agonists; PDE4 inhibitors; GABA A inverse agonists; inhibitors of amyloid aggregation; glycogen synthase kinase beta inhibitors; promoters of alpha secretase activity; PDE-10 inhibitors, cholesterol absorption inhibitors, and any pharmaceutically acceptable salts thereof.
- the additional therapeutic agent is a second antibody.
- the second antibody is selected from
- bapineuzumab solaneuzumab, gantenerumab, crenezumab, ponezumab, and IVIG immunoglobulin.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the biological sample is a biopsy, a CSF, blood, serum, or plasma sample.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or !gG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or !gG4 isotype.
- the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 14, RHB and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are aisosuch that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHE and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 25, RHM and the sequence of the light chain variable region is SEQ ID NO. 26, RKA.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are also such that the sequence of the heavy chain variable region is SEQ ID NO. 16, RHD and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or !gG4 isotype.
- any of the therapeutic methods described in the previous paragraphs can be practiced with an antibody or tau-binding fragment, wherein the antibody and binding fragment are alsosuch that the sequence of the heavy chain variable region is SEQ ID NO. 17, RHM and the sequence of the light chain variable region is SEQ ID NO. 27, RKB.
- the antibody and binding fragment are of the lgG1 or lgG4 isotype.
- Figure 1 Schematic of six isoforms of human tau
- Figure 2 Schematic functional map of human tau (2N4R); discloses "VQIINK” and “VQIVYK” as SEQ ID NOS 147 and 146, respectively.
- Figure 3 Protein (SEQ ID NO: 8) and DNA sequence (SEQ ID NO: 91) of DC8E8 Kappa Light Chain Variable Region
- Figure 4 Protein (SEQ ID NO: 7) and DNA Sequence (SEQ ID NO: 90) of DC8E8 Heavy Chain Variable Region
- FIG 8 DC8E8 Heavy Chain Humanization Strategy. Structurally important residues (Proline, Cysteine and Asparagine) are highlighted by bold typeface and italicised. Bold underlined residues indicate back-translations to the Mouse Residue. CDR regions are in lowercase letters and indicated by dots in the table header.
- Residues within 4 A of a CDR are indicated by stars in the table header.
- Figure 8 discloses SEQ ID NOS 7, 71 and 13-25, respectively, in order of appearance. Note that SEQ ID NO. 71 (accession number M65092 in the IMGT database) is shown without the leader peptide M DWTWRFLFWAAVTGVQS (SEQ ID NO. 174).
- FIG. 9 DC8E8 Kappa Light Chain Humanization Strategy. Structurally important residues (Proline, Cysteine and Asparagine) are highlighted by bold typeface and italicised. Bold underlined residues indicate back-translations to the Mouse Residue. CDR regions are in lowercase letters and indicated by dots in the table header.
- Figure 10 Binding of humanized and chimeric DC8E8 to Tau 151 -391 /4R.
- Figure 11 Binding of humanized and chimeric DC8E8 to Tau 151-391/4R: RKA Versions.
- Figure 12 Binding of humanized and chimeric DC8E8 to Tau 151 -391 /4R: RKB Versions.
- Figure 13 Binding of humanized and chimeric DC8E8 to Tau 151 -391 /4R: Vk Versions (with chimeric light chain).
- Figure 15 Thermal stability of candidate humanized DC8E8 antibodies: Purified antibodies were heated for 10 min at the indicated temperature, then cooled to 4°C before performing the Tau Binding ELISA.
- Figure 16 Thermal shift analysis of the purified humanized candidate DC8E8 antibodies: Determination of the purified candidate antibodies Tm and comparison to chimeric and murine DC8E8.
- Figure 17 Binding kinetics of DC8E8 antibodies analysed by surface plasmon resonance: KD determination: Murine DC8E8.
- Figure 22 Binding kinetics of DC8E8 antibodies analysed by surface plasmon resonance: K D determination: Humanized DC8E8 RHE/RKB (AX017);
- Figure 24 Fully humanized antibody candidates aggregation analysis: A. AX004 (DA); B. AX005 (EA); C. AX016 (DB); D. AX017 (EB).
- Figure 25 Purified humanized antibody candidates of DC8E8 assessed for solubility: Solubility Profile during concentration.
- Figure 26 Purified humanized antibody candidates of DC8E8 assessed for solubility: Solubility Profile during concentration: Binding activity after concentration.
- Figure 27 Freeze/thaw stress analysis of humanized candidate antibodies.
- Figure 28 Heat induced stress analysis of fully humanized antibody candidates: A. AX004 (DA); B. AX005 (EA); C. AX0016 (DB); D. AX017 (EB).
- Figure 29 Binding of (A) chimeric DC8E8 and (B) mouse DC8E8 to misdisordered truncated tau 151 -391 /4R and physiological tau 2N4R as determined by ELISA. (C) EC50 values of chimeric and mouse antibody for analyzed tau proteins.
- Figure 30 Mouse and chimeric DC8E8 equilibrium association binding constants to misdisordered truncated tau 151-391/4R and full length physiological tau 2N4R were determined by surface plasmon resonance.
- Figure 31 Binding of (A) chimeric DC8E8 and (B) mouse DC8E8 to tau peptides derived from repeat domains of protein tau, determined by ELISA. (C) EC50 values of chimeric and mouse antibody for analyzed tau peptides.
- FIG. 32 Chimeric DC8E8 inhibits pathological tau-tau interaction in in vitro tau fibrillization assay. Misdisordered truncated tau 151 -391 /4R was induced by heparin to undergo a conformational change and fibrilize, extent of which was measured by Thioflavin T fluorescence; chimeric DC8E8 was tested for its ability to prevent the pathological conformational change and tau-tau interaction.
- Figure 33 Binding of humanized leads of DC8E8 (lgG4 isotype) and chimeric DC8E8 to misdisordered tau 151 -391 /4R and full length physiological tau 2N4R, as determined by ELISA.
- A Binding of humanized antibody AX004;
- B Binding of humanized antibody AX005;
- C Binding of humanized antibody AX016;
- D Binding of humanized antibody AX017.
- E Binding of chimeric DC8E8.
- F EC50 values of chimeric DC8E8 and humanized leads AX004, AX005, AX016, AX017 to the analyzed tau proteins.
- Figure 34 Binding of humanized leads of DC8E8 (lgG1 isotype) to misdisordered tau 151 -391 /4R and full length physiological tau 2N4R, as determined by ELISA.
- A Binding of humanized antibody AX004;
- B Binding of humanized antibody AX005;
- C Binding of humanized antibody AX016;
- D Binding of humanized antibody AX017.
- E EC50 values of humanized leads AX004, AX005, AX016, AX017 to the analyzed tau proteins.
- Figure 35 Surface plasmon resonance (SPR) to characterize humanized DC8E8 leads AX004, AX005, AX016, AX017, binding to mis-disordered tau151-391/4R and full length 2N4R.
- SPR Surface plasmon resonance
- Figure 36 Binding of humanized antibodies (of lgG4 isotype) to tau peptides derived from the microtubule-binding repeat region of protein tau, as determined by ELISA.
- A Binding of humanized antibody AX004;
- B Binding of humanized antibody AX005;
- C Binding of humanized antibody AX016;
- D Binding of humanized antibody AX017.
- E Binding of chimeric DC8E8.
- F EC50 values of chimeric DC8E8 and humanized version AX004, AX005, AX016, AX017 for analyzed tau proteins.
- Figure 37 Binding of humanized antibodies (of lgG1 isotype) to tau peptides derived from the microtubule-binding repeat region of protein tau, as determined by ELISA.
- A Binding of humanized antibody AX004;
- B Binding of humanized antibody AX005;
- C Binding of humanized antibody AX016;
- D Binding of humanized antibody AX017.
- E EC50 values of chimeric DC8E8 and humanized version AX004, AX005, AX016, AX017 for analyzed tau proteins.
- Figure 38 Humanized DC8E8 leads inhibit pathological tau-tau interaction in fluorescence-based tau fibrillization assay. Mis-disordered tau 151-391/4R was induced to undergo a conformational change and fibrilize as measured by Thioflavin T fluorescence; humanized antibodies were added to the fibrillization reaction and tested for their ability to prevent the pathological conformational change. All tested humanized antibodies are capable of inhibiting pathological tau-tau aggregation. (A) Inhibition of pathological aggregation induced by humanized DC8E8 leads of lgG4 isotype and (B) inhibition of pathological aggregation induced by humanized antibodies of lgGI isotype.
- FIG 39 Immunohistochemical staining of Alzheimer's disease brain using humanized DC8E8 antibodies (lgG1) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high load of neurofibrillary pathology in the human AD hippocampus (CA1).
- Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8.
- humanized antibodies AX005 (D) and AX017 (F) recognized less pathological structures in AD brain.
- Tool bar 100 ⁇
- Figure 40 Immunohistochemical staining of Alzheimer's disease brain using humanized DC8E8 antibodies (lgG4) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high load of neurofibrillary pathology in the human AD hippocampus (CA1). Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8. In general humanized antibodies AX005 (D) and AX017 (F) recognized less pathological structures in AD brain. Tool bar: 100 m
- FIG 41 Immunohistochemical staining of FTDP-17 brain (tau mutation at R406W) using humanized DC8E8 antibodies (lgG1) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high load of neurofibrillary pathology in the human entorhinal cortex.
- Humanized antibodies AX004 (C) and AX016 (E) displayed the similar staining pattern as DC8E8.
- humanized antibodies AX005 (D) and AX017 (F) recognized less pathological structures in FTDP-17 brain.
- Tool bar ⁇
- Figure 42 Immunohistochemical staining of FTDP-17 brain (tau mutation at R406W) using humanized DC8E8 antibodies (lgG4) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high load of neurofibrillary pathology in the human entorhinal cortex. Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8. AX005 (D) and AX017 (F) did not recognize any pathological structures in FTDP-17 brain. Tool bar: 100 m
- FIG 43 Immunohistochemical staining of corticobasal degeneration using humanized DC8E8 antibodies (lgG1) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high number of glial tau pathology in the human nucleus caudatus.
- Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8. In general humanized antibodies AX005 (D) and AX017 (F) recognized less pathological structures in CBD brain, however the intensity of staining is comparable to DC8E8.
- Tool bar 50 ⁇ Figure 44: Immunohistochemical staining of corticobasal degeneration using humanized DC8E8 antibodies (igG4) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high number of glial tau pathology in the human nucleus caudatus.
- Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8. In general humanized antibodies AX005 (D) and AX017 (F) recognized less pathological structures in CBD brain, however the intensity of staining is comparable to DC8E8.
- Tool bar ⁇
- Figure 45 Immunohistochemical staining of progressive supranuclear palsy using humanized DC8E8 antibodies (lgG1) Both DC8E8 (A) and chimeric DC8E8 (B) recognized high number of glial tau pathology in the human nucleus caudatus.
- Humanized antibodies AX004 (C) and AX016 (E) displayed the same staining pattern as DC8E8.
- humanized antibodies AX005 (D) and AX017 (F) recognized slightly less pathological structures. The intensity of staining is comparable to DC8E8.
- Tool bar 50 ⁇
- Figure 46 Immunohistochemical staining of progressive supranuclear palsy using humanized DC8E8 antibodies (lgG4) Both DC8E8 (A) and chimeric DC8E8 (B) recognizes high number of glial tau pathology in the human nucleus caudatus.
- Tool bar 50 ⁇
- amino acid sequences corresponding to the human tau isoforms are given in SEQ ID NOs. 151-156, respectively, in order of appearance:
- affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the equilibrium dissociation constant (K D ) (or its inverse equilibrium association constant, KA).
- K D equilibrium dissociation constant
- KA inverse equilibrium association constant
- Affinity can be measured by common methods known in the art, including those described herein. See, for example, Pope ME, Soste MV, Eyford BA, Anderson NL, Pearson TW. (2009) J Immunol Methods. 341(1-2):86-96 and methods described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described below.
- amino acid refers to naturally occurring, modified, and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O- phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
- Suitable amino acids include, without limitation, both the D- and L-isomers of the 20 common naturally occurring amino acids found in peptides as well as the naturally occurring and unnaturally occurring amino acids prepared by organic synthesis or other metabolic routes.
- unnaturally occurring amino acids include, but are not limited to, N-acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and O- phosphotyrosine.
- Modified amino acids include, but are not limited to,
- amino acid also includes naturally occurring amino acids that are metabolites in certain organisms but are not encoded by the genetic code for incorporation into proteins. Such amino acids include, but are not limited to, ornithine, D-ornithine, and D-arginine.
- Antibody-dependent cell-mediated cytotoxicity and “ADCC” refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.
- FcRs Fc receptors
- FcR expression on hematopoietic cells in summarized is Table 3 on page 464 of Ravetch and Kinet, Annu. Rev.
- ADCC activity of a molecule of interest may be assessed in vitro, such as that described in U.S. Pat. No. 5,500,362 or U.S. Pat. No. 5,821 ,337.
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
- a “back mutation” is a mutation introduced in a nucleotide sequence which encodes a humanized antibody, the mutation results in an amino acid corresponding to an amino acid in the parent antibody (e.g., donor antibody, for example, a murine antibody). Certain framework residues from the parent antibody may be retained during the humanization of the antibodies of the disclosure in order to substantially retain the binding properties of the parent antibody, while at the same time minimizing the potential immunogenicity of the resultant antibody.
- the parent antibody is of mouse origin.
- the back mutation changes a human framework residue to a parent murine residue.
- framework residues that may be back mutated include, but are not limited to, canonical residues, interface packing residues, unusual parent residues which are close to the binding site, residues in the "Vernier Zone” (which forms a platform on which the CDRs rest) (Foote & Winter, 1992, J. Mol. Biol. 224, 487-499), and those close to CDR H3.
- chimeric antibodies refers to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass (e.g., chimeric humanized, class-switched antibodies), while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et a!., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
- chimeric antibody refers to a monoclonal antibody comprising a variable region, i.e., binding region, from one source or species and at least a portion of a constant region derived from a different source or species, usually prepared by recombinant DNA techniques.
- Chimeric antibodies comprising a murine variable region and a human constant region are sometimes preferred.
- Such murine/human chimeric antibodies are the product of expressed immunoglobulin genes comprising DNA segments encoding murine immunoglobulin variable regions and DNA segments encoding human immunoglobulin constant regions.
- Other forms of "chimeric antibodies" encompassed by the present invention are those in which the class or subclass has been modified or changed from that of the original antibody.
- Such “chimeric” antibodies are also referred to as "class-switched antibodies.”
- Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques now known in the art. See, e.g., Morrison, S. L, et al., Proc. Natl. Acad Sci. USA 81 (1984) 6851-6855; U.S. Pat. Nos. 5,202,238 and 5,204,244.
- immunoglobulin/antibody/binding fragment under testing inhibits specific binding of a reference antibody to a common antigen, such as tau (e.g., tau 151-391/4R).
- tau e.g., tau 151-391/4R
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J, Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct labeled sandwich assay see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)
- solid phase direct label RIA using I 125 label see Morel et a!., Mol. Immunol.
- “Complement dependent cytotoxicity” or “CDC” refers to the ability of a molecule to lyse a target in the presence of complement.
- the complement activation pathway is initiated by the binding of the first component of the complement system (C1q) to a molecule (e.g. an antibody) complexed with a cognate antigen.
- a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
- conjugation refers to a bond or chemical moiety formed from a chemical reaction between a functional group of a first molecule (e.g., an antibody) with a functional group of a second molecule (e.g., a therapeutic agent or drug).
- bonds include, but are not limited to, covalent linkages and non-covalent bonds, while such chemical moieties include, but are not limited to, esters, carbonates, imines phosphate esters, hydrazones, acetals, orthoesters, peptide linkages, and oligonucleotide linkages.
- Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time.
- Hydrophilytically unstable or degradable linkages means that the linkages are degradable in water or in aqueous solutions, including for example, blood.
- Enzymatically unstable or degradable linkages means that the linkages are degraded by one or more enzymes.
- certain PEG and related polymers include degradable linkages in the polymer backbone or in a linker group between the PEG polymer backbone and one or more of the terminal functional groups of protein, polypeptide or peptide provided herein.
- Such degradable linkages include, but are not limited to, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent.
- hydrolytically degradable linkages include but are not limited to carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyi group of a peptide; and oligonucleotide linkages formed by a
- phosphoramidite group including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide
- DC8E8 refers to an antibody described in WO2013/041962 and produced by the hybridoma deposited under American Type Culture Collection Patent Deposit no. PTA-1 1994.
- DC8E8 antibodies that specifically bind to one or more of four previously unidentified functional regions of tau selected from 268-HQPGGG-273 (SEQ ID NO: 148 ) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 149 ) (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (SEQ ID NO: 150) (within 3 rd repeat domain of tau protein), and 362-HVPGGG-367 (SEQ ID NO: 149) (within 4 th repeat domain of tau protein) are capable of inhibiting formation of pathological tau aggregates, and of detecting various pathological forms of tau, some of which are the earliest formed in the disease (e.g., pathological monomers
- Hybridomas produced against human misdisordered tau II (Tau 151-391/4R), which is also referred in this application as tauA(1-150;392-441)/4R, were screened for the production of monoclonal antibodies specific to human paired helical filaments (PHFs) both by immunohistochemistry (IHC) and Enzyme-linked Immuno Assays (ELISAs).
- the resulting set included mouse monoclonal antibody (mAb) DC8E8, which is of the lgG1 subclass.
- Epitope mapping of DC8E8 revealed it to bind four previously unidentified epitopes on human tau.
- further functional analysis of DC8E8 revealed that each epitope represents a distinct functional region within tau.
- regions which were described as novel targets for AD diagnosis and therapy, are comprised within functional regions of tau selected from 268-HQPGGG- 273 (SEQ ID NO: 148 ) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 149 ) (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (SEQ ID NO: 150) (within 3 rd repeat domain of tau protein), and 362-HVPGGG-367 (SEQ ID NO: 149) (within 4 th repeat domain of tau protein).
- diagnosis refers to methods by which the skilled artisan can estimate and even determine whether or not a subject is suffering from a given disease or condition, in this case Alzheimer's disease and related tauopathies.
- the skilled artisan often makes a diagnosis on the basis of one or more diagnostic indicators, such as for example a biomarker, the amount
- DC8E8 is able to discriminate between preclinical AD, clinically incipient AD and fully developed final stage AD (see WO2013/041962).
- DC8E8 displayed staining of early stages (tau monomers, dimers) of pathological tau in human preclinical AD - Braak's Stage I.
- the antibody recognized the stage of pathological tau oligomers and the stage of pathological tau polymers (tangles).
- final stage - Braak's Stage VI In fully developed Alzheimer's disease (final stage - Braak's Stage VI), DC8E8 recognized mainly pathological tau polymers in forms of the neurofibrillary tangles, neuritic plaques and neuritic threads.
- DC8E8 recognized all developmental stages of tangle formation in Alzheimer's disease.
- DC8E8 recognized early developmental stages of tangle formation - monomeric, dimeric and early oligomeric stage, and late oligomeric, pre- tangle stage, as well as late developmental stages of pathological tau polymers - intracellular and extracellular neurofibrillary tangles.
- diagnosis or “making a diagnosis,” as used herein, is further inclusive of making a prognosis, which can provide for predicting a clinical outcome (with or without medical treatment), selecting an appropriate treatment (or whether treatment would be effective), or monitoring a current treatment and potentially changing the treatment, based on the measure of pathological tau levels.
- Antibody effector functions refer to those biological activities attributable to an Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody.
- Examples of antibody effector functions include C1q binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors (e.g. B eel! receptor; BCR).
- epitopes refers to a site on an antigen to which an immunoglobulin or antibody (or antigen binding fragment thereof) specifically binds.
- Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acids, often in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray
- a “conformational epitope” is an epitope to which the antibody or tau-binding fragment thereof binds in a conformational-specific manner.
- the binding can depend on the epitope-carrying-protein's secondary, tertiary, or quaternary structure.
- the antibody binds in a structure- specific manner, a tertiary-structure-specific manner, or a quaternary-structure- specific manner.
- a conformational epitope is one that is present in pathological tau (e.g., present in Tau 151 -391 /4R).
- the antibodies and tau-binding fragments described herein have as their "epitope" any one or more of the foilowing four tau sites, some or all of which are
- conformational epitopes 268-HQPGGG-273 (SEQ ID NO: 148 ) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 149 ) (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (SEQ ID NO: 150) (within 3 rd repeat domain of tau protein), and 362-HVPGGG-367 (SEQ ID NO: 149) (within 4 th repeat domain of tau protein).
- These epitopes are also referred herein as QT1 , QT2, QT3, and QT4, respectively.
- DC8E8 binds to all of QT1-QT4; in fact, the epitope of DC8E8 is HXPGGG, wherein X is any amino acid (SEQ ID NO. 157).
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily (fragment
- Fv is that portion of the heavy chain that is included in a Fab fragment. Any of these fragments can also be produced recombinantly.
- the Fc portion of an antibody is associated with the antibody's effector functions, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity or phagocytosis. Alterations (e.g., mutations or glycosylation changes) in the Fc region of an antibody can be used to modulate any of its effector functions as well as increase its serum half-life and other pharmacokinetic properties.
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1 ) of the heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear at least one free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- Fc includes the polypeptide comprising the constant region of an antibody excluding the first constant region immunoglobulin domain.
- Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
- IgA and IgM Fc may include the J chain.
- Fc comprises immunoglobulin domains C gamma 2 and C gamma 3 (Cgamma2 and Cgamma3) and the hinge between C gamma
- the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU numbering system.
- the Fc region is herein defined, in one embodiment, to comprise residue P232 to its carboxyl-terminus, wherein the numbering is according to the EU numbering system (Edelman G M et a!., (1969) Proc Natl Acad Sci USA, 63(1): 78-85).
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantJy engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- Fc may refer to this region in isolation or this region in the context of an Fc polypeptide, for example an antibody.
- the Fc may be a native sequence Fc or a variant Fc.
- Fc replacements of amino acid residues in the Fc portion to alter antibody effector function are known in the art (see, e.g., Winter et a!., U.S. Pat. Nos. 5,648,260 and 5,624,821).
- One suitable Fc described in PCT application WO 93/10151 (hereby incorporated by reference), is a single chain polypeptide extending from the N- terminal hinge region to the native C-terminus of the Fc region of a human lgG1 antibody.
- Another useful Fc polypeptide is the Fc mutein described in U.S. Pat. No. 5,457,035 and in Baum et a!., 1994, EMBO J. 13:3992-4001.
- amino acid sequence of this mutein is identical to that of the native Fc sequence presented in WO 93/10151 , except that amino acid 19 has been changed from Leu to Ala, amino acid 20 has been changed from Leu to Glu, and amino acid 22 has been changed from Gly to Ala.
- the mutein exhibits reduced affinity for Fc receptors.
- Fc receptor or “FcR” are used to describe a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the Fc.gamma.RI, Fc.gamma.RII, and Fc.gamma. RIM subclasses, including allelic variants and alternatively spliced forms of these receptors.
- Fc.gamma.RII receptors include Fc.gamma.RIIA (an “activating receptor") and Fc.gamma.RIIB (an "inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor Fc.gamma.RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- Inhibiting receptor Fc.gamma.RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daeron, Annu. Rev. Immunol 15:203-234 (1997)).
- FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al,
- FcR neonatal receptor
- Fv is also the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
- variable domain or half of an Fv comprising only three hypervariable regions specific for an antigen
- variable domain or half of an Fv comprising only three hypervariable regions specific for an antigen
- a humanized antibody that comprises a heavy or light chain variable "framework region" from a particular human germline immunoglobulin sequence may contain amino acid differences as compared to the heavy or light chain variable framework region of the particular germline sequence, due to, for example, naturally- occurring somatic mutations or intentional introduction of site-directed mutation.
- a selected humanized antibody typically is at least 90% identical in amino acid sequence of the heavy or light chain variable framework region to an amino acid sequence encoded by the heavy or light chain variable framework region of a human germline immunoglobulin gene and contains amino acid residues that identify the humanized antibody as being derived from human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
- a humanized antibody may be preferably at least 90%, more prefereably at least 95%, more preferably at least 96%, most preferably at least 97%, in particular at least 98%, most particular at least 99%, identical in amino acid sequence of the heavy or light chain variable framework region to the amino acid sequence of the heavy or light chain variable framework region encoded by the germline immunoglobulin gene.
- the heavy or light chain variable framework region of a humanized antibody derived from a particular human germline sequence will display no more than 11 amino acid, preferably no more than 5, or even more preferably no more than 4, 3, 2, or 1 differences from the amino acid sequence of the heavy or light chain variable framework region encoded by the human germline immunoglobulin gene.
- Human effector cells are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc.gamma.RIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- monocytes cytotoxic T cells and neutrophils
- the effector cells may be isolated from a native source thereof, e.g. from blood or PBMCs as described herein.
- “Human germline sequences” are found naturally in the human population. A combination of those germline genes generates antibody diversity. Germline antibody sequences for the light chain of the antibody come from conserved human germline kappa or lambda v-genes and j-genes. Similarly the heavy chain
- the term "hinge” or “hinge region” or “antibody hinge region” herein includes the flexible polypeptide comprising the amino acids between the first and second constant domains of an antibody or tau-binding fragment thereof.
- the "hinge region” as referred to herein is a sequence region of 6-62 amino acids in length, only present in !gA, IgD and IgG, which encompasses the cysteine residues that bridge the two heavy chains.
- the IgG CH1 domain ends at EU position 220, and the IgG CH2 domain begins at residue EU position 237.
- the antibody hinge is herein defined, in one embodiment, to include positions 221 (D221 in lgG1 ) to 231 (A231 in lgG1), wherein the numbering is according to the EU numbering system.
- humanized antibody refers to antibodies in which the framework regions (FR) and/or the complementarity determining regions (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity (mouse) as compared to that of the parent immunoglobulin (human).
- FR framework regions
- CDR complementarity determining regions
- a murine CDR is grafted into the framework region of a human antibody to prepare the "humanized antibody.”
- human frameworks are "grafted” or spliced into mouse antibodies, preserving the CDRs of the mouse antibody and replacing its frameworks with frameworks of human origin. Grafting and splicing can be done by various recombinant DNA technologies, including PGR and mutagenesis.
- Humanized antibodies result from genetically engineering another antibody to make it more human-like while retaining its original antigen- binding properties. Presta, L.G. Engineering of therapeutic antibodies to minimize immunogenicity and optimize function. Advanced Drug Delivery Reviews, Volume 58, Issues 5-6: 640-656 (2006).
- the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against a library of known human variable-domain sequences or a library of human germline sequences. The human sequence that is closest to that of the rodent can then be accepted as the human framework region for the humanized antibody (Sims et al., J. Immunol. 1993;
- Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al., PNAS USA, 1992; 89:4285 et seq.; Presta et al., J Immunol 1993; 151 :2623 et seq.).
- Other methods designed to reduce the immunogenicity of the antibody molecule in a human patient include veneered antibodies (see, e.g., U.S. Pat. No.
- Particularly preferred CDRs of the humanized antibodies described herein correspond to the CDR sequences of the mouse monoclonal DC8E8 antibody, namely SEQ ID NOs.1-6.
- a copy of the humanized antibodies and tau-binding fragments thereof described herein e.g. an immunoglobulin with the same heavy or light chain variable region as those described herein, made by recombinant methods or any other methods (except a naturally existing antibody), is also a humanized antibody or tau-binding fragment thereof within the scope of the term.
- hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen-binding.
- the hypervariable region generally comprises amino acid residues from a "complementarity determining region” or "CDR" (e.g. residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
- CDR complementarity determining region
- residues from a "hypervariable loop” e.g. residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1 ), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
- "Framework Region” or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined.
- cysteine 23 (1st-CYS), tryptophan 41 (CONSERVE D-TRP), hydrophobic amino acid 89, cysteine 104 (2nd-CYS), phenylalanine or tryptophan 1 18 (J-PHE or J-TRP).
- Lefranc M.-P. Immunology Today 18, 509 (1997); Lefranc M.-P., The Immunologist, 7, 132-136 (1999); Lefranc, M.-P., Pommie, C, Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L, Thouvenin-Contet, V. and Lefranc, Dev. Comp.
- the IMGT unique numbering provides a standardized delimitation of the framework regions (FR1-IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 118 to 128) and of the complementarity determining regions: CDR1-IMGT: 27 to 38, CDR2-IMGT: 56 to 65 and CDR3-IMGT: 105 to 1 17.
- the CDR-IMGT lengths (shown between brackets and separated by dots, e.g. [8.8.13]) become important information.
- IMGT Colliers de Perles 2D graphical representations, designated as IMGT Colliers de Perles. See, e.g., Ruiz, M. and Lefranc, M.-P., Immunogenetics, 53, 857-883 (2002); Kaas, Q. and Lefranc, M.-P., Current Bioinformatics, 2, 21-30 (2007). It is also used for representing 3D
- Framework or FR residues are those variable domain residues other than and bracketing the hypervariable regions.
- a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc.
- immunogenicity refers to an antibody response to administration of a therapeutic drug.
- the immunogenicity toward the antibodies and tau-binding fragments provided herein is obtained using quantitative and qualitative assays for detection of antibodies against said therapeutic proteins, polypeptides and peptides in biological fluids.
- Such assays include, but are not limited to, Radioimmunoassay (RIA), Enzyme-linked immunosorbent assay (ELISA), luminescent immunoassay (LIA), and fluorescent immunoassay (FIA). Analysis of such immunogenicity involves comparing the antibody response upon administration of antibodies and tau-binding fragments provided herein to the antibody response upon administration of a control therapeutic protein, polypeptide or peptide or of the delivery vehicle or delivery buffer.
- RIA Radioimmunoassay
- ELISA Enzyme-linked immunosorbent assay
- LIA luminescent immunoassay
- FFA fluorescent immunoassay
- the "light chains" of antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- “Native antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end. The constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- nucleic acid as used herein, is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.
- the "percentage identity" between two sequences of nucleic acids or amino acids means the percentage of identical nucleotides or amino acid residues between the two sequences to be compared, obtained after optima! alignment, this percentage being purely statistical and the differences between the two sequences being distributed randomly along their length.
- the comparison of two nucleic acid or amino acid sequences is traditionally carried out by comparing the sequences after having optimally aligned them, said comparison being able to be conducted by segment or by using an "alignment window”. Optimal alignment of the sequences for comparison can be carried out, in addition to comparison by hand, by means of the local homology algorithm of Smith and Waterman (1981 ) [Ad. App. Math.
- the identity of a sequence can exist over a region that is at least about 75-100 sequential units in length, over a region that is about 50 sequential units in length, or, where not specified, across the entire sequence of a polypeptide sequence.
- the percentage identity between two nucleic acid or amino acid sequences is determined by comparing the two optimally-aligned sequences in which the nucleic acid or amino acid sequence to compare can have additions or deletions compared to the reference sequence for optimal alignment between the two sequences.
- Percentage identity is calculated by determining the number of positions at which the amino acid nucleotide or residue is identical between the two sequences, for example between the two complete sequences, dividing the number of identical positions by the total number of positions in the alignment window and multiplying the result by 100 to obtain the percentage identity between the two sequences.
- percentage sequence identities between antibodies are determined with antibody sequences maximally aligned by the Kabat numbering convention.
- the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
- BLAST 2 sequences (Tatusova et a/., "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol., 1999, Lett. 174:247-250) available on the site
- amino acid sequence exhibiting at least 80%, for example 85%, 90%, 95% and 98% identity with a reference amino acid sequence
- preferred examples include those containing the reference sequence, certain modifications, notably a deletion, addition or substitution of at least one amino acid, truncation or extension.
- substitutions are preferred in which the substituted amino acids are replaced by "equivalent” amino acids.
- the expression “equivalent amino acids” is meant to indicate any amino acids likely to be substituted for one of the structural amino acids without however modifying the biological activities of the corresponding antibodies and of those specific examples defined below.
- Equivalent amino acids can be determined either on their structural homology with the amino acids for which they are substituted or on the results of comparative tests of biological activity between the various antibodies likely to be generated.
- Table 1 summarizes the possible substitutions likely to be carried out without resulting in a significant modification of the biological activity of the corresponding modified antibody; inverse substitutions are naturally possible under the same conditions.
- pathological tau and “disease tau” include pathological tau conformers and structures and encompasses all of the following: Tau Type 1A, IB, 11 A, and MB (described in detail in WO2004/007547 A2), misordered, misdisordered tau (monomer, dimer, trimer, oligomer), misdisordered soluble tau, sarkosyl-insoluble tau, extracellular tau deposits, tau aggregates, paired helical filaments, neurofibrillary pathology, including neurofibrillary lesions, tangles, threads, fibrils, axonal spheriods, highly phosphorylated forms of truncated tau and of full-length tau, or any other form of tau associated with AD or another tauopathy that is detectable by the antibodies and/or tau-blnding fragments described herein.
- Tau 151-391/4R also referred to as tauA(1-15Q;392-441)
- pharmaceutically acceptable means biologically or pharmacologically compatible for in vivo use in animals or humans, and preferably means approved by a regulatory agency of the Federal or a state government or listed in the U.S.
- Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- another tauopathy encompasses all neurological diseases that are accompanied by the appearance of abnormal forms of microtubule associated protein tau in the brains of patients.
- the term includes, but is not limited to, the following diseases: Alzheimer's disease, Gerstrnann-Straussier-Scheinker disease, British dementia, Danish dementia, Pick's disease, Progressive supranuclear palsy, Corticobasal degeneration, Argyrophilic grain disease, Guam Parkinsonism- dementia complex, Tangle-only dementia, White matter tauopathy with globular glial inclusions, Frontotemporal dementia (e.g., FTDP-17), and Parkinsonism linked to chromosome 17. See, e.g., Goedert M, Clavaguera F and Tolnay M.
- the term “another tauopathy” encompasses all neurological diseases that are accompanied by the appearance of abnormal forms of microtubule associated protein tau in the brains of patients.
- the term includes, but is not limited to, the following diseases: Alzheimer'
- one or more of those abnormal forms of tau is recognized by one of the antibodies or binding fragments described herein in at least one assay.
- the assay is IHC. In other embodiments, the assay is ELISA.
- Single-chain Fv or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- treatment is defined as the application or administration of a therapeutic agent to a subject, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- compositions of the disclosure either alone or in combination with another therapeutic agent cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect at least one symptom of Alzheimer's Disease or another tauopathy being treated as compared to that symptom in the absence of use of the humanized anti-tau antibody or tau-binding fragment thereof composition
- the result should be considered a treatment of the underlying disorder regardless of whether all the symptoms of the disorder are cured, healed, alleviated, relieved, altered, remedied, ameliorated, improved or affected or not.
- variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs).
- the variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- hypervariable regions (HVR) in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors” (or simply, “expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- viral vectors e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
- the humanized antibodies described herein are capable of binding at least one, two, three, or four of QT1-QT4 in such manner that they discriminate between wild-type/normal tau and
- two, three, or four of the QT1-QT4 may be simultaneously occupied by these antibodies.
- the antibodies and tau-binding fragments described herein have as their "epitope" any one or more of the following four tau sites, some or all of which are conformational epitopes: 268-HQPGGG-273 (SEQ ID NO: 148 ) (within 1 st repeat domain of tau protein), 299-HVPGGG-304 (SEQ ID NO: 149 ) (within 2 nd repeat domain of tau protein), 330-HKPGGG-335 (SEQ ID NO: 150) (within 3" 1 repeat domain of tau protein), and 362-HVPGGG-367 (SEQ ID NO: 149) (within 4 th repeat domain of tau protein).
- DC8E8 binds to all of QT1-QT4; in fact, the epitope of DC8E8 is HXPGGG, wherein X is any amino acid.
- the antibodies and tau-binding fragments have affinities for Tau 151-139/4R that are at least 80% as good if not better than that of the parent mouse monoclonal antibody DC8E8. In one embodiment, the antibodies and tau-binding fragments retain specificity for the epitopes recognized by the mouse DC8E8 antibody. In one embodiment, these antibodies have one or more advantageous biochemical properties (e.g., human constant regions and thus reduced
- tau-binding fragments e.g. antibody portions
- These fragments are also capable of binding to at least one, two, three, or four of QT1-QT4 (defined above) in such manner that they discriminate between wild-type/normal tau and conformations of tau that are associated with AD.
- all four of the QT1-QT4 epitopes may be occupied by four of the antibodies or tau-binding fragments described herein.
- the fragments or portions bind to tau with the same affinity and properties of the mouse monoclonal antibody DC8E8.
- antibody fragments or portions capable of binding to one or more of QT1-QT4 include, but are not limited to Fab (e.g., by papain digestion), Fd, Fab' (e.g., by pepsin digestion and partial reduction) and F(ab')2 (e.g., by pepsin digestion), facb (e.g., by plasmin digestion), pFc' (e.g., by pepsin or plasmin digestion), Fd (e.g., by pepsin digestion, partial reduction and re-aggregation), Fv or scFv (e.g., by molecular biology techniques) fragments, are provided by the present invention. See also, William E.
- a combination gene encoding an F(ab') 2 heavy chain portion can be designed to include DNA sequences encoding the CH1 domain and/or hinge region of the heavy chain.
- the various portions of antibodies can be joined together chemically by conventional techniques, or can be prepared as a contiguous protein using routine genetic engineering techniques.
- intact antibodies can be assigned to different "classes".
- the heavy-chain constant domains that correspond to the different classes of antibodies are called alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ), and mu ( ⁇ ), respectively.
- the antibodies described herein have constant regions of any of the existing immunogenic isotypes.
- the constant regions can be of the lambda or kappa region and the gamma-1 , gamma-2, gamma-3, or gamma 4 regions.
- Constant regions of mixed isotypes are also within the scope of this disclosure (e.g., lgG1 mixed with lgG4). It has been perceived that some isotypes are superior over the others.
- the human isotypes IgM, lgG1 , lgG2, lgG3 (two allotypes), lgG4, IgA and IgE were compared for autologous complement mediated lysis as well as for antibody dependent cell mediated cytotoxicity (ADCC).
- ADCC antibody dependent cell mediated cytotoxicity
- human IgM and lgG1 proved to be the most effective with the two allotypes of igG3 being next best.
- lgG2 gave poor lysis while the other isotypes seemed to give no lysis.
- ADCC results were that lgG1 was again very effective followed by either lgG2, lgG3, or lgG4, depending on the assay (e.g., cell type).
- antibodies have many other activities (e.g., promoting opsonization by macrophages), and ultimately it is difficult or even not possible to predict which isotype is going to have the best set of properties for its desired use.
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain.
- humanization can be essentially performed following the method of Winter and co-workers (Jones et al, Nature, 321 :522-525 (1986); Riechmann et al, Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
- humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanized antibodies are human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- variable domains both light and heavy
- sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
- the human sequence (entire variable region or just the frameworks) that is closest to that of the rodent is then accepted as the human framework region (FR) for the humanized antibody (Sims et al, J. Immunol., 151 :2296 (1993); Chothia et al, J. Mol. Biol., 196:901 (1987)).
- Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
- the same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol, 151 :2623 (1993)).
- humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional
- immunoglobulin models are commonly available and are familiar to those skilled in the art.
- Computer programs are available which illustrate and display probable three- dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
- FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
- the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
- a humanized antibody or tau- binding fragment as described herein, comprises SEQ ID NOs. 1 , 2, 3, as the heavy chain CDRs 1 , 2, and 3, respectively, and SEQ ID Nos. 4, 5, 6, as the light chain CDRs 1, 2, and 3, respectively.
- this antibody or fragment comprises at least one CDR, as defined according to Kabat, whose sequence has at least 80%, preferable at least 85%, 90%, 95%, and 98% identity after optimal alignment with a CDR of any one of SEQ ID NOs. 1 to 6.
- the antibody (AX001) or tau-binding fragment thereof comprises heavy chain variable region RHA (SEQ ID NO. 13) and light chain variable region RKA (SEQ ID NO. 26 ).
- This antibody is provided with either lgG1 (AX001-lgG1) or lgG4 (AXON001-lgG4) constant regions.
- the antibody (AX002) or tau-binding fragment thereof comprises heavy chain variable region RHB (SEQ ID NO. 14) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX002-lgG1) or lgG4 (AXON002-lgG4) constant regions.
- the antibody (AX003) or tau-binding fragment thereof comprises heavy chain variable region RHC (SEQ ID NO. 15) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX003-lgG1) or lgG4 (AXON003-lgG4) constant regions.
- the antibody (AX004) or tau-binding fragment thereof comprises heavy chain variable region RHD (SEQ ID NO. 16) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX004-lgG1) or lgG4 (AXON004-lgG4) constant regions.
- the antibody (AX005) or tau-binding fragment thereof comprises heavy chain variable region RHE (SEQ ID NO. 17) and light chain variable region RKA (SEQ ID NO. 26 ).
- This antibody is provided with either lgG1 (AX005-lgG1) or lgG4 (AXON005-lgG4) constant regions.
- the antibody (AX006) or tau-binding fragment thereof comprises heavy chain variable region RHF (SEQ ID NO. 18) and light chain variable region RKA (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX006-lgG1) or lgG4 (AXON006-lgG4) constant regions.
- the antibody (AX007) or tau-binding fragment thereof comprises heavy chain variable region RHG (SEQ ID NO. 19) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX007-lgG1) or lgG4 (AXON007-lgG4) constant regions.
- the antibody (AX008) or tau-binding fragment thereof comprises heavy chain variable region RHH (SEQ ID NO. 20) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX008-lgG1) or lgG4 (AXON008-lgG4) constant regions.
- the antibody (AX009) or tau-binding fragment thereof comprises heavy chain variable region RHI (SEQ ID NO. 21) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX009-lgG1) or lgG4 (AXON009-lgG4) constant regions.
- the antibody (AX010) or tau-binding fragment thereof comprises heavy chain variable region RHJ (SEQ ID NO. 22) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX010-lgG1) or lgG4 (AXON010-lgG4) constant regions.
- the antibody (AX01 1) or tau-binding fragment thereof comprises heavy chain variable region RHK (SEQ ID NO. 23) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX011-lgG1) or lgG4 (AXON011-lgG4) constant regions.
- the antibody (AX012) or tau-binding fragment thereof comprises heavy chain variable region RHL (SEQ ID NO. 24) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX012-lgG1) or lgG4 (AXON012-lgG4) constant regions.
- the antibody (AX013) or tau-binding fragment thereof comprises heavy chain variable region RHA (SEQ ID NO. 1 ) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX013-lgG1) or lgG4 (AXON013-lgG4) constant regions.
- the antibody (AX014) or tau-binding fragment thereof comprises heavy chain variable region RHB (SEQ ID NO. 2) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX014-lgG1) or lgG4 (AXON014-lgG4) constant regions.
- the antibody (AX015) or tau-binding fragment thereof comprises heavy chain variable region RHC (SEQ ID NO. 15) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX015-lgG1) or igG4 (AXON015-lgG4) constant regions.
- the antibody (AX016) or tau-binding fragment thereof comprises heavy chain variable region RHD (SEQ ID NO. 16) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX016-lgG1) or lgG4 (AXON016-lgG4) constant regions.
- the antibody (AX017) or tau-binding fragment thereof comprises heavy chain variable region RHE (SEQ ID NO. 17) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX017-lgG1) or lgG4 (AXON017-!gG4) constant regions.
- the antibody (AX018) or tau-binding fragment thereof comprises heavy chain variable region RHF (SEQ ID NO. 18) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AXQ18-lgG1) or lgG4 (AXON018-lgG4) constant regions.
- the antibody (AX019) or tau-binding fragment thereof comprises heavy chain variable region RHG (SEQ ID NO. 19) and light chain variable region RKA (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX019-lgG1) or lgG4 (AXON019-lgG4) constant regions.
- the antibody (AX020) or tau-binding fragment thereof comprises heavy chain variable region RHH (SEQ ID NO. 20) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX020-lgG1) or lgG4 (AXON020-lgG4) constant regions.
- the antibody (AX021) or tau-binding fragment thereof comprises heavy chain variable region RHI (SEQ ID NO. 21) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX021-lgG1) or lgG4 (AXON021-lgG4) constant regions.
- the antibody (AX022) or tau-binding fragment thereof comprises heavy chain variable region RHJ (SEQ ID NO. 22) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX022-lgG1) or lgG4 (AXON022-lgG4) constant regions.
- the antibody (AX023) or tau-binding fragment thereof comprises heavy chain variable region RHK (SEQ ID NO. 23) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX023-lgG1) or lgG4 (AXON023-lgG4) constant regions.
- the antibody (AX024) or tau-binding fragment thereof comprises heavy chain variable region RHL (SEQ ID NO. 24) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX024-lgG1) or lgG4 (AXON024-lgG4) constant regions.
- the antibody (AX025) or tau-binding fragment thereof comprises heavy chain variable region RHA (SEQ ID NO. 13) and light chain variable region VK (SEQ ID NO. 8)).
- This antibody is provided with either lgG1 (AX025-lgG1) or lgG4 (AXON025-lgG4) constant regions. ⁇
- the antibody (AX026) or tau-binding fragment thereof comprises heavy chain variable region RHB (SEQ ID NO. 14) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX026-lgG1) or lgG4 (AXON026-lgG4) constant regions.
- the antibody (AX027) or tau-binding fragment thereof comprises heavy chain variable region RHC (SEQ ID NO. 15) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX027-lgG1 ) or lgG4 (AXON027-lgG4) constant regions.
- the antibody (AX028) or tau-binding fragment thereof comprises heavy chain variable region RHD (SEQ ID NO. 16) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX028-lgG1) or lgG4 (AXON028-lgG4) constant regions.
- the antibody (AX029) or tau-binding fragment thereof comprises heavy chain variable region RHE (SEQ ID NO. 17) and light chain variable region VK (SEQ ID N0.8).
- This antibody is provided with either lgG1 (AX029-lgG1) or lgG4 (AXON029-!gG4) constant regions.
- the antibody (AX030) or tau-binding fragment thereof comprises heavy chain variable region RHF (SEQ ID NO. 18) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX030-lgG1) or lgG4 (AXON030-lgG4) constant regions.
- the antibody (AX031) or tau-binding fragment thereof comprises heavy chain variable region RHG (SEQ ID NO. 19) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX031-lgG1) or lgG4 (AXON031-lgG4) constant regions.
- the antibody (AX032) or tau-binding fragment thereof comprises heavy chain variable region RHH (SEQ ID NO. 20) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX032-lgG1) or lgG4 (AXON032-lgG4) constant regions.
- the antibody (AX033) or tau-binding fragment thereof comprises heavy chain variable region RHI (SEQ ID NO. 21) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX033-lgG1) or lgG4 (AXON033-lgG4) constant regions.
- the antibody (AX034) or tau-binding fragment thereof comprises heavy chain variable region RHJ (SEQ ID NO. 22) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX034-lgG1) or lgG4 (AXON034-lgG4) constant regions.
- the antibody (AX035) or tau-binding fragment thereof comprises heavy chain variable region RHK (SEQ ID NO. 23) and light chain variable region VK (SEQ ID NO.8).
- This antibody is provided with either lgG1 (AX035-lgG1) or lgG4 (AXON035-lgG4) constant regions.
- the antibody (AX036) or tau-binding fragment thereof comprises heavy chain variable region RHL (SEQ ID NO. 24) and light chain variable region VK (SEQ ID N0.8),
- This antibody is provided with either lgG1 (AX036-igG1) or igG4 (AXON036-lgG4) constant regions.
- the antibody (AX037) or tau-binding fragment thereof comprises heavy chain variable region RHM (SEQ ID NO. 25) and light chain variable region RKA (SEQ ID NO. 26).
- This antibody is provided with either lgG1 (AX037-lgG1) or lgG4 (AXON037-lgG4) constant regions.
- the antibody (AX038) or tau-blnding fragment thereof comprises heavy chain variable region RHM (SEQ ID NO.) and light chain variable region RKB (SEQ ID NO. 27).
- This antibody is provided with either lgG1 (AX037-lgG1) or lgG4 (AXON037-lgG4) constant regions.
- the invention provides an antibody heavy chain comprising a variable region chosen from any one of heavy chain variable regions RHA, RHB, RHC, RHD, RHE, RHF, RHG, RHH, RHI, RHJ, RHK, RHL, and RHM. Any of these variable regions can be linked to a constant region of any human isotype, including constant regions with mixed isotypes.
- the invention provides an antibody light chain comprising a variable region chosen from RKA and RKB. Any of these variable regions can be linked to a constant region of any human isotype, including constant regions with mixed isotypes.
- the invention provides an antibody heavy chain of any one of SEQ ID NO. 28-40 and 43-55.
- the invention provides an antibody light chain chosen from SEQ ID NO. 57-59.
- the heavy and light chain variable regions of humanized antibodies can be linked to at least a portion of a human constant region.
- the choice of constant region depends, in part, whether antibody-dependent cell- mediated cytotoxicity, antibody dependent cellular phagocytosis and/or complement dependent cytotoxicity are desired.
- human isotopes lgG1 and lgG3 have complement-dependent cytotoxicity and human isotypes lgG2 and lgG4 do not.
- human lgG1 and igG3 also induce stronger ceil mediated effector functions than human lgG2 and lgG4.
- Light chain constant regions can be lambda or kappa.
- An exemplary human light chain kappa constant region has the amino acid sequence of SEQ ID NO: 170.
- the N-terminal arginine of SEQ ID NO: 170 can be omitted, in which case light chain kappa constant region has the amino acid sequence of SEQ ID NO:171.
- An exemplary human lgG1 heavy chain constant region has the amino acid sequence of SEQ ID NO: 172.
- An exemplary human lgG4 heavy chain constant region has the amino acid sequence of SEQ ID NO: 173.
- Antibodies can be expressed as tetramers containing two light and two heavy chains, as separate heavy chains, light chains, as Fab, Fab', F(ab')2, and Fv, or as single chain antibodies in which heavy and light chain mature variable domains are linked through a spacer.
- cDNA sequences encoding the constant regions of human antibodies are known to one of ordinary skill in the art.
- exemplary cDNA sequences available via, e.g., GenBank each of which incorporated by reference in its entirety, are as follows: Human lgG1 constant heavy chain region: GenBank accession No.: J00228; Human lgG2 constant heavy chain region: GenBank accession No.:
- K01316; and Human kappa light chain constant region GenBank accession No.: J00241.
- the constant region may further be modified according to known methods.
- residue S241 may be mutated to a proline (P) residue to allow complete disulphide bridge formation at the hinge (see, e.g., Angel et a!., Mol. Immunol. 1993; 30:105-8).
- the table 5 summarizes the various amino acid sequences corresponding to the various full length sequences of the light chains of the humanized antibodies described herein.
- the chimeric antibody or tau-binding fragment thereof comprises heavy chain variable region DC8E8 VH (SEQ ID NO. 9) and light chain variable region DC8E8 VK(SEQ ID NO. 10) together with a human lgG1 constant region (SEQ ID NO. 172 ) for the heavy chain and a kappa constant region (SEQ ID NO. 170) for the light chain.
- the chimeric antibody or tau-binding fragment thereof comprises heavy chain variable region DC8E8 VH (SEQ ID NO. 9) and light chain variable region DC8E8 VK(SEQ ID NO. 10) together with a human lgG4 constant region (SEQ ID NO. 173) for the heavy chain and a kappa constant region (SEQ ID NO. 170) for the light chain.
- the humanized antibody or a tau-binding fragment/portion thereof is made recombinantiy. In another embodiment, the humanized antibody or a tau-binding fragment/portion thereof is made, at least partially, by chemical synthesis. In one embodiment, the chimeric antibody or a tau-binding
- fragment/portion thereof is made recombinantiy.
- the chimeric antibody or a tau-binding fragment/portion thereof is made, at least partially, by chemical synthesis.
- Table 6 summarizes the sequences for some of the other humanization-related molecules described herein.
- Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
- Amino acid sequence variants of the antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
- the amino acid changes also may alter post-transiationai processes of the antibody, such as changing the number or position of glycosylation sites.
- antibodies and binding fragments the sequence of which has been altered by introducing at least one, particularly at least two, more particularly at least 3 or more conservative substitutions into the sequences of SEQ ID NOs: 13-25 and SEQ ID NOs: 26 and 27 respectively, such that the antibody essentially maintains its full functionality.
- Certain amino acids from the human mature variable region framework residues can be selected for substitution based on their possible influence on CDR conformation and/or binding to antigen, mediating interaction between heavy and light chains, interaction with the constant region, being a site for desired or undesired post- translational modification, being an unusual residue for its position in a human variable region sequence and therefore potentially immunogenic, among other reasons.
- One of ordinary skill in the art would know how to pick certain amino acids for substitution and then assess the result of such substitution. In many
- positions for substitution within frameworks and amino acids to substitute are selected empirically.
- Amino acid substitutions can also be made in the CDRs.
- One possible variation is to substitute certain residues in the CDRs of the mouse DC8E8 antibody with corresponding residues from human CDRs sequences, typically from the CDRs of the human acceptor sequences used in designing the exemplified humanized antibodies.
- human CDRs sequences typically from the CDRs of the human acceptor sequences used in designing the exemplified humanized antibodies.
- SDRs subset of CDR residues required for binding
- CDR residues not contacting antigen and not in the SDRs can be identified based on previous studies (for example residues H60-H65 in CDR H2 are often not required), from regions of Kabat CDRs lying outside Chothia
- the amino acid occupying the position can be an amino acid occupying the corresponding position (by Kabat numbering) in the acceptor antibody sequence.
- the number of such substitutions of acceptor for donor amino acids in the CDRs to include reflects a balance of competing considerations.
- substitutions are potentially advantageous in decreasing the number of mouse amino acids in a humanized antibody and consequently decreasing potential immunogenicity.
- substitutions can also cause changes of affinity, and significant reductions in affinity are preferably avoided.
- Positions for substitution within CDRs and amino acids to substitute can also be selected empirically.
- antibodies and tau-binding fragments thereof comprise a heavy chain variable region comprising CDR-H1 , CDR-H2, and CDR-H3 of SEQ ID NOs 1 , 2, and 3, respectively, and being at least 90% identical to the mature heavy chain of SEQ ID NO. 28-40 (complete RHA-RHM); and a light chain variable region comprising CDR-L1 , CDR-L2, and CDR-L3 of SEQ ID NOs. 4, 5, and 6 respectively, and being at least 90% identical to the mature light chain of SEQ ID NO. 57 (RKA) or SEQ ID NO. 58 (RKB).
- the mature heavy chain variable region is at least 95%, 96%, 97%, 98%, or 99% identical to any one of SEQ ID NO. 28-40. In some embodiments, the mature light chain variable region is at least 95%, 96%, 97%, 98%, or 99% identical to any one of SEQ ID NO. 57or SEQ ID NO. 58.
- a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells Science, 244:1081-1085 (1989).
- a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
- Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
- the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be
- ala scanning or random mutagenesis is conducted at the target codon or region and the expressed antibody variants are screened for the desired activity.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include antibody with an N-terminal methionyl residue or the antibody fused to another therapeutic agent.
- Other insertional variants of the antibody molecule include the fusion to the N- or C- terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- variants are an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue.
- sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in a table above as well as below. More substantial changes, denominated in amino acid classes may be introduced and the products screened.
- substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehnlnger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)):
- Naturally occurring residues may be divided into groups based on other common side-chain properties:
- Non-conservative substitutions typically entail exchanging a member of one of these classes for another class.
- cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
- cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
- a particularly preferred type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
- a parent antibody e.g. a humanized or human antibody
- the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
- a convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site.
- the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g. binding affinity) as herein disclosed.
- alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
- Another type of amino acid variant of the antibody alters the original giycosylation pattern of the antibody.
- altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more giycosylation sites that are not present in the antibody.
- Giycosylation of antibodies is typically either N-linked or O-linked.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tri peptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked giycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- Addition of giycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above- described tripeptide sequences (for N-linked giycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked giycosylation sites).
- the carbohydrate attached thereto may be altered.
- antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 A1 , Presta, L. See also US 2004/0693621 A1 (Kyowa Hakko Kogyo Co., Ltd).
- Antibodies with a bisecting N-acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in
- one or more Fc amino acids are mutated to increase the half-life of the antibody in the blood, or wherein one or more sugar moieties of the Fc have been deleted, or one or more sugar moieties added to increase the blood half-life of the antibody.
- Common plasma proteins such as human serum albumin (HSA) and immunoglobulins (Igs), including humanized antibodies, show long half-lifes, typically of 2 to 3 weeks, which is attributable to their specific interaction with the neonatal Fc receptor (FcRn), which leads to endosomal recycling (Ghetie (2002) Immunol Res, 25:97-1 13).
- the antibodies or tau-binding fragments thereof may be modified to affect half-life or circulation time through PEGylation or other conjugation to other polymers.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the preferred molecular weight is between about 1 kDa and about 100 kDa (the term "about” indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing.
- Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the
- polyethylene glycol to a therapeutic protein or analog
- polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11 ,000, 11 ,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 Da.
- Branched polyethylene glycols are described, for example, in U.S. Pat. No.
- Polyethylene glycol may be attached to proteins via linkage to any of a number of amino acid residues.
- polyethylene glycol can be linked to polypeptides via covalent bonds to lysine, histidine, aspartic acid, glutamic acid, or cysteine residues.
- reaction chemistries may be employed to attach polyethylene glycol to specific amino acid residues (e.g., lysine, histidine, aspartic acid, glutamic acid, or cysteine) or to more than one type of amino acid residue (e.g., lysine, histidine, aspartic acid, glutamic acid, cysteine and combinations thereof).
- specific amino acid residues e.g., lysine, histidine, aspartic acid, glutamic acid, or cysteine
- amino acid residues e.g., lysine, histidine, aspartic acid, glutamic acid, cysteine and combinations thereof.
- antibodies or fragments thereof may have increased in vivo half lives via fusion with albumin (including but not limited to recombinant human serum albumin or fragments or variants thereof (see, e.g., U.S. Pat. No. 5,876,969, issued Mar. 2, 1999, EP Patent 0 413 622, and U.S. Pat. No. 5,766,883, issued Jun. 16, 1998, herein incorporated by reference in their entirety)) or other circulating blood proteins such as transferrin or ferritin.
- polypeptides and/or antibodies of the present invention are fused with the mature form of human serum albumin (i.e., amino acids 1-585 of human serum albumin as shown in FIGS. 1 and 2 of EP Patent 0 322 094) which is herein incorporated by reference in its entirety.
- Polynucleotides encoding fusion proteins of the disclosure are also encompassed by the invention.
- Antibodies or tau-binding fragments thereof may also be chemically modified to provide additional advantages such as increased solubility, stability and circulating time (in vivo half-life) of the polypeptide, or decreased immunogenicity (See, e.g, U.S. Pat. No. 4,179,337).
- the chemical moieties for derivatization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like.
- the antibodies and tau-binding fragments thereof may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties
- ADCC antigen-dependent cell-mediated cyotoxicity
- CDC complement dependent cytotoxicity
- This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody.
- cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al, J. Exp Med.
- an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al. Anti-Cancer Drug Design 3:219-230 (1989).
- WO00/42072 (Presta, L.) describes antibodies with improved ADCC function in the presence of human effector cells, where the antibodies comprise amino acid substitutions in the Fc region thereof.
- the antibody with improved ADCC comprises substitutions at positions 298, 333, and/or 334 of the Fc region.
- the altered Fc region is a human lgG1 Fc region comprising or consisting of substitutions at one, two or three of these positions.
- Antibodies with altered C1q binding and/or complement dependent cytotoxicity are described in W099/51642, U.S. Pat. No. 6.194.551 B1 , U.S. Pat. No. 6,242, 195B1 , U.S. Pat. No. 6,528,62461 and U.S. Pat. No. 6,538,124 (Idusogie et al.).
- the antibodies comprise an amino acid substitution at one or more of amino acid positions 270, 322, 326, 327, 329, 313, 333 and/or 334 of the Fc region thereof.
- a salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in U.S. Pat. No.
- the term "salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule (e.g., lgG1 , lgG2, lgG3, or lgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- Antibodies with improved binding to the neonatal Fc receptor (FcRn), and increased half-lives are described in WO00/42072 (Presta, L). These antibodies comprise a Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
- the Fc region may have substitutions at one or more of positions 238, 256, 265, 272, 286, 303, 305, 307, 311 , 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434.
- the preferred Fc region-comprising antibody variant with improved FcRn binding comprises amino acid substitutions at one, two or three of positions 307, 380 and 434 of the Fc region thereof.
- the humanized antibody or a tau-binding fragment/portion thereof is monoclonal.
- the monoclonal antibodies (mAbs) described herein are antibodies obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Each mAb is directed against a single determinant (epitope) on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they can be synthesized by hybridoma culture, uncontaminated by other immunoglobulins.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made in an immortalized B cell or hybridoma thereof, or may be made by
- the monoclonal antibodies are made from the growth of a single cell clone, such as a eukaryotic host cell transfected with a DNA molecule encoding for the antibody or a tau-binding fragment or portion thereof.
- Nucleic acids encoding antibodies and fragments of the disclosure can also be delivered to a host subject for expression of the antibody and fragments by cells of the host subject. Examples of strategies for polynucleotide delivery to and expression of anti-senilin antibodies in the central nervous system of a host subject are described in PCT application No. W098/44955, published Oct. 15, 1998. Any nucleic acid may be modified to increase stability in vivo.
- flanking sequences at the 5' and/or 3' ends Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends; the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages in the backbone; and/or the inclusion of nontraditional bases such as inosine, queuosine and wybutosine, as well as acetyl-, methyl-, thio- and other modified forms of adenine, cytidine, guanine, thymine and uridine.
- flanking sequences at the 5' and/or 3' ends Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends; the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages in the backbone; and/or the inclusion of nontraditional bases such as inosine, queuosine and wybutosine,
- an antibody or tau-binding fragment as described herein is capable of displaying a higher affinity for pathological tau than for physiological tau.
- an antibody or tau-binding fragment as described herein is capable of inhibiting tau-tau aggregation.
- an antibody or tau-binding fragment as described herein is capable of mediating uptake and degradation of pathological tau protein by microglia.
- an antibody or tau-binding fragment as described herein is capable of displaying a higher affinity for pathological tau than for physiological tau and inhibiting tau-tau aggregation.
- an antibody or tau-binding fragment as described herein is capable of displaying a higher affinity for pathological tau than for physiological tau, inhibiting tau-tau aggregation, and mediating uptake and degradation of pathological tau protein by microglia.
- the invention provides nucleic acids encoding the antibodies described herein, or parts thereof.
- the nucleic acids encoding heavy chain variable regions DC8E8 VH, RHA, RHB, RHC, RHD, RHE, RHF, RHG, RHH, RHI, RHJ, RHK, RHL, and RHM and light chain variable regions DC8E8 VK, RKA, and RKB have been codon optimized, using GeneScript's proprietary technology.
- codon optimization is the process of modifying a nucleotide sequence in a manner that improves its expression, G/C content, RNA secondary structure, and translation in eukaryotic cells, without altering the amino acid sequence it encodes.
- the invention provides nucleic acids (DNA or RNA) that encode a humanized antibody heavy chain variable region as described herein.
- the nucleic acid comprises a DNA that encodes any one of heavy chain variable regions RHA, RHB, RHC, RHD, RHE, RHF, RHG, RHH, RHI, RHJ, RHK, RHL, and RHM. These nucleic acids are represented in the tables below. Nucleic acids exhibiting a percent identity of at least 80%, at least 85%, at least 90%, at least 95%, and at least 98% are also within the scope of this embodiment.
- the table 10 summarizes the various nucleic acid sequences corresponding to the various full length sequences of the light chains of the humanized antibodies described herein.
- the invention provides nucleic acids (DNA or RNA) that encode a humanized antibody light chain variable region as described herein.
- the nucleic acid comprises a DNA that encodes any one of light chain variable regions RKA and RKB. These nucleic acids are represented in the tables above. Nucleic acids exhibiting a percent identity of at least 80%, at least 85%, at least 90%, at least 95%, and at least 98% are also within the scope of this embodiment.
- nucleotide sequences that encode an antibody or tau-binding fragment thereof as described herein. Some of these nucleic acids bear minimal homology to the nucleotide sequence of any "wild-type" antibody or tau-binding fragment thereof as described herein. Nonetheless, nucleic acids that vary due to differences in codon usage are specifically contemplated by the present invention.
- the invention provides nucleic acids (DNA or RNA) that encode a humanized antibody heavy chain variable region as described herein.
- the nucleic acid comprises a DNA that encodes any one of heavy chains variable regions RHA, RHB, RHC, RHD, RHE, RHF, RHG, RHH, RHI, RHJ, RHK, RHL, and RHM linked to a human lgG1 constant region.
- Nucleic acids exhibiting a percent identity of at least 80%, at least 85%, at least 90%, at least 95%, and at least 98% are also within the scope of this embodiment.
- the invention provides nucleic acids (DNA or RNA) that encode a humanized antibody heavy chain variable region as described herein.
- the nucleic acid comprises a DNA that encodes any one of heavy chains variable regions RHA, RHB, RHC, RHD, RHE, RHF, RHG, RHH, RHI, RHJ, RHK, RHL, and RHM linked to a human lgG4 constant region.
- Nucleic acids exhibiting a percent identity of at least 80%, at least 85%, at least 90%, at least 95%, and at least 98% are also within the scope of this embodiment.
- the invention provides nucleic acids (DNA or RNA) that encode a humanized antibody light chain variable region as described herein.
- the nucleic acid comprises a DNA that encodes any one of light chain variable regions RKA and RKB linked to a human kappa region. Nucleic acids exhibiting a percent identity of at least 80%, at least 85%, at least 90%, at least 95%, and at least 98% are also within the scope of this embodiment.
- the invention provides nucleic acids (DNA or RNA) that encode each of DC8E8's CDRs in a codon optimized manner.
- Nucleic sequences exhibiting a percentage identity of at least 80%, for example 85%, 90%, 95% and 98%, after optimal alignment with a preferred sequence means nucleic sequences exhibiting, with respect to the reference nucleic sequence, certain modifications such as, in particular, a deletion, a truncation, an extension, a chimeric fusion and/or a substitution, notably punctual.
- these are sequences which code for the same amino acid sequences as the reference sequence, this being related to the degeneration of the genetic code, or
- complementarity sequences that are likely to hybridize specifically with the reference sequences, for example under highly stringent conditions, notably those defined below.
- Hybridization under highly stringent conditions means that conditions related to temperature and ionic strength are selected in such a way that they allow
- DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1 ) prehybridization at 42°C for three hours in phosphate buffer (20 mM, pH 7.5) containing 5X SSC (1X SSC corresponds to a solution of 0.15 M NaCI + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10X Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) primary hybridization for 20 hours at a temperature depending on the length of the probe (i.e.: 42°C for a probe >100 nucleotides in length) followed by two 20-minute washings at 20°C in 2X SSC + 2% SDS, one 20- minute washing at 20°C in 0.1X SSC + 0.1 % SDS. The last washing is carried out in 0.1X SSC + 0.1 % SDS for 30 minutes at 60°C for a probe >100 nucleotides in length.
- polynucleotide of defined size can be adapted by a person skilled in the art for longer or shorter oligonucleotides, according to the procedures described in Sambrook, et al. (Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory; 3rd edition, 2001).
- the antibodies and tau-binding fragments thereof can be made synthetically or by any of the multiple expression systems known to those of ordinary skill in the art.
- the host cells are eukaryotic.
- the host cells are prokaryotic.
- the host cells express one or more of the antibodies and tau binding fragments thereof. Selected cells may be cultured and if required, the protein product of the gene of interest isolated from the culture using conventional techniques.
- the expression systems have been adapted to express the antibody or tau-binding fragment thereof at an optimal level.
- the antibodies and tau-binding fragments thereof are expressed by contract-based antibody expression companies (e.g., Lonza) that use proprietary technologies to express the antibodies and tau-binding fragments thereof as a service.
- the antibodies and tau-binding fragments thereof are expressed in a cell-free system.
- routinely used antibody expression systems include recombinant baculovirus, lentivirus, protozoa (e.g., eukaryotic parasite Leishmania tarentolae), microbial expression systems, including yeast-based (e.g. Pichia pastohs,
- glycosylation pattern of the antibodies expressed by these various systems varies considerably with the expression system.
- the glycosylation machinery of CHO cells is somewhat similar to the human glycosylation machinery, with some differences.
- factors that affect glycosylation during recombinant production of antibodies include growth mode, media formulation, culture density, oxygenation, pH, purification schemes and the like.
- Various methods have been proposed to alter the glycosylation pattern achieved in a particular host organism including introducing or overexpressing certain enzymes involved in oligosaccharide production (U.S. Pat. Nos. 5,047,335; 5,510,261 and 5,278,299).
- Glycosylation or certain types of glycosylation, can be enzymatically removed from the glycoprotein, for example using endoglycosidase H (Endo H).
- Endo H endoglycosidase H
- the recombinant host cell can be genetically engineered to be defective in processing certain types of polysaccharides.
- compositions comprising a humanized antibody or a tau-binding fragment thereof, as described herein, and another component, such as a carrier.
- pharmaceutical compositions/therapeutic formulations comprising a humanized antibody or a tau-binding fragment thereof, as described herein, and an excipient and/or a pharmaceutical carrier.
- the carrier is not a naturally existing compound.
- the excipient is not a naturally existing compound.
- the diluent is not a naturally existing compound.
- the formulation comprising the humanized antibody or a tau-binding fragment thereof, as described herein does not contain a naturally existing compound, except, optionally, water.
- therapeutic formulations of the antibodies used in accordance with the present invention are prepared for storage and/or administration by mixing an antibody our tau-binding fragment thereof having the desired degree of purity with optional pharmaceutically acceptable carriers, diluents, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3- pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
- hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides,
- disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS or polyethylene glycol (PEG).
- lyophilized antibody formulations are described in WO 97/04801 , expressly incorporated herein by reference.
- the formulation further comprises a surfactant.
- the surfactant may, for example, be selected from a detergent, ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides, sorbitan fatty acid esters, polyoxypropylene-polyoxyethylene block polymers (eg. poloxamers such as
- phosphatidyl serine phosphatidyl choline
- phosphatidyl ethanolamine phosphatidyl inositol
- diphosphatidyl glycerol phosphatidyl glycerol and sphingomyelin
- derivates of phospholipids eg.
- dipalmitoyl phosphatidic acid dipalmitoyl phosphatidic acid
- lysophospholipids eg. palmitoyl lysophosphatidyl- L-serine and 1 -acyl-sn-glycero-3-phosphate esters of ethanolamine, choline, serine or threonine
- alkyl alkoxyl (alkyl ester), alkoxy (alkyl ether)-derivatives of lysophosphatidyl and phosphatidylcholines, e.g.
- glycerophospholipids eg. cephalins
- glycerog!ycolipids eg. galactopyransoide
- sphingoglycolipids eg. ceramides, gangliosides
- dodecylphosphocholine hen egg lysolecithin
- fusidic acid derivatives-(e.g. sodium tauro-dihydrofusidate etc.) long- chain fatty acids and salts thereof C6-C12 (eg.
- acylcarnitines and derivatives N alpha.-acylated derivatives of lysine, arginine or histidine, or side-chain acylated derivatives of lysine or arginine, Nalpha.-acylated derivatives of dipeptides comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, Nalpha-acylated derivative of a tri peptide comprising any combination of a neutral amino acid and two charged amino acids, DSS (docusate sodium, CAS registry no [577-11-7]), docusate calcium, CAS registry no [128-49-4]), docusate potassium, CAS registry no [7491-09-0]), SDS (sodium dodecyl sulphate or sodium lauryl sulphate), sodium caprylate, cholic acid or derivatives thereof, bile acids and salts thereof and glycine or taurine conjugates
- DSS docusate sodium, CAS
- N-alkyl-N,N-dimethylammonio-1-propanesulfonates 3-cholamido-1- propyldimethylammonio-1-propanesulfonate
- cationic surfactants quaternary ammonium bases
- cetyl-trimethylammonium bromide cetylpyridinium chloride
- non-ionic surfactants eg. Dodecyl .beta.-D-glucopyranoside
- poloxamines eg.
- Tetronic's which are tetrafunctional block copolymers derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine, or the surfactant may be selected from the group of imidazoline derivatives, or mixtures thereof. In one embodiment, the surfactant is not a naturally existing compound. Each one of these specific surfactants constitutes an alternative embodiment of the disclosure.
- One embodiment provides for stable formulations of the antibodies and/or tau- binding fragments thereof, which comprise preferably a phosphate buffer with saline or a chosen salt, as well as preserved solutions and formulations containing a preservative, as well as multi-use preserved formulations suitable for pharmaceutical or veterinary use, comprising at least one the antibodies and/or tau-binding fragments thereof in a pharmaceutically acceptable formulation.
- preserved formulations contain at least one known preservative or optionally selected from the group consisting of at least one phenol, m-cresoi, p-cresol, o- cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g., hexahydrate), alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent.
- Any suitable concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or value therein, such as, but not limited to 0.001 , 0.003, 0.005, 0.009, 0.01 , 0.02, 0.03, 0.05, 0.09, 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9,
- Non-limiting examples include, no preservative, 0.1-2% m-cresol (e.g., 0.2, 0.3, 0.4, 0.5, 0.9, 1.0%), 0.1-3% benzyl alcohol (e.g., 0.5, 0.9,
- the antibodies and tau-binding fragments thereof of the disclosure can be incorporated into pharmaceutical compositions suitable for administration to a subject.
- the pharmaceutical composition comprises an antibody or tau-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Additional examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody or tau-binding fragment thereof.
- auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody or tau-binding fragment thereof.
- an appropriate amount of a pharmaceutica!ly-acceptable salt is used in the formulation to render the formulation isotonic.
- the carrier include saline, Ringer's solution and dextrose solution.
- the pH of the solution is from about 5 to about 8. In another embodiment, the pH is from about 7 to about 7.5.
- Further carriers include sustained release preparations such as semipermeable matrices of solid hydrophobic polymers containing the antibody or tau-binding fragment thereof, which matrices are in the form of shaped articles, e.g., films, liposomes or microparticles.
- a sustained release matrix is a matrix made of materials, usually polymers which are degradable by enzymatic or acid/base hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids.
- the sustained release matrix desirably is chosen by biocompatible materials such as liposomes, polylactides (poiy!actide acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid), polyanhydrides, poly(ortho)esters, polypeptides, hyaluronic acid, collagen, chondroitin sulfate, carboxylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such phenylalanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene,
- a preferred biodegradable matrix is a matrix of one of either polylactide, polyglycolide, or polylactide co-glycolide (co-polymers of lactic acid and glycolic acid).
- compositions of this invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
- liquid solutions e.g., injectable and infusible solutions
- dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
- compositions may also comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide) and/or preservatives.
- buffers e.g., neutral buffered saline or phosphate buffered saline
- carbohydrates e.g., glucose, mannose, sucrose or dextrans
- mannitol proteins
- proteins polypeptides or amino acids
- proteins e.glycine
- antioxidants e.g., g., chelating agents such as EDTA or glutathione
- adjuvants e.g., aluminum hydroxide
- preservatives e.g., aluminum hydroxide
- Dosage forms suitable for internal administration generally contain from about 0.1 milligram to about 500 milligrams of antibody or tau-binding fragment thereof (the active ingredient) per unit or container.
- the active ingredient will ordinarily be present in an amount of about 0.5-99.999% by weight based on the total weight of the composition.
- compositions/formulations typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
- Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or tau-binding fragment thereof) in the required amount in an appropriate solvent with one or a combination of ingredients
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for passive
- administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
- the antibody is administered by intravenous infusion or injection.
- the antibody is administered by intramuscular or subcutaneous injection.
- the antibodies and tau-binding fragments thereof of the present invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
- the antibody or tau-binding fragment thereof may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- an antibody or tau-binding fragment thereof of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
- the antibody or tau-binding fragment thereof (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
- the antibody or tau-binding fragment thereof may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- an antibody or tau-binding fragment thereof of the invention may be necessary to coat the antibody or tau-binding fragment thereof with, or co-administer the antibody or tau-binding fragment thereof with, a material to prevent its inactivation.
- Certain embodiments of the invention provide for the antibody or tau-binding fragment thereof to traverse the blood-brain barrier.
- Certain neurodegenerative diseases including AD and related tauopathies, are associated with an increase in permeability of the blood-brain barrier, such that the antibody or tau-binding fragment thereof can be readily introduced to the brain.
- AD and related tauopathies are associated with an increase in permeability of the blood-brain barrier, such that the antibody or tau-binding fragment thereof can be readily introduced to the brain.
- Physical methods of transporting the antibody or or tau-binding fragment thereof across the blood-brain barrier include, but are not limited to, circumventing the blood- brain barrier entirely, or by creating openings in the blood-brain barrier.
- Circumvention methods include, but are not limited to, direct injection into the brain (see, e.g., Papanastassiou et a!., Gene Therapy 9: 398-406 (2002)) and implanting a delivery device in the brain (see, e.g., Gill et a!., Nature Med. 9: 589-595 (2003); and Gliadel Wafers.TM., Guildford Pharmaceutical).
- Methods of creating openings in the barrier include, but are not limited to, ultrasound (see, e.g., U.S. Patent Publication No. 2002/0038086), osmotic pressure (e.g., by administration of hypertonic mannitol (Neuwelt, E. A., Implication of the Blood-Brain Barrier and its Manipulation, Vols 1 & 2, Plenum Press, N.Y. (1989))), permeabilization by, e.g., bradykinin or
- permeabilizer A-7 see, e.g., U.S. Pat. Nos. 5,112,596, 5,268, 164, 5,506,206, and 5,686,416), and transfection of neurons that straddle the blood-brain barrier with vectors containing genes encoding the antibody or tau-binding fragment thereof (see, e.g., U.S. Patent Publication No. 2003/0083299).
- Lipid-based methods of transporting the antibody or tau-binding fragment thereof across the blood-brain barrier include, but are not limited to, encapsulating the antibody or tau-binding fragment thereof in liposomes that are coupled to active fragments thereof that bind to receptors on the vascular endothelium of the blood- brain barrier (see, e.g., U.S. Patent Application Publication No. 20020025313), and coating the antibody or tau-binding fragment thereof in low-density lipoprotein particles (see, e.g., U.S. Patent Application Publication No. 20040204354) or apolipoprotein E (see, e.g., U.S. Patent Application Publication No. 20040131692).
- Receptor and channel-based methods of transporting the antibody or tau-binding fragment thereof across the blood-brain barrier include, but are not limited to, using glucocorticoid blockers to increase permeability of the blood-brain barrier (see, e.g., U.S. Patent Application Publication Nos. 2002/0065259, 2003/0162695, and
- the antibody or tau-binding fragment thereof may be administered by direct intraventricular or intrathecal injection, preferably via slow infusion to minimize impact on brain parenchyma.
- the desired antibody or tau- binding fragment thereof may also be delivered using a slow release implant in the brain, or implanted recombinant cells that produce the antibody or tau-binding fragment thereof.
- the blood brain barrier (BBB) may be permeabilized concomitant with the antibody or tau-binding fragment thereof administration, to permit movement of the antibody or tau-binding fragment thereof across the BBB.
- Permeabilizing agents include osmotic agents, such as hypertonic mannitol, or another
- permeabilizing agent such as bradykinin, an alkylglycerol, ultrasound,
- the antibodies and tau-binding fragments thereof could be useful to remove pathological tau from the brain out into the circulation, effectively preventing it from causing further damage to the neuronal cells and tissues.
- Supplementary or combination active compounds or therapeutic agents as disclosed elsewhere in this application can also be incorporated into the compositions, administered concurrently, or administered sequentially with the antibody or tau- binding fragment thereof.
- an antibody or tau-binding fragment thereof of the invention is coformulated with and/or coadministered with one or more additional therapeutic agents. These additional therapeutic agents can also be chemically conjugates to the antibodies or tau-binding fragments thereof described herein.
- an immunoconjugate having the formula (A)-(L)-(C), wherein: (A) is an antibody or binding fragment thereof of any one of claims 1-51 ; (L) is a linker; and (C) is an agent; and wherein said linker (L) links (A) to (C).
- (C) is an effector molecule, e.g., therapeutic agent, an imaging agent, a detectable agent, or a diagnostic agent.
- ADCs antibody-drug-conjugates
- a (L) linker is a molecule that is used to join the (A) to (C).
- the linker is capable of forming covalent bonds to both the antibody and to the effector molecule.
- Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
- the linkers may be joined to the constituent amino acids through their side groups (e.g., through a disulfide linkage to cysteine). However, in a preferred embodiment, the linkers will be joined to the alpha carbon amino and carboxyl groups of the terminal amino acids.
- immunoconjugates will comprise linkages which are cleavable in the vicinity of the target site. Cleavage of the linker to release the effector molecule from the antibody may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site.
- the linker unit is not cleavable and the drug is released, for example, by antibody degradation. A number of different reactions are avai!ab!e for covalent attachment of drugs and/or linkers to antibodies or fragments thereof.
- Afunctional agents such as
- dialdehydes or imidoesters have been used to link the amino group of a compound to amino groups of an antibody molecule.
- the Schiff base reaction also available for attachment of drugs to antibodies is the Schiff base reaction. This method involves the periodate oxidation of a drug that contains glycol or hydroxy groups, thus forming an aldehyde which is then reacted with the binding agent. Attachment occurs via formation of a Schiff base with amino groups of the binding agent.
- Isothiocyanates can also be used as coupling agents for covalently attaching drugs to binding agents.
- the linker is cleavable by a cleaving agent that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea).
- the linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). Most typical are peptidyl linkers that are cleavable by enzymes that are present in 191 P4D12-expressing cells. Other examples of such linkers are described, e.g., in U.S. Pat. No. 6,214,345.
- the peptidyl linker cleavable by an intracellular protease is a Val-Cit linker or a Phe-Lys linker (see, e.g., U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the Val-Cit linker).
- One advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
- the cleavable linker is pH-sensitive, i.e., sensitive to hydrolysis at certain pH values. Typically, the pH-sensitive linker hydrolyzable under acidic conditions.
- an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like can be used.
- the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the therapeutic agent via an acylhydrazone bond (see, e.g., U.S. Pat. No. 5,622,929).
- the linker is cleavable under reducing conditions (e.g., a disulfide linker).
- a disulfide linker e.g., a disulfide linker.
- disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2- pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl-alpha- (2-pyridyl-dithio)toluene)- , SPDB and SMPT.
- SATA N-succinimidyl-S-acetylthioacetate
- SPDP N-succinimi
- the linker is a malonate linker (Johnson et al., 1995, Anticancer Res. 15:1387-93), a maleimidobenzoyl linker (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1299-1304), or a 3'-N-amide analog (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1305-12).
- the linker unit is not cleavable and the drug is released by antibody degradation. (See U.S. Publication No. 2005/0238649).
- the linker is not substantially sensitive to the extracellular environment.
- “not substantially sensitive to the extracellular environment,” in the context of a linker means that no more than about 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers, in a sample of antibody-drug conjugate compound, are cleaved when the antibody-drug conjugate compound presents in an extracellular environment (e.g., in plasma).
- Whether a linker is not substantially sensitive to the extracellular environment can be determined, for example, by incubating with plasma the antibody-drug conjugate compound for a predetermined time period (e.g., 2, 4, 8, 16, or 24 hours) and then quantitating the amount of free drug present in the plasma.
- a predetermined time period e.g. 2, 4, 8, 16, or 24 hours
- the linker promotes cellular internalization. In certain embodiments, the linker promotes cellular internalization when conjugated to the therapeutic agent (i.e., in the milieu of the linker-therapeutic agent moiety of the antibody-drug conjugate compound as described herein).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Food Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Psychiatry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hospice & Palliative Care (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Zoology (AREA)
Priority Applications (27)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2017526550A JP6830061B2 (ja) | 2014-11-19 | 2015-11-18 | アルツハイマー病におけるヒト化タウ抗体 |
| CA2966964A CA2966964A1 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
| US15/528,333 US10160799B2 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in a alzheimer's disease |
| PL15837211T PL3221349T3 (pl) | 2014-11-19 | 2015-11-18 | Humanizowane przeciwciała tau w chorobie Alzheimera |
| SG11201703237VA SG11201703237VA (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
| EP20198475.4A EP3786182A1 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
| ES15837211T ES2848376T3 (es) | 2014-11-19 | 2015-11-18 | Anticuerpos de tau humanizados en la enfermedad de Alzheimer |
| KR1020177016640A KR20170126855A (ko) | 2014-11-19 | 2015-11-18 | 알쯔하이머병에서 인간화된 타우 항체 |
| LTEP15837211.0T LT3221349T (lt) | 2014-11-19 | 2015-11-18 | Humanizuoti tau antikūnai, esant alzheimerio ligai |
| SM20210055T SMT202100055T1 (it) | 2014-11-19 | 2015-11-18 | Anticorpi tau umanizzati nella malattia di alzheimer |
| RS20210132A RS61431B1 (sr) | 2014-11-19 | 2015-11-18 | Humanizovana antitela na tau u alchajmerovoj bolesti |
| SI201531480T SI3221349T1 (sl) | 2014-11-19 | 2015-11-18 | Humanizirano tau protitelo pri alzheimerjevi bolezni |
| MX2017006663A MX388142B (es) | 2014-11-19 | 2015-11-18 | Anticuerpos tau humanizados en enfermedad de alzheimer. |
| HRP20210124TT HRP20210124T1 (hr) | 2014-11-19 | 2015-11-18 | Humanizirana tau antitijela u alzheimerovoj bolesti |
| DK15837211.0T DK3221349T3 (da) | 2014-11-19 | 2015-11-18 | Humaniserede tau-antistoffer i Alzheimers sygdom |
| AU2015348012A AU2015348012B2 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in Alzheimer's disease |
| BR112017010498A BR112017010498A2 (pt) | 2014-11-19 | 2015-11-18 | anticorpos tau humanizados em doença de alzheimer |
| CN201580072454.2A CN107428820B (zh) | 2014-11-19 | 2015-11-18 | 在阿尔茨海默氏病中的人源化tau抗体 |
| HK18103940.5A HK1244495B (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
| EP15837211.0A EP3221349B1 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
| RU2017120688A RU2730668C2 (ru) | 2014-11-19 | 2015-11-18 | Гуманизированные тау-антитела при болезни альцгеймера |
| IL251921A IL251921B (en) | 2014-11-19 | 2017-04-25 | Tau antibodies of human origin in Alzheimer's disease |
| US16/181,088 US10745469B2 (en) | 2014-11-19 | 2018-11-05 | Humanized tau antibodies in alzheimer's disease |
| US16/926,062 US11319363B2 (en) | 2014-11-19 | 2020-07-10 | Humanized tau antibodies in Alzheimer's disease |
| AU2020227007A AU2020227007B2 (en) | 2014-11-19 | 2020-08-31 | Humanized tau antibodies in Alzheimer's disease |
| CY20211100012T CY1123746T1 (el) | 2014-11-19 | 2021-01-11 | Ανθρωποποιημενα tau αντισωματα σε νοσο του alzheimer |
| IL284250A IL284250A (en) | 2014-11-19 | 2021-06-21 | Tau antibodies of human origin in Alzheimer's disease |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462081809P | 2014-11-19 | 2014-11-19 | |
| US62/081,809 | 2014-11-19 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/528,333 A-371-Of-International US10160799B2 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in a alzheimer's disease |
| US16/181,088 Continuation US10745469B2 (en) | 2014-11-19 | 2018-11-05 | Humanized tau antibodies in alzheimer's disease |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016079597A1 true WO2016079597A1 (en) | 2016-05-26 |
| WO2016079597A8 WO2016079597A8 (en) | 2020-07-02 |
Family
ID=55411706
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2015/002610 Ceased WO2016079597A1 (en) | 2014-11-19 | 2015-11-18 | Humanized tau antibodies in alzheimer's disease |
Country Status (24)
| Country | Link |
|---|---|
| US (3) | US10160799B2 (https=) |
| EP (2) | EP3221349B1 (https=) |
| JP (3) | JP6830061B2 (https=) |
| KR (1) | KR20170126855A (https=) |
| CN (1) | CN107428820B (https=) |
| AU (2) | AU2015348012B2 (https=) |
| BR (1) | BR112017010498A2 (https=) |
| CA (1) | CA2966964A1 (https=) |
| CY (1) | CY1123746T1 (https=) |
| DK (1) | DK3221349T3 (https=) |
| ES (1) | ES2848376T3 (https=) |
| HR (1) | HRP20210124T1 (https=) |
| HU (1) | HUE053239T2 (https=) |
| IL (2) | IL251921B (https=) |
| LT (1) | LT3221349T (https=) |
| MX (2) | MX388142B (https=) |
| PL (1) | PL3221349T3 (https=) |
| PT (1) | PT3221349T (https=) |
| RS (1) | RS61431B1 (https=) |
| RU (2) | RU2020126237A (https=) |
| SG (1) | SG11201703237VA (https=) |
| SI (1) | SI3221349T1 (https=) |
| SM (1) | SMT202100055T1 (https=) |
| WO (1) | WO2016079597A1 (https=) |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017191561A1 (en) * | 2016-05-02 | 2017-11-09 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2017191560A1 (en) * | 2016-05-02 | 2017-11-09 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2019048017A1 (en) * | 2017-09-07 | 2019-03-14 | Danmarks Tekniske Universitet | METHODS FOR REMOVING NOX FROM A GAS STREAM CONTAINING MORE THAN ONE GAS COMPOUND |
| US10358485B2 (en) | 2017-10-16 | 2019-07-23 | Eisai R&D Management Co., Ltd. | Anti-Tau antibodies and uses thereof |
| WO2019161384A1 (en) * | 2018-02-19 | 2019-08-22 | New York University | Tau single domain antibodies |
| WO2019186276A2 (en) | 2018-03-28 | 2019-10-03 | Axon Neuroscience Se | Antibody-based methods of detecting and treating alzheimer's disease |
| US10501531B2 (en) | 2013-03-13 | 2019-12-10 | Prothena Biosciences Limited | Tau immunotherapy |
| JP2020511976A (ja) * | 2017-03-28 | 2020-04-23 | ヤンセン ファッシンズ アンド プリベンション ベーフェーJanssen Vaccines & Prevention B.V. | タウに特異的に結合する結合分子 |
| WO2020077380A1 (en) * | 2018-10-17 | 2020-04-23 | The University Of Queensland | Methods and compositions for treating tauopathies |
| US10752679B2 (en) | 2016-05-02 | 2020-08-25 | Prothena Biosciences Limited | Tau immunotherapy |
| WO2021048619A2 (en) | 2019-09-09 | 2021-03-18 | Axon Neuroscience Se | Biomarkers and treatments of alzheimer's disease and mild cognitive impairment |
| US10961302B2 (en) | 2019-03-03 | 2021-03-30 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US11370832B2 (en) | 2017-02-17 | 2022-06-28 | Denali Therapeutics Inc. | Anti-Tau antibodies and methods of use thereof |
| WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
| US11958896B2 (en) | 2017-05-02 | 2024-04-16 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US12291565B2 (en) | 2022-09-15 | 2025-05-06 | Voyager Therapeutics, Inc. | Tau binding compounds |
| WO2025122634A1 (en) | 2023-12-05 | 2025-06-12 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
| WO2026005695A1 (en) * | 2024-06-25 | 2026-01-02 | Islam Tohidul | Detection of oligomeric tau and soluble tau aggregates |
Families Citing this family (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11201703148TA (en) | 2014-11-05 | 2017-05-30 | Voyager Therapeutics Inc | Aadc polynucleotides for the treatment of parkinson's disease |
| SI3221349T1 (sl) * | 2014-11-19 | 2021-02-26 | Axon Neuroscience Se | Humanizirano tau protitelo pri alzheimerjevi bolezni |
| JOP20190269A1 (ar) | 2017-06-15 | 2019-11-20 | Voyager Therapeutics Inc | بولي نوكليوتيدات aadc لعلاج مرض باركنسون |
| AU2018308088B2 (en) | 2017-07-25 | 2025-05-29 | Truebinding, Inc. | Treating cancer by blocking the interaction of TIM-3 and its ligand |
| EP3746095A4 (en) | 2018-02-01 | 2021-04-21 | Nkmax Co., Ltd. | Method of producing natural killer cells and composition for treating cancer |
| WO2019213612A1 (en) * | 2018-05-03 | 2019-11-07 | Washington University | Methods of diagnosing and treating based on site-specific tau phosphorylation |
| SG11202011296VA (en) | 2018-05-15 | 2020-12-30 | Voyager Therapeutics Inc | Compositions and methods for the treatment of parkinson's disease |
| SG11202104549TA (en) * | 2018-11-08 | 2021-05-28 | Prothena Biosciences Ltd | Antibodies recognizing tau |
| AU2020214796A1 (en) | 2019-01-30 | 2021-07-29 | Truebinding, Inc. | Anti-Gal3 antibodies and uses thereof |
| TWI877179B (zh) * | 2019-06-27 | 2025-03-21 | 德商百靈佳殷格翰國際股份有限公司 | 抗-angpt2抗體 |
| MX2022001817A (es) * | 2019-08-13 | 2022-03-11 | Washington University St Louis | Metodos para detectar isoformas de la region de union a microtubulos (mtbr) tau y uso de las mismas. |
| EP4028775A4 (en) | 2019-09-10 | 2023-04-12 | Washington University | BLOOD-BASED TEST FOR DIAGNOSIS AND TREATMENT BASED ON SITE-SPECIFIC TAU PHOSPHORYLATION |
| EP4073119A1 (en) * | 2019-12-12 | 2022-10-19 | Alector LLC | Methods of use of anti-cd33 antibodies |
| US20230201136A1 (en) * | 2020-02-28 | 2023-06-29 | Genemo, Inc. | Methods and materials for diagnosis and treatment of neuronal disorder |
| WO2021242776A2 (en) | 2020-05-26 | 2021-12-02 | Truebinding, Inc. | Methods of treating inflammatory diseases by blocking galectin-3 |
| CA3192987A1 (en) * | 2020-09-22 | 2022-03-31 | Kathleen E. Clarence-Smith | Pharmaceutical combination for the treatment of human hypocholinergic disorders |
| CN113156134B (zh) * | 2020-11-26 | 2024-01-23 | 江苏荃信生物医药股份有限公司 | 用于检测人白介素23的elisa试剂盒及检测方法 |
| JP7847834B2 (ja) * | 2022-04-28 | 2026-04-20 | 国立大学法人鳥取大学 | 進行性核上性麻痺の診断マーカー |
| US20260048083A1 (en) * | 2022-08-10 | 2026-02-19 | Nkmax Co., Ltd. | Method of treating alzheimer's disease with expanded natural killer cells |
| CA3237624A1 (en) * | 2023-07-28 | 2025-04-24 | Genentech, Inc. | NEW USES FOR OMALIZUMAB |
Citations (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4816587A (en) | 1986-06-27 | 1989-03-28 | Richter Gedeon Vegyeszeti Gyar Rt. | Process for the preparation of 2-halogenated ergoline derivatives |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| US5112596A (en) | 1990-04-23 | 1992-05-12 | Alkermes, Inc. | Method for increasing blood-brain barrier permeability by administering a bradykinin agonist of blood-brain barrier permeability |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1997004801A1 (en) | 1995-07-27 | 1997-02-13 | Genentech, Inc. | Stabile isotonic lyophilized protein formulation |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US5712120A (en) | 1994-06-30 | 1998-01-27 | Centro De Immunologia Molecular | Method for obtaining modified immunoglobulins with reduced immunogenicity of murine antibody variable domains, compositions containing them |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5766883A (en) | 1989-04-29 | 1998-06-16 | Delta Biotechnology Limited | Polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1998044955A1 (en) | 1997-04-09 | 1998-10-15 | Mindset Ltd. | Recombinant antibodies specific for beta-amyloid ends, dna encoding and methods of use thereof |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5876969A (en) | 1992-01-31 | 1999-03-02 | Fleer; Reinhard | Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001018546A2 (en) | 1999-09-09 | 2001-03-15 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Screening for inhibitors of 'paired helical filaments' |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US20020025313A1 (en) | 1992-07-27 | 2002-02-28 | Micklus Michael J. | Targeting of liposomes to the blood-brain barrier |
| US20020034765A1 (en) | 1991-05-17 | 2002-03-21 | Merck & Co., Inc. | Method for reducing the immunogenicity of antibody variable domains |
| US20020038086A1 (en) | 2000-07-27 | 2002-03-28 | Hynynen Kullervo H. | Blood-brain barrier opening |
| US20020065259A1 (en) | 2000-08-30 | 2002-05-30 | Schatzberg Alan F. | Glucocorticoid blocking agents for increasing blood-brain barrier permeability |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US20030073713A1 (en) | 2000-10-30 | 2003-04-17 | Schoenhard Grant L. | Inhibitors of ABC drug transporters at the blood-brain barrier |
| US20030083299A1 (en) | 2000-11-04 | 2003-05-01 | Ferguson Ian A. | Non-invasive delivery of polypeptides through the blood-brain barrier |
| US20030129186A1 (en) | 2001-07-25 | 2003-07-10 | Biomarin Pharmaceutical Inc. | Compositions and methods for modulating blood-brain barrier transport |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20030162695A1 (en) | 2002-02-27 | 2003-08-28 | Schatzberg Alan F. | Glucocorticoid blocking agents for increasing blood-brain barrier permeability |
| WO2004007547A2 (en) | 2002-07-12 | 2004-01-22 | Axon Neuroscience Forschungs- Und Entwicklungs Gmbh | Truncated tau proteins |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040131692A1 (en) | 2001-05-05 | 2004-07-08 | Joerg Kreuter | Nanoparticles made of protein with coupled apolipoprotein e for penetration of the blood-brain barrier and methods for the production thereof |
| WO2004058258A1 (en) | 2002-12-24 | 2004-07-15 | Neurochem (International) Limited | Therapeutic formulations for the treatment of beta-amyloid related diseases |
| US20040204354A1 (en) | 2002-12-03 | 2004-10-14 | Thomas Nelson | Artificial low-density lipoprotein carriers for transport of substances across the blood-brain barrier |
| US20050089473A1 (en) | 2003-09-10 | 2005-04-28 | Cedars-Sinai Medical Center | Potassium channel mediated delivery of agents through the blood-brain barrier |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006034488A2 (en) | 2004-09-23 | 2006-03-30 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| US20110158986A1 (en) | 2000-02-24 | 2011-06-30 | Eli Lilly Corporation | Humanized antibodies that sequester amyloid beta peptide |
| WO2012049570A1 (en) * | 2010-10-11 | 2012-04-19 | Panima Pharmaceuticals Ag | Human anti-tau antibodies |
| WO2013041962A1 (en) | 2011-09-19 | 2013-03-28 | Axon Neuroscience Se | Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease |
| WO2013151762A1 (en) * | 2012-04-05 | 2013-10-10 | Ac Immune S.A. | Humanized tau antibody |
| WO2014100600A2 (en) * | 2012-12-21 | 2014-06-26 | Biogen Idec Ma Inc. | Human anti-tau antibodies |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2142190C (fr) | 1995-02-14 | 1998-01-27 | Marc Lessard | Conduite d'exfiltration d'air use |
| US8609097B2 (en) * | 2009-06-10 | 2013-12-17 | Hoffmann-La Roche Inc. | Use of an anti-Tau pS422 antibody for the treatment of brain diseases |
| ES2548686T3 (es) * | 2010-10-07 | 2015-10-20 | Ac Immune S.A. | Anticuerpos que reconocen fosfo-Tau |
| SI3221349T1 (sl) * | 2014-11-19 | 2021-02-26 | Axon Neuroscience Se | Humanizirano tau protitelo pri alzheimerjevi bolezni |
-
2015
- 2015-11-18 SI SI201531480T patent/SI3221349T1/sl unknown
- 2015-11-18 ES ES15837211T patent/ES2848376T3/es active Active
- 2015-11-18 WO PCT/IB2015/002610 patent/WO2016079597A1/en not_active Ceased
- 2015-11-18 DK DK15837211.0T patent/DK3221349T3/da active
- 2015-11-18 RU RU2020126237A patent/RU2020126237A/ru unknown
- 2015-11-18 PT PT158372110T patent/PT3221349T/pt unknown
- 2015-11-18 RS RS20210132A patent/RS61431B1/sr unknown
- 2015-11-18 EP EP15837211.0A patent/EP3221349B1/en active Active
- 2015-11-18 PL PL15837211T patent/PL3221349T3/pl unknown
- 2015-11-18 HU HUE15837211A patent/HUE053239T2/hu unknown
- 2015-11-18 HR HRP20210124TT patent/HRP20210124T1/hr unknown
- 2015-11-18 MX MX2017006663A patent/MX388142B/es unknown
- 2015-11-18 US US15/528,333 patent/US10160799B2/en active Active
- 2015-11-18 JP JP2017526550A patent/JP6830061B2/ja active Active
- 2015-11-18 SM SM20210055T patent/SMT202100055T1/it unknown
- 2015-11-18 EP EP20198475.4A patent/EP3786182A1/en active Pending
- 2015-11-18 AU AU2015348012A patent/AU2015348012B2/en active Active
- 2015-11-18 CN CN201580072454.2A patent/CN107428820B/zh active Active
- 2015-11-18 CA CA2966964A patent/CA2966964A1/en not_active Abandoned
- 2015-11-18 KR KR1020177016640A patent/KR20170126855A/ko not_active Ceased
- 2015-11-18 LT LTEP15837211.0T patent/LT3221349T/lt unknown
- 2015-11-18 SG SG11201703237VA patent/SG11201703237VA/en unknown
- 2015-11-18 RU RU2017120688A patent/RU2730668C2/ru active
- 2015-11-18 BR BR112017010498A patent/BR112017010498A2/pt not_active Application Discontinuation
-
2017
- 2017-04-25 IL IL251921A patent/IL251921B/en unknown
- 2017-05-19 MX MX2021014367A patent/MX2021014367A/es unknown
-
2018
- 2018-11-05 US US16/181,088 patent/US10745469B2/en active Active
-
2020
- 2020-03-18 JP JP2020047903A patent/JP6864763B2/ja active Active
- 2020-07-10 US US16/926,062 patent/US11319363B2/en active Active
- 2020-08-31 AU AU2020227007A patent/AU2020227007B2/en active Active
-
2021
- 2021-01-11 CY CY20211100012T patent/CY1123746T1/el unknown
- 2021-04-02 JP JP2021063583A patent/JP2021119774A/ja active Pending
- 2021-06-21 IL IL284250A patent/IL284250A/en unknown
Patent Citations (76)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4816587A (en) | 1986-06-27 | 1989-03-28 | Richter Gedeon Vegyeszeti Gyar Rt. | Process for the preparation of 2-halogenated ergoline derivatives |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| US5766883A (en) | 1989-04-29 | 1998-06-16 | Delta Biotechnology Limited | Polypeptides |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| US5506206A (en) | 1990-04-23 | 1996-04-09 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5112596A (en) | 1990-04-23 | 1992-05-12 | Alkermes, Inc. | Method for increasing blood-brain barrier permeability by administering a bradykinin agonist of blood-brain barrier permeability |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| US5686416A (en) | 1991-04-23 | 1997-11-11 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US20020034765A1 (en) | 1991-05-17 | 2002-03-21 | Merck & Co., Inc. | Method for reducing the immunogenicity of antibody variable domains |
| US6797492B2 (en) | 1991-05-17 | 2004-09-28 | Merck & Co., Inc. | Method for reducing the immunogenicity of antibody variable domains |
| US20040253645A1 (en) | 1991-05-17 | 2004-12-16 | Daugherty Bruce L. | Method for reducing the immunogenicity of antibody variable domains |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5876969A (en) | 1992-01-31 | 1999-03-02 | Fleer; Reinhard | Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof |
| US20020025313A1 (en) | 1992-07-27 | 2002-02-28 | Micklus Michael J. | Targeting of liposomes to the blood-brain barrier |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| US5712120A (en) | 1994-06-30 | 1998-01-27 | Centro De Immunologia Molecular | Method for obtaining modified immunoglobulins with reduced immunogenicity of murine antibody variable domains, compositions containing them |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| WO1997004801A1 (en) | 1995-07-27 | 1997-02-13 | Genentech, Inc. | Stabile isotonic lyophilized protein formulation |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| WO1998044955A1 (en) | 1997-04-09 | 1998-10-15 | Mindset Ltd. | Recombinant antibodies specific for beta-amyloid ends, dna encoding and methods of use thereof |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6538124B1 (en) | 1998-04-02 | 2003-03-25 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| EP1214598A2 (en) | 1999-09-09 | 2002-06-19 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | Screening for inhibitors of "paired helical filaments" |
| WO2001018546A2 (en) | 1999-09-09 | 2001-03-15 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Screening for inhibitors of 'paired helical filaments' |
| US20110158986A1 (en) | 2000-02-24 | 2011-06-30 | Eli Lilly Corporation | Humanized antibodies that sequester amyloid beta peptide |
| US20020038086A1 (en) | 2000-07-27 | 2002-03-28 | Hynynen Kullervo H. | Blood-brain barrier opening |
| US20020065259A1 (en) | 2000-08-30 | 2002-05-30 | Schatzberg Alan F. | Glucocorticoid blocking agents for increasing blood-brain barrier permeability |
| US20030073713A1 (en) | 2000-10-30 | 2003-04-17 | Schoenhard Grant L. | Inhibitors of ABC drug transporters at the blood-brain barrier |
| US20030083299A1 (en) | 2000-11-04 | 2003-05-01 | Ferguson Ian A. | Non-invasive delivery of polypeptides through the blood-brain barrier |
| US20040131692A1 (en) | 2001-05-05 | 2004-07-08 | Joerg Kreuter | Nanoparticles made of protein with coupled apolipoprotein e for penetration of the blood-brain barrier and methods for the production thereof |
| US20030129186A1 (en) | 2001-07-25 | 2003-07-10 | Biomarin Pharmaceutical Inc. | Compositions and methods for modulating blood-brain barrier transport |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20030162695A1 (en) | 2002-02-27 | 2003-08-28 | Schatzberg Alan F. | Glucocorticoid blocking agents for increasing blood-brain barrier permeability |
| US20050124533A1 (en) | 2002-02-27 | 2005-06-09 | Schatzberg Alan F. | Glucocorticoid blocking agents for increasing blood-brain barrier permeability stan-261con |
| WO2004007547A2 (en) | 2002-07-12 | 2004-01-22 | Axon Neuroscience Forschungs- Und Entwicklungs Gmbh | Truncated tau proteins |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20040204354A1 (en) | 2002-12-03 | 2004-10-14 | Thomas Nelson | Artificial low-density lipoprotein carriers for transport of substances across the blood-brain barrier |
| WO2004058258A1 (en) | 2002-12-24 | 2004-07-15 | Neurochem (International) Limited | Therapeutic formulations for the treatment of beta-amyloid related diseases |
| US20050089473A1 (en) | 2003-09-10 | 2005-04-28 | Cedars-Sinai Medical Center | Potassium channel mediated delivery of agents through the blood-brain barrier |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006034488A2 (en) | 2004-09-23 | 2006-03-30 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2012049570A1 (en) * | 2010-10-11 | 2012-04-19 | Panima Pharmaceuticals Ag | Human anti-tau antibodies |
| WO2013041962A1 (en) | 2011-09-19 | 2013-03-28 | Axon Neuroscience Se | Protein-based therapy and diagnosis of tau-mediated pathology in alzheimer's disease |
| WO2013151762A1 (en) * | 2012-04-05 | 2013-10-10 | Ac Immune S.A. | Humanized tau antibody |
| WO2014100600A2 (en) * | 2012-12-21 | 2014-06-26 | Biogen Idec Ma Inc. | Human anti-tau antibodies |
Non-Patent Citations (136)
| Title |
|---|
| A. L. LEHNINGER: "Biochemistry, second ed.,", 1975, WORTH PUBLISHERS, pages: 73 - 75 |
| ALLEY, S. C.: "Controlling the location of drug attachment in antibody-drug conjugates", PROCEEDINGS OF THE AACR, vol. 45, 27 March 2004 (2004-03-27) |
| ALMAGRO JC1; FRANSSON J: "Humanization of antibodies", FRONT BIOSCI., vol. 13, 2008, pages 1619 - 33 |
| ANGEL ET AL., MOL. IMMUNOL., vol. 30, 1993, pages 105 - 8 |
| ANONYMOUS: "Antibody Engineering -| MRC Technology", 1 January 2016 (2016-01-01), pages 1 - 2, XP055262689, Retrieved from the Internet <URL:http://www.antibodyengineering.co.uk/> [retrieved on 20160405] * |
| ANONYMOUS: "AXON Neuroscience SE", 6 July 2015 (2015-07-06), pages 1 - 4, XP055262638, Retrieved from the Internet <URL:http://www.axon-neuroscience.eu/docs/axon-neuroscience.pdf> [retrieved on 20160404] * |
| ANONYMOUS: "MRC Technology Announces Humanization of Anti-Tau Monoclonal Antibody for Alzheimer's Disease Therapy", 22 July 2014 (2014-07-22), pages 1 - 2, XP055262683, Retrieved from the Internet <URL:http://www.mrctechnology.org/mrc-technology-announces-humanization-anti-tau-monoclonal-antibody-alzheimers-disease-therapy/> [retrieved on 20160405] * |
| ANONYMOUS: "Our Process - Antibody Engineering | MRC Technology", 1 January 2016 (2016-01-01), pages 1 - 2, XP055262717, Retrieved from the Internet <URL:http://www.antibodyengineering.co.uk/our-process/> [retrieved on 20160405] * |
| ASUNI AA; BOUTAJANGOUT A; QUARTERMAIN D; SIGURDSSON EM: "Immunotherapy targeting pathological tau conformers in a tangle mouse model reduces brain pathology with associated functional improvements", J NEUROSES, vol. 27, 2007, pages 9115 - 9129 |
| BAUM ET AL., EMBO J., vol. 13, 1994, pages 3992 - 4001 |
| BINDON CI; HALE G; BRUGGEMANN M; WALDMANN H: "Human monoclonal IgG isotypes differ incomplement activating function at the level of C4 as well as C1q", J. EXP. MED., vol. 168, 1988, pages 127 - 42 |
| BRAAK, H: "Neuropathological stageing of Alzheimer-related changes", ACTA NEUROPATHOL, vol. 82, 1991, pages 239 - 259 |
| BRUGGEMANN M; WILLIAMS GT; BINDON CI; CLARK MR; WALKER MR; JEFFERIS R; WALDMANN H; NEUBERGER MS: "Comparison of the effector functions of human immunoglobulins using a matched set of chimeric antibodies", J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| BUEE, L; BUSSIERE, T; BUEE-SCHERRER, V.; DELACOURTE, A.; HOF, P.R.: "Tau protein isoforms, phosphorylation and role in neurodegenerative disorders", BRAIN RESEARCH. BRAIN RESEARCH REVIEWS., vol. 33, 2000, pages 95 - 130 |
| BUTNER KA; KIRSCHNER MW: "Tau protein binds to microtubules through a flexible array of distributed weak sites", J CELL BIOL, vol. 115, 1991, pages 717 - 730 |
| CALICETI, ADV DRUG DELIV REV, vol. 55, 2003, pages 1261 - 1277 |
| CALICETI, BIOCONJUG. CHEM., vol. 10, 1999, pages 638 - 646 |
| CAPEL, IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CARON, J. EXP MED., vol. 176, 1992, pages 1191 - 1195 |
| CARTER ET AL., PNAS USA, vol. 89, 1992, pages 4285 |
| CARTER ET AL., PROC. NAT!. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHADD ET AL.: "Therapeutic antibody expression technology", CURR OPIN BIOTECHNOL., vol. 12, no. 2, April 2001 (2001-04-01), pages 188 - 94 |
| CHEUNG, VIROLOGY, vol. 176, 1990, pages 546 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CHOTHIA, J. MOL, BIOL., vol. 196, 1987, pages 901 |
| CHOTHIA; LESK, J. MOL. BIOI., vol. 196, 1987, pages 901 - 917 |
| CLYNES ET AL., PNAS (USA, vol. 95, 1998, pages 652 - 656 |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| DAERON, ANNU. REV. IMMUNOL, vol. 15, 1997, pages 203 - 234 |
| DB KAAS, Q; RUIZ, M; LEFRANC, M.-P.: "T cell receptor and MHC structural data", NUCL. ACIDS. RES., vol. 32, 2004, pages D208 - D210 |
| DUBOWCHIK; WALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123 |
| EDELMAN G M, PROC NATL ACAD SCI USA, vol. 63, no. 1, 1969, pages 78 - 85 |
| EUR. J. IMMUNOL., vol. 6, pages 599 - 601 |
| EVA KONTSEKOVA ET AL: "Identification of structural determinants on tau protein essential for its pathological function: novel therapeutic target for tau immunotherapy in Alzheimer?s disease", ALZHEIMERS RES THER, BIOMED CENTRAL LTD, LONDON, UK, vol. 6, no. 4, 1 August 2014 (2014-08-01), pages 45, XP021196288, ISSN: 1758-9193, DOI: 10.1186/ALZRT277 * |
| EVA KONTSEKOVA; NORBERT ZILKA; BRANISLAV KOVACECH; PETR NOVAK; MICHAI NOVAK: "First-in-man tau vaccine targeting structural determinants essential for pathological tau-tau interaction reduces tau oligomerisation and neurofibrillary degeneration in an Alzheimer's disease model", ALZHEIMER'S RESEARCH & THERAPY, vol. 6, 2014, pages 44 |
| FENG, Y ET AL.: "Conjugates of Small Molecule Drugs with Antibodies and Other Proteins", BIOMEDICINES, vol. 2, 2014, pages 1 - 13 |
| FOOTE; WINTER, J. MOL. BIOL., vol. 224, 1992, pages 487 - 499 |
| FRIEDHOFF P; SCHNEIDER A; MANDELKOW EM; MANDELKOW E: "Rapid assembly of Alzheimer-like paired helical filaments from microtubule-associated protein tau monitored by fluorescence in solution", BIOCHEMISTRY, vol. 37, no. 28, 1998, pages 10223 - 30 |
| FROST, B.; DIAMOND, M.I: "The expanding realm of prion phenomena in neurodegenerative disease", PRION, vol. 3, no. 2, 2009, pages 74 - 7 |
| FROST, B.; JACKS, R.L.; DIAMOND, M.I.: "Propagation of tau misfolding from the outside to the inside of a cell", J BIOL CHEM, vol. 284, no. 19, 2009, pages 12845 - 52 |
| G. E. MORRIS,: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| GAZZANO-SANTORO ET AL., J, IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GHETIE, IMMUNOL RES, vol. 25, 2002, pages 97 - 113 |
| GILL ET AL., NATURE MED, vol. 9, 2003, pages 589 - 595 |
| GOMEZ-ISLA T; HOLLISTER R; WEST H; MUI S; GROWDON JH; PETERSEN RC; PARISI JE; HYMAN BT: "Neuronal loss correlates with but exceeds neurofibrillary tangles in Alzheimer's disease", ANN NEURO!, vol. 41, 1997, pages 17 - 24 |
| GÓMEZ-ISLA, T.; PRICE, J.L.; MCKEEL JR, D.W.; MORRIS, J.C.; GROWDON, J.H.; HYMAN, B.T: "Profound loss of layer II entorhinal cortex neurons occurs in very mild Alzheimer's disease", J NEUROSCI, vol. 16, no. 14, 1996, pages 4491 - 500 |
| GÓMEZ-RAMOS, A.; DÍAZ-HERNÁNDEZ, M.; CUADROS, R.; HERNANDEZ, F.; AVILA, J.: "Extracellular tau is toxic to neuronal cells", FEBS LETT, vol. 580, no. 20, 2006, pages 4842 - 50 |
| GONZALES ET AL., MOL. IMMUNOL., vol. 41, 2004, pages 863 |
| GREENSPAN; BONA, FASEB J., vol. 7, no. 5, 1989, pages 437 - 444 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HAAS, J. LAB. CLIN; MED., vol. 126, 1995, pages 330 - 41 |
| HAMBLETT, K J.: "Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an anti-CD30 antibody-drug conjugate", PROCEEDINGS OF THE AACR, 27 March 2004 (2004-03-27) |
| HAMPEL, H.; BLENNOW, K.; SHAW, L.M.; HOESSLER, Y.C.; ZETTERBERG, H.; TROJANOWSKI, J.Q: "Total and phosphorylated tau protein as biological markers of Alzheimer's disease", EXP GERONTOL, vol. 45, no. 1, 2010, pages 30 - 40 |
| HARDY, TRENDS NEUROSCI., vol. 20, 1997, pages 154 - 9 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HUSE WD; SASTRY S; IVERSON SA; KANG AS; ALTING-MEES M; BURTON DR; BENKOVIC SJ; LERNER RA: "Generation of a large combinatorial library of the immunoglobulin repertoire in phage lambda", SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| IMMUN. REV, vol. 62, 1982, pages 185 |
| J. IMMUNOL., vol. 151, 1993, pages 2296 |
| J. R. ROBINSON,: "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| JAKES, R.; NOVAK, M.; DAVISON, M.; WISCHIK, C.M.: "Identification of 3- and 4-repeat tau isoforms within the PHF in Alzheimer's disease", EMBO J, vol. 10, 1991, pages 2725 - 2729 |
| JOHNNSON, B. ET AL., ANAL. BIOCHEM., vol. 198, 1991, pages 268 - 277 |
| JOHNSON ET AL., ANTICANCER RES., vol. 15, 1995, pages 1387 - 93 |
| JOHNSSON, B ET AL., J. MOL. RECOGNIT., vol. 8, 1995, pages 125 - 131 |
| JONES, NATURE, vol. 321, 1986, pages 522 - 525 |
| JONSSON, U. ET AL., ANN. BIOL. CLIN., vol. 51, 1993, pages 19 - 26 |
| JONSSON, U. ET AL., BIOTECHNIQUES, vol. 11, 1991, pages 620 - 627 |
| KAAS, Q.; LEFRANC, M,-P., CURRENT BIOINFORMATICS, vol. 2, 2007, pages 21 - 30 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th Ed.", 1991 |
| KABAT: "Sequences of Proteins of Immunological Interest 5th Ed.", 1991, NATIONAL INSTITUTES OF HEALTH |
| KARISSON; LARSSON: "Affinity Measurement Using Surface Plasmon Resonance, in Methods in Molecular Biology", vol. 248, 2008, HUMANA PRESS INC. |
| KHEE HWANG W Y ET AL: "Use of human germline genes in a CDR homology-based approach to antibody humanization", METHODS, ACADEMIC PRESS, US, vol. 36, no. 1, 1 May 2005 (2005-05-01), pages 35 - 42, XP027216561, ISSN: 1046-2023, [retrieved on 20050419] * |
| KIM, J. IMMUNOL., vol. 24, 1994, pages 249 |
| KIRKLAND ET AL., J, IMMUNOL., vol. 137, 1986, pages 3614 |
| KOVACECH B; NOVAK M.: "Tau truncation is a productive posttransiational modification of neurofibrillary degeneration in Alzheimer's disease", CURR ALZHEIMER RES, vol. 7, no. 8, December 2010 (2010-12-01), pages 708 - 16 |
| KOVACECH B; SKRABANA R; NOVAK M: "Transition of tau protein from disordered to misordered in Alzheimer's disease", NEURODEGENER DIS, vol. 7, 2010, pages 24 - 27 |
| KOVACECH B; SKRABANA R; NOVAK M: "Transition of tau protein from disordered to misordered in Alzheimer's disease", NEURODEGENER DIS, vol. 7, pages 24 - 27 |
| LAU ET AL., BIOORG-MED-CHEM, vol. 3, no. 10, 1995, pages 1299 - 1304 |
| LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1305 - 12 |
| LEE G; NEVE RL; KOSIK KS: "The microtubule binding domain of tau protein", NEURON, vol. 2, 1989, pages 1615 - 1624 |
| LEFRANC M.-P., IMMUNOLOGY TODAY, vol. 18, 1997, pages 509 |
| LEFRANC M.-P., THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136 |
| LEFRANC, M.-P.; POMMIE, C.; RUIZ, M.; GIUDICELLI, V.; FOULQUIER, E.; TRUONG, L; THOUVENIN-CONTET, V.; LEFRANC, DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| LEFRANC, M-P; LEFRANC, G: "The Immunoglobulin Facts Book", 2001, ACADEMIC PRESS |
| MA ET AL.: "Human antibody expression in transgenic rats: comparison of chimeric IgH loci with human VH, D and JH but bearing different rat C-gene regions", J IMMUNOL METHODS, vol. 400-401, 31 December 2013 (2013-12-31), pages 78 - 86 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOREL, MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MORPURGO, APPL. BIOCHEM. SIOTECHNOL, vol. 56, 1996, pages 59 - 72 |
| MORRISON, PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MORRISON, S. L ET AL., PROC. NATL. ACAD SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| NEDDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NEUBERGER, M. S. ET AL., NATURE, vol. 314, 1985, pages 268 - 270 |
| NEUWELT, E. A.: "Implication of the Blood-Brain Barrier and its Manipulation", vol. 1, 2, 1989, PLENUM PRESS |
| NEVILLE, BIOL. CHEM., vol. 264, 1989, pages 14653 - 14661 |
| NISSINOFF, J. IMMUNOL., vol. 147, 1991, pages 2429 - 2438 |
| NOVAK, M.; KABAT, J.; WISCHIK, C.M: "Molecular characterization of the minimal protease resistant tau unit of the Alzheimer's disease paired helical filament", EMBO J, vol. 12, 1993, pages 365 - 70 |
| OSOL, A.: "Remington's Pharmaceutical Sciences 16th edition,", 1980 |
| PAPANASTASSIOU, GENE THERAPY, vol. 9, 2002, pages 398 - 406 |
| PEARSON; LIPMAN, PROC, NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
| POPE ME; SOSTE MV; EYFORD BA; ANDERSON NL; PEARSON TW, J IMMUNOL METHODS, vol. 341, no. 1-2, 2009, pages 86 - 96 |
| PRESTA ET AL., J IMMUNOL, vol. 151, 1993, pages 2623 |
| PRESTA ET AL., J. IMMUNOL, vol. 151, 1993, pages 2623 |
| PRESTA, L.G.: "Engineering of therapeutic antibodies to minimize immunogenicity and optimize function", ADVANCED DRUG DELIVERY REVIEWS, vol. 58, no. 5-6, 2006, pages 640 - 656 |
| RAVETCH; KINET, ANNU, REV, IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| RAVETCH; KINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RIECHMANN, L ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROLLIN-SILLAIRE ET AL.: "Reasons that prevent the inclusion of Alzheimer's disease patients in clinical trials", BR J CLIN PHARMACOL., vol. 75, no. 4, April 2013 (2013-04-01), pages 1089 - 1097 |
| RUIZ, M.; LEFRANC, M.-P., IMMUNOGENETICS, vol. 53, 2002, pages 857 - 883 |
| SAFDARI Y1; FARAJNIA S; ASGHARZADEH M; KHAIIII M: "Antibody humanization methods - a review and update", BIOTECHNOL GENET ENG REV., vol. 29, 2013, pages 175 - 86 |
| SAMBROOK ET AL.: "Molecular cloning: a laboratory manual; 3rd edition,", 2001, COLD SPRING HARBOR LABORATORY |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001 |
| SASTRY L; ALTING-MESS M; HUSE WD; SHORT JM; SORGE JA; HAY BN; JANDA KD; BENKOVIC SJ; LERNER RA: "Cloning of the immunological repertoire in for generation of monoclonal catalytic antibodies: construction of a heavy chain variable region-specific cDNA library", PROC NATL ACAD SCI USA, vol. 86, 1989, pages 5728 - 5732 |
| SHAW DR; KHAZAELI MB; LOBUGLIO AF: "Mouse/human chimeric antibodies to a tumor associated antigen: biologic activity of the four human IgG subclasses", J. NATL. CANCER INST., vol. 80, 1988, pages 1553 - 9 |
| SHOPES, B, J. IMMUNOL., vol. 148, 1992, pages 2918 - 2922 |
| SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296 |
| SKRABANA, R.; SEVCIK, I.; NOVAK, M.: "Intrinsically disordered proteins in the neurodegenerative processes: formation of tau protein paired helical filaments and their analysis", CELL MOL NEUROBIOL, vol. 26, 2006, pages 1085 - 1097 |
| SMITH; WATERMAN, AD. APP, MATH., vol. 2, 1981, pages 482 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| STEPLEWSKI Z; SUN LK; SHEARMAN CW; GHRAYEB J; DADDONA P; KOPROWSKI,H: "Biological activity of human-mouse IgG1, IgG2, IgG3, and IgG4chimeric monoclonal antibodies with antitumor specificity", PROC. NATL. ACAD. SCI, 1988 |
| STEVENSON ET AL., ANTI-CANCER DRUG DESIGN, vol. 3, 1989, pages 219 - 230 |
| TANIGUCHI S; SUZUKI N; MASUDA M; HISANAGA S; IWATSUBO T; GOEDERT M; HASEGAWA M: "Inhibition of heparin-induced tau filament formation by phenothiazines, polyphenols, and porphyrins", J BIOL CHEM, vol. 280, 2005, pages 7614 - 7823 |
| TANIGUCHI T; SUMIDA M; HIRAOKA S; TOMOO K; KAKEHI T; MINOURA K; SUGIYAMA S; INAKA K; ISHIDA T; SAITO N: "Effects of different anti-tau antibodies on tau fibrillogenesis: RTA-1 and RTA-2 counteract tau aggregation", FEBS LETT, vol. 579, 2005, pages 1399 - 1404 |
| TATUSOVA ET AL.: "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS MICROBIOL., vol. 174, 1999, pages 247 - 250 |
| THORPE, CANCER RES., vol. 47, 1987, pages 5924 - 5931 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VON BERGEN M; FRIEDHOFF P; BIERNAT J; HEBERLE J; MANDELKOW EM; MANDELKOW E: "Assembly of tau protein into Alzheimer paired helical filaments depends on a local sequence motif ((306)VQIVYK(311)) forming beta structure", PROC NATL ACAD SCI U S A, vol. 97, 2000, pages 5129 - 5134 |
| VOROBJEV, NUCLEOSIDES NUCLEOTIDES, vol. 18, 1999, pages 2745 - 2750 |
| WAWRZYNCZAK: "Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer", 1987, OXFORD U. PRESS |
| WEST, M.J.; COLEMAN, P.D.; FLOOD, D.G.; TRONCOSO, J.C.: "Differences in the pattern of hippocampal neuronal loss in normal ageing and Alzheimer's disease", LANCET, vol. 344, 1994, pages 769 - 72 |
| WILLIAM E. PAUL: "Fundamental Immunology, 8th Edition,", 2008, LIPPINCOTT WILLIAMS & WILKINS |
| WISCHIK, C.M.; NOVAK, M.; EDWARDS, P.C.; KLUG, A.; TICHELAAR, W.; CROWTHER, R.A.: "Structural characterization of the core of the paired helical filament of Alzheimer disease", PROC NATL ACAD SCI USA, vol. 85, 1988, pages 4884 - 8 |
| WISCHIK, C.M.; NOVAK, M.; THØGERSEN, H.C.; EDWARDS, P.C.; RUNSWICK, M.J.; JAKES, R.; WALKER, J.E.; MIISTEIN, C.; ROTH, M; KLUG, A: "Isolation of a fragment of tau derived from the core of the paired helical filament of Alzheimer disease", PROC NATL ACAD SCI USA, vol. 85, 1988, pages 4506 - 10 |
| YAGHOUB SAFDARI ET AL: "Antibody humanization methods - a review and update", BIOTECHNOLOGY AND GENETIC ENGINEERING REVIEWS, vol. 29, no. 2, 1 October 2013 (2013-10-01), GB, pages 175 - 186, XP055250530, ISSN: 0264-8725, DOI: 10.1080/02648725.2013.801235 * |
| ZHANG ET AL.: "Monoclonal antibody expression in mammalian cells", METHODS MOL BIOL, vol. 907, 2012, pages 341 - 58 |
| ZILKA, N.: "Chaperone-like Antibodies Targeting Misfolded Tau Protein: New Vistas in the Immunotherapy of Neurodegenerative Foldopathies", JOURNAL OF ALZHEIMER'S DISEASE, vol. 15, 2008, pages 169 - 179 |
Cited By (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10501531B2 (en) | 2013-03-13 | 2019-12-10 | Prothena Biosciences Limited | Tau immunotherapy |
| US11643457B2 (en) | 2013-03-13 | 2023-05-09 | Prothena Biosciences Limited | Tau immunotherapy |
| US12195525B2 (en) | 2016-05-02 | 2025-01-14 | Prothena Biosciences Limited | Tau immunotherapy |
| IL262726B1 (en) * | 2016-05-02 | 2024-03-01 | Prothena Biosciences Ltd | Antibodies recognizing tau |
| CN109219615B (zh) * | 2016-05-02 | 2022-12-09 | 普罗塞纳生物科学有限公司 | 识别tau的抗体 |
| US11492393B2 (en) | 2016-05-02 | 2022-11-08 | Prothena Biosciences Limited | Tau immunotherapy |
| IL262726B2 (en) * | 2016-05-02 | 2024-07-01 | Prothena Biosciences Ltd | Antibodies recognizing tau |
| CN109219615A (zh) * | 2016-05-02 | 2019-01-15 | 普罗塞纳生物科学有限公司 | 识别tau的抗体 |
| US11584791B2 (en) | 2016-05-02 | 2023-02-21 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2017191560A1 (en) * | 2016-05-02 | 2017-11-09 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US10752679B2 (en) | 2016-05-02 | 2020-08-25 | Prothena Biosciences Limited | Tau immunotherapy |
| US10906964B2 (en) | 2016-05-02 | 2021-02-02 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2017191561A1 (en) * | 2016-05-02 | 2017-11-09 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US10889638B2 (en) | 2016-05-02 | 2021-01-12 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US11370832B2 (en) | 2017-02-17 | 2022-06-28 | Denali Therapeutics Inc. | Anti-Tau antibodies and methods of use thereof |
| JP2020511976A (ja) * | 2017-03-28 | 2020-04-23 | ヤンセン ファッシンズ アンド プリベンション ベーフェーJanssen Vaccines & Prevention B.V. | タウに特異的に結合する結合分子 |
| JP7109467B2 (ja) | 2017-03-28 | 2022-07-29 | ヤンセン ファッシンズ アンド プリベンション ベーフェー | タウに特異的に結合する結合分子 |
| US11958896B2 (en) | 2017-05-02 | 2024-04-16 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US12479910B2 (en) | 2017-05-02 | 2025-11-25 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2019048017A1 (en) * | 2017-09-07 | 2019-03-14 | Danmarks Tekniske Universitet | METHODS FOR REMOVING NOX FROM A GAS STREAM CONTAINING MORE THAN ONE GAS COMPOUND |
| CN111630064B (zh) * | 2017-10-16 | 2023-06-27 | 卫材R&D管理有限公司 | 抗Tau抗体及其用途 |
| US11578120B2 (en) | 2017-10-16 | 2023-02-14 | Eisai R&D Management Co., Ltd. | Anti-Tau antibodies and uses thereof |
| US10358485B2 (en) | 2017-10-16 | 2019-07-23 | Eisai R&D Management Co., Ltd. | Anti-Tau antibodies and uses thereof |
| US10829547B2 (en) | 2017-10-16 | 2020-11-10 | Eisai R&D Management Co., Ltd. | Anti-tau antibodies and uses thereof |
| CN111630064A (zh) * | 2017-10-16 | 2020-09-04 | 卫材R&D管理有限公司 | 抗Tau抗体及其用途 |
| US12398201B2 (en) | 2018-02-19 | 2025-08-26 | New York University | Tau single domain antibodies |
| WO2019161384A1 (en) * | 2018-02-19 | 2019-08-22 | New York University | Tau single domain antibodies |
| WO2019186276A2 (en) | 2018-03-28 | 2019-10-03 | Axon Neuroscience Se | Antibody-based methods of detecting and treating alzheimer's disease |
| US20210347869A1 (en) * | 2018-10-17 | 2021-11-11 | The University Of Queensland | Methods and compositions for treating tauopathies |
| WO2020077380A1 (en) * | 2018-10-17 | 2020-04-23 | The University Of Queensland | Methods and compositions for treating tauopathies |
| US10961302B2 (en) | 2019-03-03 | 2021-03-30 | Prothena Biosciences Limited | Antibodies recognizing tau |
| EP3935083A4 (en) * | 2019-03-03 | 2022-11-30 | Prothena Biosciences Limited | Antibodies recognizing tau |
| US11926659B2 (en) | 2019-03-03 | 2024-03-12 | Prothena Biosciences Limited | Antibodies recognizing tau |
| WO2021048619A2 (en) | 2019-09-09 | 2021-03-18 | Axon Neuroscience Se | Biomarkers and treatments of alzheimer's disease and mild cognitive impairment |
| WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
| US12291565B2 (en) | 2022-09-15 | 2025-05-06 | Voyager Therapeutics, Inc. | Tau binding compounds |
| WO2025122634A1 (en) | 2023-12-05 | 2025-06-12 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
| WO2026005695A1 (en) * | 2024-06-25 | 2026-01-02 | Islam Tohidul | Detection of oligomeric tau and soluble tau aggregates |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11319363B2 (en) | Humanized tau antibodies in Alzheimer's disease | |
| KR102496162B1 (ko) | 트랜스티레틴(ttr) 아밀로이드증의 항체-기반의 치료 및 이를 위한 인간-유래의 항체 | |
| AU2013361107B2 (en) | Human anti-tau antibodies | |
| TWI545132B (zh) | 人類化抗-TAU(pS422)抗體及使用方法 | |
| CN109415434B (zh) | 识别tau的抗体 | |
| KR102791519B1 (ko) | 미스폴딩된 tdp-43 결합 분자 | |
| JP2025094219A (ja) | 抗tdp-43結合分子およびその使用 | |
| TW202100550A (zh) | 識別tau之抗體 | |
| CN108135986A (zh) | 对于Tau的截短的Asp421表位特异性的基于抗体的分子和它们在诊断和治疗Tau疾病中的用途 | |
| HK40044666A (en) | Humanized tau antibodies in alzheimer's disease | |
| HK1244495B (en) | Humanized tau antibodies in alzheimer's disease | |
| US20240018226A1 (en) | Methods of using antibodies recognizing tau | |
| EA052560B1 (ru) | Способы применения антител, распознающих тау | |
| JP2018508193A (ja) | メディンを認識する抗体 | |
| HK40061324A (en) | Anti-tdp-43 binding molecules and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15837211 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 251921 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2966964 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201703237V Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2017526550 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015348012 Country of ref document: AU Date of ref document: 20151118 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15528333 Country of ref document: US Ref document number: MX/A/2017/006663 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017010498 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015837211 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20177016640 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017120688 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017010498 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170518 |